data_39JO # _entry.id 39JO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.417 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 39JO pdb_000039jo 10.2210/pdb39jo/pdb WWPDB D_1000311806 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-11-04 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 39JO _pdbx_database_status.recvd_initial_deposition_date 2026-10-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'WT enzyme' 4ZNG unspecified PDB 'H38S mutant of the enzyme' 6XMR unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email takuji.tanaka@usask.ca _pdbx_contact_author.name_first Takuji _pdbx_contact_author.name_last Tanaka _pdbx_contact_author.name_mi 0000-0003-3304-5830 _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-3304-5830 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Xu, S.' 1 ? 'Grochulski, P.' 2 ? 'Tanaka, T.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Biochimica et Biophysica Acta (BBA) - Proteins and Proteomics' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 1872 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural basis for the allosteric behaviour and substrate specificity of Lactococcus lactis Prolidase' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, S.' 1 ? primary 'Grochulski, P.' 2 ? primary 'Tanaka, T.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptidase M24 family protein' 40399.699 1 3.4.13.9 Del101 ? ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 2 ? ? ? ? 3 non-polymer syn 'HEXAETHYLENE GLYCOL' 282.331 1 ? ? ? ? 4 non-polymer syn 'ACETATE ION' 59.044 1 ? ? ? ? 5 water nat water 18.015 619 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Prolidase,Xaa-Pro dipeptidase,Xaa-Pro peptidase family protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;IGSEFMSKIERISAFLNDKEVDMTFITNPTTLNYLTGLAIDPHERIAGLMIFRDSTPMLFTPALEVEKAKEHTSGLDIFG YEDSQNPWEVVKNHVKSDVKSIAVESDIPLAKTEGLKAQFGDINFVNLTPLIERMRLIKSADEIEKMKVAGDFADKCFEI GFATAAERNGVTESDIVAKIEYEMKRMGVPQMSFDTLVLSGARAANPHGAPENVEIQENKLLLFDLGVMSGGYASDATRT IAIGQPNDFDAEIHKIVKEAQQAAMDFIKPGVTAHEVDAVARDLITKAGYGEYFNHRLGHGIGMDVHEYPSIVAGNDLVI QEGMCFSNEPGIYIPGKVGVRIEDCLYVTENGCESFTHTDHDLLIF ; _entity_poly.pdbx_seq_one_letter_code_can ;IGSEFMSKIERISAFLNDKEVDMTFITNPTTLNYLTGLAIDPHERIAGLMIFRDSTPMLFTPALEVEKAKEHTSGLDIFG YEDSQNPWEVVKNHVKSDVKSIAVESDIPLAKTEGLKAQFGDINFVNLTPLIERMRLIKSADEIEKMKVAGDFADKCFEI GFATAAERNGVTESDIVAKIEYEMKRMGVPQMSFDTLVLSGARAANPHGAPENVEIQENKLLLFDLGVMSGGYASDATRT IAIGQPNDFDAEIHKIVKEAQQAAMDFIKPGVTAHEVDAVARDLITKAGYGEYFNHRLGHGIGMDVHEYPSIVAGNDLVI QEGMCFSNEPGIYIPGKVGVRIEDCLYVTENGCESFTHTDHDLLIF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 'HEXAETHYLENE GLYCOL' P6G 4 'ACETATE ION' ACT 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 GLY n 1 3 SER n 1 4 GLU n 1 5 PHE n 1 6 MET n 1 7 SER n 1 8 LYS n 1 9 ILE n 1 10 GLU n 1 11 ARG n 1 12 ILE n 1 13 SER n 1 14 ALA n 1 15 PHE n 1 16 LEU n 1 17 ASN n 1 18 ASP n 1 19 LYS n 1 20 GLU n 1 21 VAL n 1 22 ASP n 1 23 MET n 1 24 THR n 1 25 PHE n 1 26 ILE n 1 27 THR n 1 28 ASN n 1 29 PRO n 1 30 THR n 1 31 THR n 1 32 LEU n 1 33 ASN n 1 34 TYR n 1 35 LEU n 1 36 THR n 1 37 GLY n 1 38 LEU n 1 39 ALA n 1 40 ILE n 1 41 ASP n 1 42 PRO n 1 43 HIS n 1 44 GLU n 1 45 ARG n 1 46 ILE n 1 47 ALA n 1 48 GLY n 1 49 LEU n 1 50 MET n 1 51 ILE n 1 52 PHE n 1 53 ARG n 1 54 ASP n 1 55 SER n 1 56 THR n 1 57 PRO n 1 58 MET n 1 59 LEU n 1 60 PHE n 1 61 THR n 1 62 PRO n 1 63 ALA n 1 64 LEU n 1 65 GLU n 1 66 VAL n 1 67 GLU n 1 68 LYS n 1 69 ALA n 1 70 LYS n 1 71 GLU n 1 72 HIS n 1 73 THR n 1 74 SER n 1 75 GLY n 1 76 LEU n 1 77 ASP n 1 78 ILE n 1 79 PHE n 1 80 GLY n 1 81 TYR n 1 82 GLU n 1 83 ASP n 1 84 SER n 1 85 GLN n 1 86 ASN n 1 87 PRO n 1 88 TRP n 1 89 GLU n 1 90 VAL n 1 91 VAL n 1 92 LYS n 1 93 ASN n 1 94 HIS n 1 95 VAL n 1 96 LYS n 1 97 SER n 1 98 ASP n 1 99 VAL n 1 100 LYS n 1 101 SER n 1 102 ILE n 1 103 ALA n 1 104 VAL n 1 105 GLU n 1 106 SER n 1 107 ASP n 1 108 ILE n 1 109 PRO n 1 110 LEU n 1 111 ALA n 1 112 LYS n 1 113 THR n 1 114 GLU n 1 115 GLY n 1 116 LEU n 1 117 LYS n 1 118 ALA n 1 119 GLN n 1 120 PHE n 1 121 GLY n 1 122 ASP n 1 123 ILE n 1 124 ASN n 1 125 PHE n 1 126 VAL n 1 127 ASN n 1 128 LEU n 1 129 THR n 1 130 PRO n 1 131 LEU n 1 132 ILE n 1 133 GLU n 1 134 ARG n 1 135 MET n 1 136 ARG n 1 137 LEU n 1 138 ILE n 1 139 LYS n 1 140 SER n 1 141 ALA n 1 142 ASP n 1 143 GLU n 1 144 ILE n 1 145 GLU n 1 146 LYS n 1 147 MET n 1 148 LYS n 1 149 VAL n 1 150 ALA n 1 151 GLY n 1 152 ASP n 1 153 PHE n 1 154 ALA n 1 155 ASP n 1 156 LYS n 1 157 CYS n 1 158 PHE n 1 159 GLU n 1 160 ILE n 1 161 GLY n 1 162 PHE n 1 163 ALA n 1 164 THR n 1 165 ALA n 1 166 ALA n 1 167 GLU n 1 168 ARG n 1 169 ASN n 1 170 GLY n 1 171 VAL n 1 172 THR n 1 173 GLU n 1 174 SER n 1 175 ASP n 1 176 ILE n 1 177 VAL n 1 178 ALA n 1 179 LYS n 1 180 ILE n 1 181 GLU n 1 182 TYR n 1 183 GLU n 1 184 MET n 1 185 LYS n 1 186 ARG n 1 187 MET n 1 188 GLY n 1 189 VAL n 1 190 PRO n 1 191 GLN n 1 192 MET n 1 193 SER n 1 194 PHE n 1 195 ASP n 1 196 THR n 1 197 LEU n 1 198 VAL n 1 199 LEU n 1 200 SER n 1 201 GLY n 1 202 ALA n 1 203 ARG n 1 204 ALA n 1 205 ALA n 1 206 ASN n 1 207 PRO n 1 208 HIS n 1 209 GLY n 1 210 ALA n 1 211 PRO n 1 212 GLU n 1 213 ASN n 1 214 VAL n 1 215 GLU n 1 216 ILE n 1 217 GLN n 1 218 GLU n 1 219 ASN n 1 220 LYS n 1 221 LEU n 1 222 LEU n 1 223 LEU n 1 224 PHE n 1 225 ASP n 1 226 LEU n 1 227 GLY n 1 228 VAL n 1 229 MET n 1 230 SER n 1 231 GLY n 1 232 GLY n 1 233 TYR n 1 234 ALA n 1 235 SER n 1 236 ASP n 1 237 ALA n 1 238 THR n 1 239 ARG n 1 240 THR n 1 241 ILE n 1 242 ALA n 1 243 ILE n 1 244 GLY n 1 245 GLN n 1 246 PRO n 1 247 ASN n 1 248 ASP n 1 249 PHE n 1 250 ASP n 1 251 ALA n 1 252 GLU n 1 253 ILE n 1 254 HIS n 1 255 LYS n 1 256 ILE n 1 257 VAL n 1 258 LYS n 1 259 GLU n 1 260 ALA n 1 261 GLN n 1 262 GLN n 1 263 ALA n 1 264 ALA n 1 265 MET n 1 266 ASP n 1 267 PHE n 1 268 ILE n 1 269 LYS n 1 270 PRO n 1 271 GLY n 1 272 VAL n 1 273 THR n 1 274 ALA n 1 275 HIS n 1 276 GLU n 1 277 VAL n 1 278 ASP n 1 279 ALA n 1 280 VAL n 1 281 ALA n 1 282 ARG n 1 283 ASP n 1 284 LEU n 1 285 ILE n 1 286 THR n 1 287 LYS n 1 288 ALA n 1 289 GLY n 1 290 TYR n 1 291 GLY n 1 292 GLU n 1 293 TYR n 1 294 PHE n 1 295 ASN n 1 296 HIS n 1 297 ARG n 1 298 LEU n 1 299 GLY n 1 300 HIS n 1 301 GLY n 1 302 ILE n 1 303 GLY n 1 304 MET n 1 305 ASP n 1 306 VAL n 1 307 HIS n 1 308 GLU n 1 309 TYR n 1 310 PRO n 1 311 SER n 1 312 ILE n 1 313 VAL n 1 314 ALA n 1 315 GLY n 1 316 ASN n 1 317 ASP n 1 318 LEU n 1 319 VAL n 1 320 ILE n 1 321 GLN n 1 322 GLU n 1 323 GLY n 1 324 MET n 1 325 CYS n 1 326 PHE n 1 327 SER n 1 328 ASN n 1 329 GLU n 1 330 PRO n 1 331 GLY n 1 332 ILE n 1 333 TYR n 1 334 ILE n 1 335 PRO n 1 336 GLY n 1 337 LYS n 1 338 VAL n 1 339 GLY n 1 340 VAL n 1 341 ARG n 1 342 ILE n 1 343 GLU n 1 344 ASP n 1 345 CYS n 1 346 LEU n 1 347 TYR n 1 348 VAL n 1 349 THR n 1 350 GLU n 1 351 ASN n 1 352 GLY n 1 353 CYS n 1 354 GLU n 1 355 SER n 1 356 PHE n 1 357 THR n 1 358 HIS n 1 359 THR n 1 360 ASP n 1 361 HIS n 1 362 ASP n 1 363 LEU n 1 364 LEU n 1 365 ILE n 1 366 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 366 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'pepQ, AMHIJAGA_00052, B8W88_04220, QUD52_07525, RZO27_02460' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lactococcus lactis subsp. lactis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1360 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 P6G non-polymer . 'HEXAETHYLENE GLYCOL' 'POLYETHYLENE GLYCOL PEG400' 'C12 H26 O7' 282.331 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 -4 -4 ILE ILE A . n A 1 2 GLY 2 -3 -3 GLY GLY A . n A 1 3 SER 3 -2 -2 SER SER A . n A 1 4 GLU 4 -1 -1 GLU GLU A . n A 1 5 PHE 5 0 0 PHE PHE A . n A 1 6 MET 6 1 1 MET MET A . n A 1 7 SER 7 2 2 SER SER A . n A 1 8 LYS 8 3 3 LYS LYS A . n A 1 9 ILE 9 4 4 ILE ILE A . n A 1 10 GLU 10 5 5 GLU GLU A . n A 1 11 ARG 11 6 6 ARG ARG A . n A 1 12 ILE 12 7 7 ILE ILE A . n A 1 13 SER 13 8 8 SER SER A . n A 1 14 ALA 14 9 9 ALA ALA A . n A 1 15 PHE 15 10 10 PHE PHE A . n A 1 16 LEU 16 11 11 LEU LEU A . n A 1 17 ASN 17 12 12 ASN ASN A . n A 1 18 ASP 18 13 13 ASP ASP A . n A 1 19 LYS 19 14 14 LYS LYS A . n A 1 20 GLU 20 15 15 GLU GLU A . n A 1 21 VAL 21 16 16 VAL VAL A . n A 1 22 ASP 22 17 17 ASP ASP A . n A 1 23 MET 23 18 18 MET MET A . n A 1 24 THR 24 19 19 THR THR A . n A 1 25 PHE 25 20 20 PHE PHE A . n A 1 26 ILE 26 21 21 ILE ILE A . n A 1 27 THR 27 22 22 THR THR A . n A 1 28 ASN 28 23 23 ASN ASN A . n A 1 29 PRO 29 24 24 PRO PRO A . n A 1 30 THR 30 25 25 THR THR A . n A 1 31 THR 31 26 26 THR THR A . n A 1 32 LEU 32 27 27 LEU LEU A . n A 1 33 ASN 33 28 28 ASN ASN A . n A 1 34 TYR 34 29 29 TYR TYR A . n A 1 35 LEU 35 30 30 LEU LEU A . n A 1 36 THR 36 31 31 THR THR A . n A 1 37 GLY 37 32 32 GLY GLY A . n A 1 38 LEU 38 33 33 LEU LEU A . n A 1 39 ALA 39 34 34 ALA ALA A . n A 1 40 ILE 40 35 35 ILE ILE A . n A 1 41 ASP 41 36 36 ASP ASP A . n A 1 42 PRO 42 37 37 PRO PRO A . n A 1 43 HIS 43 38 38 HIS HIS A . n A 1 44 GLU 44 39 39 GLU GLU A . n A 1 45 ARG 45 40 40 ARG ARG A . n A 1 46 ILE 46 41 41 ILE ILE A . n A 1 47 ALA 47 42 42 ALA ALA A . n A 1 48 GLY 48 43 43 GLY GLY A . n A 1 49 LEU 49 44 44 LEU LEU A . n A 1 50 MET 50 45 45 MET MET A . n A 1 51 ILE 51 46 46 ILE ILE A . n A 1 52 PHE 52 47 47 PHE PHE A . n A 1 53 ARG 53 48 48 ARG ARG A . n A 1 54 ASP 54 49 49 ASP ASP A . n A 1 55 SER 55 50 50 SER SER A . n A 1 56 THR 56 51 51 THR THR A . n A 1 57 PRO 57 52 52 PRO PRO A . n A 1 58 MET 58 53 53 MET MET A . n A 1 59 LEU 59 54 54 LEU LEU A . n A 1 60 PHE 60 55 55 PHE PHE A . n A 1 61 THR 61 56 56 THR THR A . n A 1 62 PRO 62 57 57 PRO PRO A . n A 1 63 ALA 63 58 58 ALA ALA A . n A 1 64 LEU 64 59 59 LEU LEU A . n A 1 65 GLU 65 60 60 GLU GLU A . n A 1 66 VAL 66 61 61 VAL VAL A . n A 1 67 GLU 67 62 62 GLU GLU A . n A 1 68 LYS 68 63 63 LYS LYS A . n A 1 69 ALA 69 64 64 ALA ALA A . n A 1 70 LYS 70 65 65 LYS LYS A . n A 1 71 GLU 71 66 66 GLU GLU A . n A 1 72 HIS 72 67 67 HIS HIS A . n A 1 73 THR 73 68 68 THR THR A . n A 1 74 SER 74 69 69 SER SER A . n A 1 75 GLY 75 70 70 GLY GLY A . n A 1 76 LEU 76 71 71 LEU LEU A . n A 1 77 ASP 77 72 72 ASP ASP A . n A 1 78 ILE 78 73 73 ILE ILE A . n A 1 79 PHE 79 74 74 PHE PHE A . n A 1 80 GLY 80 75 75 GLY GLY A . n A 1 81 TYR 81 76 76 TYR TYR A . n A 1 82 GLU 82 77 77 GLU GLU A . n A 1 83 ASP 83 78 78 ASP ASP A . n A 1 84 SER 84 79 79 SER SER A . n A 1 85 GLN 85 80 80 GLN GLN A . n A 1 86 ASN 86 81 81 ASN ASN A . n A 1 87 PRO 87 82 82 PRO PRO A . n A 1 88 TRP 88 83 83 TRP TRP A . n A 1 89 GLU 89 84 84 GLU GLU A . n A 1 90 VAL 90 85 85 VAL VAL A . n A 1 91 VAL 91 86 86 VAL VAL A . n A 1 92 LYS 92 87 87 LYS LYS A . n A 1 93 ASN 93 88 88 ASN ASN A . n A 1 94 HIS 94 89 89 HIS HIS A . n A 1 95 VAL 95 90 90 VAL VAL A . n A 1 96 LYS 96 91 91 LYS LYS A . n A 1 97 SER 97 92 92 SER SER A . n A 1 98 ASP 98 93 93 ASP ASP A . n A 1 99 VAL 99 94 94 VAL VAL A . n A 1 100 LYS 100 95 95 LYS LYS A . n A 1 101 SER 101 96 96 SER SER A . n A 1 102 ILE 102 97 97 ILE ILE A . n A 1 103 ALA 103 98 98 ALA ALA A . n A 1 104 VAL 104 99 99 VAL VAL A . n A 1 105 GLU 105 100 100 GLU GLU A . n A 1 106 SER 106 101 101 SER SER A . n A 1 107 ASP 107 102 102 ASP ASP A . n A 1 108 ILE 108 103 103 ILE ILE A . n A 1 109 PRO 109 104 104 PRO PRO A . n A 1 110 LEU 110 105 105 LEU LEU A . n A 1 111 ALA 111 106 106 ALA ALA A . n A 1 112 LYS 112 107 107 LYS LYS A . n A 1 113 THR 113 108 108 THR THR A . n A 1 114 GLU 114 109 109 GLU GLU A . n A 1 115 GLY 115 110 110 GLY GLY A . n A 1 116 LEU 116 111 111 LEU LEU A . n A 1 117 LYS 117 112 112 LYS LYS A . n A 1 118 ALA 118 113 113 ALA ALA A . n A 1 119 GLN 119 114 114 GLN GLN A . n A 1 120 PHE 120 115 115 PHE PHE A . n A 1 121 GLY 121 116 116 GLY GLY A . n A 1 122 ASP 122 117 117 ASP ASP A . n A 1 123 ILE 123 118 118 ILE ILE A . n A 1 124 ASN 124 119 119 ASN ASN A . n A 1 125 PHE 125 120 120 PHE PHE A . n A 1 126 VAL 126 121 121 VAL VAL A . n A 1 127 ASN 127 122 122 ASN ASN A . n A 1 128 LEU 128 123 123 LEU LEU A . n A 1 129 THR 129 124 124 THR THR A . n A 1 130 PRO 130 125 125 PRO PRO A . n A 1 131 LEU 131 126 126 LEU LEU A . n A 1 132 ILE 132 127 127 ILE ILE A . n A 1 133 GLU 133 128 128 GLU GLU A . n A 1 134 ARG 134 129 129 ARG ARG A . n A 1 135 MET 135 130 130 MET MET A . n A 1 136 ARG 136 131 131 ARG ARG A . n A 1 137 LEU 137 132 132 LEU LEU A . n A 1 138 ILE 138 133 133 ILE ILE A . n A 1 139 LYS 139 134 134 LYS LYS A . n A 1 140 SER 140 135 135 SER SER A . n A 1 141 ALA 141 136 136 ALA ALA A . n A 1 142 ASP 142 137 137 ASP ASP A . n A 1 143 GLU 143 138 138 GLU GLU A . n A 1 144 ILE 144 139 139 ILE ILE A . n A 1 145 GLU 145 140 140 GLU GLU A . n A 1 146 LYS 146 141 141 LYS LYS A . n A 1 147 MET 147 142 142 MET MET A . n A 1 148 LYS 148 143 143 LYS LYS A . n A 1 149 VAL 149 144 144 VAL VAL A . n A 1 150 ALA 150 145 145 ALA ALA A . n A 1 151 GLY 151 146 146 GLY GLY A . n A 1 152 ASP 152 147 147 ASP ASP A . n A 1 153 PHE 153 148 148 PHE PHE A . n A 1 154 ALA 154 149 149 ALA ALA A . n A 1 155 ASP 155 150 150 ASP ASP A . n A 1 156 LYS 156 151 151 LYS LYS A . n A 1 157 CYS 157 152 152 CYS CYS A . n A 1 158 PHE 158 153 153 PHE PHE A . n A 1 159 GLU 159 154 154 GLU GLU A . n A 1 160 ILE 160 155 155 ILE ILE A . n A 1 161 GLY 161 156 156 GLY GLY A . n A 1 162 PHE 162 157 157 PHE PHE A . n A 1 163 ALA 163 158 158 ALA ALA A . n A 1 164 THR 164 159 159 THR THR A . n A 1 165 ALA 165 160 160 ALA ALA A . n A 1 166 ALA 166 161 161 ALA ALA A . n A 1 167 GLU 167 162 162 GLU GLU A . n A 1 168 ARG 168 163 163 ARG ARG A . n A 1 169 ASN 169 164 164 ASN ASN A . n A 1 170 GLY 170 165 165 GLY GLY A . n A 1 171 VAL 171 166 166 VAL VAL A . n A 1 172 THR 172 167 167 THR THR A . n A 1 173 GLU 173 168 168 GLU GLU A . n A 1 174 SER 174 169 169 SER SER A . n A 1 175 ASP 175 170 170 ASP ASP A . n A 1 176 ILE 176 171 171 ILE ILE A . n A 1 177 VAL 177 172 172 VAL VAL A . n A 1 178 ALA 178 173 173 ALA ALA A . n A 1 179 LYS 179 174 174 LYS LYS A . n A 1 180 ILE 180 175 175 ILE ILE A . n A 1 181 GLU 181 176 176 GLU GLU A . n A 1 182 TYR 182 177 177 TYR TYR A . n A 1 183 GLU 183 178 178 GLU GLU A . n A 1 184 MET 184 179 179 MET MET A . n A 1 185 LYS 185 180 180 LYS LYS A . n A 1 186 ARG 186 181 181 ARG ARG A . n A 1 187 MET 187 182 182 MET MET A . n A 1 188 GLY 188 183 183 GLY GLY A . n A 1 189 VAL 189 184 184 VAL VAL A . n A 1 190 PRO 190 185 185 PRO PRO A . n A 1 191 GLN 191 186 186 GLN GLN A . n A 1 192 MET 192 187 187 MET MET A . n A 1 193 SER 193 188 188 SER SER A . n A 1 194 PHE 194 189 189 PHE PHE A . n A 1 195 ASP 195 190 190 ASP ASP A . n A 1 196 THR 196 191 191 THR THR A . n A 1 197 LEU 197 192 192 LEU LEU A . n A 1 198 VAL 198 193 193 VAL VAL A . n A 1 199 LEU 199 194 194 LEU LEU A . n A 1 200 SER 200 195 195 SER SER A . n A 1 201 GLY 201 196 196 GLY GLY A . n A 1 202 ALA 202 197 197 ALA ALA A . n A 1 203 ARG 203 198 198 ARG ARG A . n A 1 204 ALA 204 199 199 ALA ALA A . n A 1 205 ALA 205 200 200 ALA ALA A . n A 1 206 ASN 206 201 201 ASN ASN A . n A 1 207 PRO 207 202 202 PRO PRO A . n A 1 208 HIS 208 203 203 HIS HIS A . n A 1 209 GLY 209 204 204 GLY GLY A . n A 1 210 ALA 210 205 205 ALA ALA A . n A 1 211 PRO 211 206 206 PRO PRO A . n A 1 212 GLU 212 207 207 GLU GLU A . n A 1 213 ASN 213 208 208 ASN ASN A . n A 1 214 VAL 214 209 209 VAL VAL A . n A 1 215 GLU 215 210 210 GLU GLU A . n A 1 216 ILE 216 211 211 ILE ILE A . n A 1 217 GLN 217 212 212 GLN GLN A . n A 1 218 GLU 218 213 213 GLU GLU A . n A 1 219 ASN 219 214 214 ASN ASN A . n A 1 220 LYS 220 215 215 LYS LYS A . n A 1 221 LEU 221 216 216 LEU LEU A . n A 1 222 LEU 222 217 217 LEU LEU A . n A 1 223 LEU 223 218 218 LEU LEU A . n A 1 224 PHE 224 219 219 PHE PHE A . n A 1 225 ASP 225 220 220 ASP ASP A . n A 1 226 LEU 226 221 221 LEU LEU A . n A 1 227 GLY 227 222 222 GLY GLY A . n A 1 228 VAL 228 223 223 VAL VAL A . n A 1 229 MET 229 224 224 MET MET A . n A 1 230 SER 230 225 225 SER SER A . n A 1 231 GLY 231 226 226 GLY GLY A . n A 1 232 GLY 232 227 227 GLY GLY A . n A 1 233 TYR 233 228 228 TYR TYR A . n A 1 234 ALA 234 229 229 ALA ALA A . n A 1 235 SER 235 230 230 SER SER A . n A 1 236 ASP 236 231 231 ASP ASP A . n A 1 237 ALA 237 232 232 ALA ALA A . n A 1 238 THR 238 233 233 THR THR A . n A 1 239 ARG 239 234 234 ARG ARG A . n A 1 240 THR 240 235 235 THR THR A . n A 1 241 ILE 241 236 236 ILE ILE A . n A 1 242 ALA 242 237 237 ALA ALA A . n A 1 243 ILE 243 238 238 ILE ILE A . n A 1 244 GLY 244 239 239 GLY GLY A . n A 1 245 GLN 245 240 240 GLN GLN A . n A 1 246 PRO 246 241 241 PRO PRO A . n A 1 247 ASN 247 242 242 ASN ASN A . n A 1 248 ASP 248 243 243 ASP ASP A . n A 1 249 PHE 249 244 244 PHE PHE A . n A 1 250 ASP 250 245 245 ASP ASP A . n A 1 251 ALA 251 246 246 ALA ALA A . n A 1 252 GLU 252 247 247 GLU GLU A . n A 1 253 ILE 253 248 248 ILE ILE A . n A 1 254 HIS 254 249 249 HIS HIS A . n A 1 255 LYS 255 250 250 LYS LYS A . n A 1 256 ILE 256 251 251 ILE ILE A . n A 1 257 VAL 257 252 252 VAL VAL A . n A 1 258 LYS 258 253 253 LYS LYS A . n A 1 259 GLU 259 254 254 GLU GLU A . n A 1 260 ALA 260 255 255 ALA ALA A . n A 1 261 GLN 261 256 256 GLN GLN A . n A 1 262 GLN 262 257 257 GLN GLN A . n A 1 263 ALA 263 258 258 ALA ALA A . n A 1 264 ALA 264 259 259 ALA ALA A . n A 1 265 MET 265 260 260 MET MET A . n A 1 266 ASP 266 261 261 ASP ASP A . n A 1 267 PHE 267 262 262 PHE PHE A . n A 1 268 ILE 268 263 263 ILE ILE A . n A 1 269 LYS 269 264 264 LYS LYS A . n A 1 270 PRO 270 265 265 PRO PRO A . n A 1 271 GLY 271 266 266 GLY GLY A . n A 1 272 VAL 272 267 267 VAL VAL A . n A 1 273 THR 273 268 268 THR THR A . n A 1 274 ALA 274 269 269 ALA ALA A . n A 1 275 HIS 275 270 270 HIS HIS A . n A 1 276 GLU 276 271 271 GLU GLU A . n A 1 277 VAL 277 272 272 VAL VAL A . n A 1 278 ASP 278 273 273 ASP ASP A . n A 1 279 ALA 279 274 274 ALA ALA A . n A 1 280 VAL 280 275 275 VAL VAL A . n A 1 281 ALA 281 276 276 ALA ALA A . n A 1 282 ARG 282 277 277 ARG ARG A . n A 1 283 ASP 283 278 278 ASP ASP A . n A 1 284 LEU 284 279 279 LEU LEU A . n A 1 285 ILE 285 280 280 ILE ILE A . n A 1 286 THR 286 281 281 THR THR A . n A 1 287 LYS 287 282 282 LYS LYS A . n A 1 288 ALA 288 283 283 ALA ALA A . n A 1 289 GLY 289 284 284 GLY GLY A . n A 1 290 TYR 290 285 285 TYR TYR A . n A 1 291 GLY 291 286 286 GLY GLY A . n A 1 292 GLU 292 287 287 GLU GLU A . n A 1 293 TYR 293 288 288 TYR TYR A . n A 1 294 PHE 294 289 289 PHE PHE A . n A 1 295 ASN 295 290 290 ASN ASN A . n A 1 296 HIS 296 291 291 HIS HIS A . n A 1 297 ARG 297 292 292 ARG ARG A . n A 1 298 LEU 298 293 293 LEU LEU A . n A 1 299 GLY 299 294 294 GLY GLY A . n A 1 300 HIS 300 295 295 HIS HIS A . n A 1 301 GLY 301 296 296 GLY GLY A . n A 1 302 ILE 302 297 297 ILE ILE A . n A 1 303 GLY 303 298 298 GLY GLY A . n A 1 304 MET 304 299 299 MET MET A . n A 1 305 ASP 305 300 300 ASP ASP A . n A 1 306 VAL 306 301 301 VAL VAL A . n A 1 307 HIS 307 302 302 HIS HIS A . n A 1 308 GLU 308 303 303 GLU GLU A . n A 1 309 TYR 309 304 304 TYR TYR A . n A 1 310 PRO 310 305 305 PRO PRO A . n A 1 311 SER 311 306 306 SER SER A . n A 1 312 ILE 312 307 307 ILE ILE A . n A 1 313 VAL 313 308 308 VAL VAL A . n A 1 314 ALA 314 309 309 ALA ALA A . n A 1 315 GLY 315 310 310 GLY GLY A . n A 1 316 ASN 316 311 311 ASN ASN A . n A 1 317 ASP 317 312 312 ASP ASP A . n A 1 318 LEU 318 313 313 LEU LEU A . n A 1 319 VAL 319 314 314 VAL VAL A . n A 1 320 ILE 320 315 315 ILE ILE A . n A 1 321 GLN 321 316 316 GLN GLN A . n A 1 322 GLU 322 317 317 GLU GLU A . n A 1 323 GLY 323 318 318 GLY GLY A . n A 1 324 MET 324 319 319 MET MET A . n A 1 325 CYS 325 320 320 CYS CYS A . n A 1 326 PHE 326 321 321 PHE PHE A . n A 1 327 SER 327 322 322 SER SER A . n A 1 328 ASN 328 323 323 ASN ASN A . n A 1 329 GLU 329 324 324 GLU GLU A . n A 1 330 PRO 330 325 325 PRO PRO A . n A 1 331 GLY 331 326 326 GLY GLY A . n A 1 332 ILE 332 327 327 ILE ILE A . n A 1 333 TYR 333 328 328 TYR TYR A . n A 1 334 ILE 334 329 329 ILE ILE A . n A 1 335 PRO 335 330 330 PRO PRO A . n A 1 336 GLY 336 331 331 GLY GLY A . n A 1 337 LYS 337 332 332 LYS LYS A . n A 1 338 VAL 338 333 333 VAL VAL A . n A 1 339 GLY 339 334 334 GLY GLY A . n A 1 340 VAL 340 335 335 VAL VAL A . n A 1 341 ARG 341 336 336 ARG ARG A . n A 1 342 ILE 342 337 337 ILE ILE A . n A 1 343 GLU 343 338 338 GLU GLU A . n A 1 344 ASP 344 339 339 ASP ASP A . n A 1 345 CYS 345 340 340 CYS CYS A . n A 1 346 LEU 346 341 341 LEU LEU A . n A 1 347 TYR 347 342 342 TYR TYR A . n A 1 348 VAL 348 343 343 VAL VAL A . n A 1 349 THR 349 344 344 THR THR A . n A 1 350 GLU 350 345 345 GLU GLU A . n A 1 351 ASN 351 346 346 ASN ASN A . n A 1 352 GLY 352 347 347 GLY GLY A . n A 1 353 CYS 353 348 348 CYS CYS A . n A 1 354 GLU 354 349 349 GLU GLU A . n A 1 355 SER 355 350 350 SER SER A . n A 1 356 PHE 356 351 351 PHE PHE A . n A 1 357 THR 357 352 352 THR THR A . n A 1 358 HIS 358 353 353 HIS HIS A . n A 1 359 THR 359 354 354 THR THR A . n A 1 360 ASP 360 355 355 ASP ASP A . n A 1 361 HIS 361 356 356 HIS HIS A . n A 1 362 ASP 362 357 357 ASP ASP A . n A 1 363 LEU 363 358 358 LEU LEU A . n A 1 364 LEU 364 359 359 LEU LEU A . n A 1 365 ILE 365 360 360 ILE ILE A . n A 1 366 PHE 366 361 361 PHE PHE A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id MN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id MN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 401 401 MN MN A . C 2 MN 1 402 402 MN MN A . D 3 P6G 1 403 403 P6G P6G A . E 4 ACT 1 404 404 ACT ACT A . F 5 HOH 1 501 3298 HOH HOH A . F 5 HOH 2 502 2823 HOH HOH A . F 5 HOH 3 503 317 HOH HOH A . F 5 HOH 4 504 2396 HOH HOH A . F 5 HOH 5 505 3158 HOH HOH A . F 5 HOH 6 506 1431 HOH HOH A . F 5 HOH 7 507 1586 HOH HOH A . F 5 HOH 8 508 241 HOH HOH A . F 5 HOH 9 509 2850 HOH HOH A . F 5 HOH 10 510 410 HOH HOH A . F 5 HOH 11 511 1743 HOH HOH A . F 5 HOH 12 512 3275 HOH HOH A . F 5 HOH 13 513 1606 HOH HOH A . F 5 HOH 14 514 45 HOH HOH A . F 5 HOH 15 515 1279 HOH HOH A . F 5 HOH 16 516 604 HOH HOH A . F 5 HOH 17 517 126 HOH HOH A . F 5 HOH 18 518 324 HOH HOH A . F 5 HOH 19 519 3287 HOH HOH A . F 5 HOH 20 520 3066 HOH HOH A . F 5 HOH 21 521 2828 HOH HOH A . F 5 HOH 22 522 2835 HOH HOH A . F 5 HOH 23 523 2856 HOH HOH A . F 5 HOH 24 524 2431 HOH HOH A . F 5 HOH 25 525 96 HOH HOH A . F 5 HOH 26 526 3168 HOH HOH A . F 5 HOH 27 527 2860 HOH HOH A . F 5 HOH 28 528 106 HOH HOH A . F 5 HOH 29 529 95 HOH HOH A . F 5 HOH 30 530 143 HOH HOH A . F 5 HOH 31 531 766 HOH HOH A . F 5 HOH 32 532 1107 HOH HOH A . F 5 HOH 33 533 32 HOH HOH A . F 5 HOH 34 534 3048 HOH HOH A . F 5 HOH 35 535 843 HOH HOH A . F 5 HOH 36 536 3266 HOH HOH A . F 5 HOH 37 537 329 HOH HOH A . F 5 HOH 38 538 118 HOH HOH A . F 5 HOH 39 539 2870 HOH HOH A . F 5 HOH 40 540 1093 HOH HOH A . F 5 HOH 41 541 67 HOH HOH A . F 5 HOH 42 542 31 HOH HOH A . F 5 HOH 43 543 185 HOH HOH A . F 5 HOH 44 544 683 HOH HOH A . F 5 HOH 45 545 65 HOH HOH A . F 5 HOH 46 546 3286 HOH HOH A . F 5 HOH 47 547 92 HOH HOH A . F 5 HOH 48 548 2782 HOH HOH A . F 5 HOH 49 549 261 HOH HOH A . F 5 HOH 50 550 1044 HOH HOH A . F 5 HOH 51 551 2051 HOH HOH A . F 5 HOH 52 552 155 HOH HOH A . F 5 HOH 53 553 671 HOH HOH A . F 5 HOH 54 554 870 HOH HOH A . F 5 HOH 55 555 438 HOH HOH A . F 5 HOH 56 556 1614 HOH HOH A . F 5 HOH 57 557 2982 HOH HOH A . F 5 HOH 58 558 400 HOH HOH A . F 5 HOH 59 559 2468 HOH HOH A . F 5 HOH 60 560 209 HOH HOH A . F 5 HOH 61 561 460 HOH HOH A . F 5 HOH 62 562 3261 HOH HOH A . F 5 HOH 63 563 102 HOH HOH A . F 5 HOH 64 564 236 HOH HOH A . F 5 HOH 65 565 172 HOH HOH A . F 5 HOH 66 566 710 HOH HOH A . F 5 HOH 67 567 1298 HOH HOH A . F 5 HOH 68 568 295 HOH HOH A . F 5 HOH 69 569 3285 HOH HOH A . F 5 HOH 70 570 387 HOH HOH A . F 5 HOH 71 571 2861 HOH HOH A . F 5 HOH 72 572 108 HOH HOH A . F 5 HOH 73 573 164 HOH HOH A . F 5 HOH 74 574 224 HOH HOH A . F 5 HOH 75 575 1576 HOH HOH A . F 5 HOH 76 576 680 HOH HOH A . F 5 HOH 77 577 81 HOH HOH A . F 5 HOH 78 578 345 HOH HOH A . F 5 HOH 79 579 107 HOH HOH A . F 5 HOH 80 580 2447 HOH HOH A . F 5 HOH 81 581 208 HOH HOH A . F 5 HOH 82 582 1905 HOH HOH A . F 5 HOH 83 583 3129 HOH HOH A . F 5 HOH 84 584 53 HOH HOH A . F 5 HOH 85 585 36 HOH HOH A . F 5 HOH 86 586 49 HOH HOH A . F 5 HOH 87 587 122 HOH HOH A . F 5 HOH 88 588 3208 HOH HOH A . F 5 HOH 89 589 234 HOH HOH A . F 5 HOH 90 590 2407 HOH HOH A . F 5 HOH 91 591 470 HOH HOH A . F 5 HOH 92 592 361 HOH HOH A . F 5 HOH 93 593 717 HOH HOH A . F 5 HOH 94 594 1123 HOH HOH A . F 5 HOH 95 595 68 HOH HOH A . F 5 HOH 96 596 10 HOH HOH A . F 5 HOH 97 597 227 HOH HOH A . F 5 HOH 98 598 109 HOH HOH A . F 5 HOH 99 599 3296 HOH HOH A . F 5 HOH 100 600 195 HOH HOH A . F 5 HOH 101 601 684 HOH HOH A . F 5 HOH 102 602 916 HOH HOH A . F 5 HOH 103 603 503 HOH HOH A . F 5 HOH 104 604 2395 HOH HOH A . F 5 HOH 105 605 70 HOH HOH A . F 5 HOH 106 606 204 HOH HOH A . F 5 HOH 107 607 448 HOH HOH A . F 5 HOH 108 608 206 HOH HOH A . F 5 HOH 109 609 2157 HOH HOH A . F 5 HOH 110 610 4 HOH HOH A . F 5 HOH 111 611 110 HOH HOH A . F 5 HOH 112 612 115 HOH HOH A . F 5 HOH 113 613 18 HOH HOH A . F 5 HOH 114 614 47 HOH HOH A . F 5 HOH 115 615 214 HOH HOH A . F 5 HOH 116 616 144 HOH HOH A . F 5 HOH 117 617 193 HOH HOH A . F 5 HOH 118 618 39 HOH HOH A . F 5 HOH 119 619 153 HOH HOH A . F 5 HOH 120 620 1092 HOH HOH A . F 5 HOH 121 621 3161 HOH HOH A . F 5 HOH 122 622 121 HOH HOH A . F 5 HOH 123 623 2 HOH HOH A . F 5 HOH 124 624 389 HOH HOH A . F 5 HOH 125 625 248 HOH HOH A . F 5 HOH 126 626 2507 HOH HOH A . F 5 HOH 127 627 192 HOH HOH A . F 5 HOH 128 628 2675 HOH HOH A . F 5 HOH 129 629 184 HOH HOH A . F 5 HOH 130 630 355 HOH HOH A . F 5 HOH 131 631 1291 HOH HOH A . F 5 HOH 132 632 3300 HOH HOH A . F 5 HOH 133 633 52 HOH HOH A . F 5 HOH 134 634 79 HOH HOH A . F 5 HOH 135 635 165 HOH HOH A . F 5 HOH 136 636 311 HOH HOH A . F 5 HOH 137 637 205 HOH HOH A . F 5 HOH 138 638 2402 HOH HOH A . F 5 HOH 139 639 1335 HOH HOH A . F 5 HOH 140 640 128 HOH HOH A . F 5 HOH 141 641 166 HOH HOH A . F 5 HOH 142 642 922 HOH HOH A . F 5 HOH 143 643 3272 HOH HOH A . F 5 HOH 144 644 173 HOH HOH A . F 5 HOH 145 645 160 HOH HOH A . F 5 HOH 146 646 86 HOH HOH A . F 5 HOH 147 647 179 HOH HOH A . F 5 HOH 148 648 685 HOH HOH A . F 5 HOH 149 649 6 HOH HOH A . F 5 HOH 150 650 72 HOH HOH A . F 5 HOH 151 651 48 HOH HOH A . F 5 HOH 152 652 1098 HOH HOH A . F 5 HOH 153 653 38 HOH HOH A . F 5 HOH 154 654 75 HOH HOH A . F 5 HOH 155 655 150 HOH HOH A . F 5 HOH 156 656 3290 HOH HOH A . F 5 HOH 157 657 2924 HOH HOH A . F 5 HOH 158 658 1629 HOH HOH A . F 5 HOH 159 659 1278 HOH HOH A . F 5 HOH 160 660 3291 HOH HOH A . F 5 HOH 161 661 675 HOH HOH A . F 5 HOH 162 662 60 HOH HOH A . F 5 HOH 163 663 395 HOH HOH A . F 5 HOH 164 664 94 HOH HOH A . F 5 HOH 165 665 30 HOH HOH A . F 5 HOH 166 666 56 HOH HOH A . F 5 HOH 167 667 225 HOH HOH A . F 5 HOH 168 668 23 HOH HOH A . F 5 HOH 169 669 200 HOH HOH A . F 5 HOH 170 670 98 HOH HOH A . F 5 HOH 171 671 2937 HOH HOH A . F 5 HOH 172 672 24 HOH HOH A . F 5 HOH 173 673 90 HOH HOH A . F 5 HOH 174 674 156 HOH HOH A . F 5 HOH 175 675 3271 HOH HOH A . F 5 HOH 176 676 454 HOH HOH A . F 5 HOH 177 677 251 HOH HOH A . F 5 HOH 178 678 99 HOH HOH A . F 5 HOH 179 679 40 HOH HOH A . F 5 HOH 180 680 3299 HOH HOH A . F 5 HOH 181 681 73 HOH HOH A . F 5 HOH 182 682 20 HOH HOH A . F 5 HOH 183 683 41 HOH HOH A . F 5 HOH 184 684 59 HOH HOH A . F 5 HOH 185 685 111 HOH HOH A . F 5 HOH 186 686 231 HOH HOH A . F 5 HOH 187 687 2469 HOH HOH A . F 5 HOH 188 688 54 HOH HOH A . F 5 HOH 189 689 3269 HOH HOH A . F 5 HOH 190 690 233 HOH HOH A . F 5 HOH 191 691 1265 HOH HOH A . F 5 HOH 192 692 21 HOH HOH A . F 5 HOH 193 693 3141 HOH HOH A . F 5 HOH 194 694 133 HOH HOH A . F 5 HOH 195 695 25 HOH HOH A . F 5 HOH 196 696 2838 HOH HOH A . F 5 HOH 197 697 279 HOH HOH A . F 5 HOH 198 698 82 HOH HOH A . F 5 HOH 199 699 27 HOH HOH A . F 5 HOH 200 700 171 HOH HOH A . F 5 HOH 201 701 751 HOH HOH A . F 5 HOH 202 702 28 HOH HOH A . F 5 HOH 203 703 112 HOH HOH A . F 5 HOH 204 704 2879 HOH HOH A . F 5 HOH 205 705 152 HOH HOH A . F 5 HOH 206 706 1579 HOH HOH A . F 5 HOH 207 707 3170 HOH HOH A . F 5 HOH 208 708 163 HOH HOH A . F 5 HOH 209 709 386 HOH HOH A . F 5 HOH 210 710 255 HOH HOH A . F 5 HOH 211 711 37 HOH HOH A . F 5 HOH 212 712 139 HOH HOH A . F 5 HOH 213 713 1289 HOH HOH A . F 5 HOH 214 714 33 HOH HOH A . F 5 HOH 215 715 154 HOH HOH A . F 5 HOH 216 716 351 HOH HOH A . F 5 HOH 217 717 3274 HOH HOH A . F 5 HOH 218 718 5 HOH HOH A . F 5 HOH 219 719 2786 HOH HOH A . F 5 HOH 220 720 242 HOH HOH A . F 5 HOH 221 721 726 HOH HOH A . F 5 HOH 222 722 3024 HOH HOH A . F 5 HOH 223 723 119 HOH HOH A . F 5 HOH 224 724 61 HOH HOH A . F 5 HOH 225 725 271 HOH HOH A . F 5 HOH 226 726 132 HOH HOH A . F 5 HOH 227 727 22 HOH HOH A . F 5 HOH 228 728 3174 HOH HOH A . F 5 HOH 229 729 327 HOH HOH A . F 5 HOH 230 730 380 HOH HOH A . F 5 HOH 231 731 183 HOH HOH A . F 5 HOH 232 732 141 HOH HOH A . F 5 HOH 233 733 2896 HOH HOH A . F 5 HOH 234 734 44 HOH HOH A . F 5 HOH 235 735 88 HOH HOH A . F 5 HOH 236 736 689 HOH HOH A . F 5 HOH 237 737 1186 HOH HOH A . F 5 HOH 238 738 623 HOH HOH A . F 5 HOH 239 739 1429 HOH HOH A . F 5 HOH 240 740 12 HOH HOH A . F 5 HOH 241 741 3062 HOH HOH A . F 5 HOH 242 742 260 HOH HOH A . F 5 HOH 243 743 162 HOH HOH A . F 5 HOH 244 744 1276 HOH HOH A . F 5 HOH 245 745 369 HOH HOH A . F 5 HOH 246 746 1114 HOH HOH A . F 5 HOH 247 747 9 HOH HOH A . F 5 HOH 248 748 7 HOH HOH A . F 5 HOH 249 749 104 HOH HOH A . F 5 HOH 250 750 1582 HOH HOH A . F 5 HOH 251 751 516 HOH HOH A . F 5 HOH 252 752 197 HOH HOH A . F 5 HOH 253 753 3216 HOH HOH A . F 5 HOH 254 754 548 HOH HOH A . F 5 HOH 255 755 42 HOH HOH A . F 5 HOH 256 756 2909 HOH HOH A . F 5 HOH 257 757 178 HOH HOH A . F 5 HOH 258 758 3288 HOH HOH A . F 5 HOH 259 759 1558 HOH HOH A . F 5 HOH 260 760 3202 HOH HOH A . F 5 HOH 261 761 2846 HOH HOH A . F 5 HOH 262 762 382 HOH HOH A . F 5 HOH 263 763 125 HOH HOH A . F 5 HOH 264 764 62 HOH HOH A . F 5 HOH 265 765 464 HOH HOH A . F 5 HOH 266 766 55 HOH HOH A . F 5 HOH 267 767 3156 HOH HOH A . F 5 HOH 268 768 123 HOH HOH A . F 5 HOH 269 769 26 HOH HOH A . F 5 HOH 270 770 1601 HOH HOH A . F 5 HOH 271 771 840 HOH HOH A . F 5 HOH 272 772 57 HOH HOH A . F 5 HOH 273 773 2872 HOH HOH A . F 5 HOH 274 774 218 HOH HOH A . F 5 HOH 275 775 66 HOH HOH A . F 5 HOH 276 776 148 HOH HOH A . F 5 HOH 277 777 1034 HOH HOH A . F 5 HOH 278 778 87 HOH HOH A . F 5 HOH 279 779 100 HOH HOH A . F 5 HOH 280 780 3278 HOH HOH A . F 5 HOH 281 781 232 HOH HOH A . F 5 HOH 282 782 2730 HOH HOH A . F 5 HOH 283 783 2887 HOH HOH A . F 5 HOH 284 784 29 HOH HOH A . F 5 HOH 285 785 17 HOH HOH A . F 5 HOH 286 786 199 HOH HOH A . F 5 HOH 287 787 3033 HOH HOH A . F 5 HOH 288 788 76 HOH HOH A . F 5 HOH 289 789 89 HOH HOH A . F 5 HOH 290 790 368 HOH HOH A . F 5 HOH 291 791 15 HOH HOH A . F 5 HOH 292 792 698 HOH HOH A . F 5 HOH 293 793 146 HOH HOH A . F 5 HOH 294 794 1162 HOH HOH A . F 5 HOH 295 795 859 HOH HOH A . F 5 HOH 296 796 2510 HOH HOH A . F 5 HOH 297 797 71 HOH HOH A . F 5 HOH 298 798 457 HOH HOH A . F 5 HOH 299 799 58 HOH HOH A . F 5 HOH 300 800 2923 HOH HOH A . F 5 HOH 301 801 167 HOH HOH A . F 5 HOH 302 802 177 HOH HOH A . F 5 HOH 303 803 129 HOH HOH A . F 5 HOH 304 804 519 HOH HOH A . F 5 HOH 305 805 135 HOH HOH A . F 5 HOH 306 806 2025 HOH HOH A . F 5 HOH 307 807 2398 HOH HOH A . F 5 HOH 308 808 323 HOH HOH A . F 5 HOH 309 809 74 HOH HOH A . F 5 HOH 310 810 2853 HOH HOH A . F 5 HOH 311 811 2746 HOH HOH A . F 5 HOH 312 812 439 HOH HOH A . F 5 HOH 313 813 679 HOH HOH A . F 5 HOH 314 814 690 HOH HOH A . F 5 HOH 315 815 147 HOH HOH A . F 5 HOH 316 816 11 HOH HOH A . F 5 HOH 317 817 151 HOH HOH A . F 5 HOH 318 818 114 HOH HOH A . F 5 HOH 319 819 201 HOH HOH A . F 5 HOH 320 820 513 HOH HOH A . F 5 HOH 321 821 244 HOH HOH A . F 5 HOH 322 822 1177 HOH HOH A . F 5 HOH 323 823 212 HOH HOH A . F 5 HOH 324 824 313 HOH HOH A . F 5 HOH 325 825 105 HOH HOH A . F 5 HOH 326 826 159 HOH HOH A . F 5 HOH 327 827 2883 HOH HOH A . F 5 HOH 328 828 2401 HOH HOH A . F 5 HOH 329 829 393 HOH HOH A . F 5 HOH 330 830 276 HOH HOH A . F 5 HOH 331 831 186 HOH HOH A . F 5 HOH 332 832 2689 HOH HOH A . F 5 HOH 333 833 628 HOH HOH A . F 5 HOH 334 834 1172 HOH HOH A . F 5 HOH 335 835 194 HOH HOH A . F 5 HOH 336 836 335 HOH HOH A . F 5 HOH 337 837 822 HOH HOH A . F 5 HOH 338 838 2577 HOH HOH A . F 5 HOH 339 839 3164 HOH HOH A . F 5 HOH 340 840 190 HOH HOH A . F 5 HOH 341 841 240 HOH HOH A . F 5 HOH 342 842 113 HOH HOH A . F 5 HOH 343 843 103 HOH HOH A . F 5 HOH 344 844 16 HOH HOH A . F 5 HOH 345 845 130 HOH HOH A . F 5 HOH 346 846 117 HOH HOH A . F 5 HOH 347 847 3279 HOH HOH A . F 5 HOH 348 848 207 HOH HOH A . F 5 HOH 349 849 3159 HOH HOH A . F 5 HOH 350 850 258 HOH HOH A . F 5 HOH 351 851 210 HOH HOH A . F 5 HOH 352 852 78 HOH HOH A . F 5 HOH 353 853 3038 HOH HOH A . F 5 HOH 354 854 1082 HOH HOH A . F 5 HOH 355 855 134 HOH HOH A . F 5 HOH 356 856 3034 HOH HOH A . F 5 HOH 357 857 620 HOH HOH A . F 5 HOH 358 858 80 HOH HOH A . F 5 HOH 359 859 101 HOH HOH A . F 5 HOH 360 860 535 HOH HOH A . F 5 HOH 361 861 2685 HOH HOH A . F 5 HOH 362 862 494 HOH HOH A . F 5 HOH 363 863 354 HOH HOH A . F 5 HOH 364 864 64 HOH HOH A . F 5 HOH 365 865 845 HOH HOH A . F 5 HOH 366 866 168 HOH HOH A . F 5 HOH 367 867 584 HOH HOH A . F 5 HOH 368 868 91 HOH HOH A . F 5 HOH 369 869 921 HOH HOH A . F 5 HOH 370 870 450 HOH HOH A . F 5 HOH 371 871 2845 HOH HOH A . F 5 HOH 372 872 116 HOH HOH A . F 5 HOH 373 873 3227 HOH HOH A . F 5 HOH 374 874 8 HOH HOH A . F 5 HOH 375 875 755 HOH HOH A . F 5 HOH 376 876 2473 HOH HOH A . F 5 HOH 377 877 1040 HOH HOH A . F 5 HOH 378 878 3019 HOH HOH A . F 5 HOH 379 879 378 HOH HOH A . F 5 HOH 380 880 1372 HOH HOH A . F 5 HOH 381 881 14 HOH HOH A . F 5 HOH 382 882 699 HOH HOH A . F 5 HOH 383 883 138 HOH HOH A . F 5 HOH 384 884 377 HOH HOH A . F 5 HOH 385 885 2958 HOH HOH A . F 5 HOH 386 886 2851 HOH HOH A . F 5 HOH 387 887 2842 HOH HOH A . F 5 HOH 388 888 97 HOH HOH A . F 5 HOH 389 889 2404 HOH HOH A . F 5 HOH 390 890 3198 HOH HOH A . F 5 HOH 391 891 1936 HOH HOH A . F 5 HOH 392 892 1133 HOH HOH A . F 5 HOH 393 893 339 HOH HOH A . F 5 HOH 394 894 2156 HOH HOH A . F 5 HOH 395 895 610 HOH HOH A . F 5 HOH 396 896 348 HOH HOH A . F 5 HOH 397 897 2403 HOH HOH A . F 5 HOH 398 898 349 HOH HOH A . F 5 HOH 399 899 3276 HOH HOH A . F 5 HOH 400 900 674 HOH HOH A . F 5 HOH 401 901 1094 HOH HOH A . F 5 HOH 402 902 2545 HOH HOH A . F 5 HOH 403 903 3023 HOH HOH A . F 5 HOH 404 904 226 HOH HOH A . F 5 HOH 405 905 3080 HOH HOH A . F 5 HOH 406 906 2480 HOH HOH A . F 5 HOH 407 907 2496 HOH HOH A . F 5 HOH 408 908 475 HOH HOH A . F 5 HOH 409 909 300 HOH HOH A . F 5 HOH 410 910 3175 HOH HOH A . F 5 HOH 411 911 1105 HOH HOH A . F 5 HOH 412 912 149 HOH HOH A . F 5 HOH 413 913 35 HOH HOH A . F 5 HOH 414 914 2885 HOH HOH A . F 5 HOH 415 915 3105 HOH HOH A . F 5 HOH 416 916 2185 HOH HOH A . F 5 HOH 417 917 337 HOH HOH A . F 5 HOH 418 918 2405 HOH HOH A . F 5 HOH 419 919 3051 HOH HOH A . F 5 HOH 420 920 2542 HOH HOH A . F 5 HOH 421 921 3160 HOH HOH A . F 5 HOH 422 922 3027 HOH HOH A . F 5 HOH 423 923 420 HOH HOH A . F 5 HOH 424 924 2834 HOH HOH A . F 5 HOH 425 925 338 HOH HOH A . F 5 HOH 426 926 213 HOH HOH A . F 5 HOH 427 927 2984 HOH HOH A . F 5 HOH 428 928 229 HOH HOH A . F 5 HOH 429 929 3172 HOH HOH A . F 5 HOH 430 930 331 HOH HOH A . F 5 HOH 431 931 456 HOH HOH A . F 5 HOH 432 932 2829 HOH HOH A . F 5 HOH 433 933 1942 HOH HOH A . F 5 HOH 434 934 2933 HOH HOH A . F 5 HOH 435 935 2732 HOH HOH A . F 5 HOH 436 936 3295 HOH HOH A . F 5 HOH 437 937 2840 HOH HOH A . F 5 HOH 438 938 1011 HOH HOH A . F 5 HOH 439 939 607 HOH HOH A . F 5 HOH 440 940 137 HOH HOH A . F 5 HOH 441 941 3088 HOH HOH A . F 5 HOH 442 942 3297 HOH HOH A . F 5 HOH 443 943 1638 HOH HOH A . F 5 HOH 444 944 697 HOH HOH A . F 5 HOH 445 945 850 HOH HOH A . F 5 HOH 446 946 303 HOH HOH A . F 5 HOH 447 947 2827 HOH HOH A . F 5 HOH 448 948 145 HOH HOH A . F 5 HOH 449 949 2040 HOH HOH A . F 5 HOH 450 950 1322 HOH HOH A . F 5 HOH 451 951 385 HOH HOH A . F 5 HOH 452 952 363 HOH HOH A . F 5 HOH 453 953 340 HOH HOH A . F 5 HOH 454 954 3282 HOH HOH A . F 5 HOH 455 955 2939 HOH HOH A . F 5 HOH 456 956 821 HOH HOH A . F 5 HOH 457 957 3280 HOH HOH A . F 5 HOH 458 958 2726 HOH HOH A . F 5 HOH 459 959 563 HOH HOH A . F 5 HOH 460 960 2483 HOH HOH A . F 5 HOH 461 961 3289 HOH HOH A . F 5 HOH 462 962 306 HOH HOH A . F 5 HOH 463 963 860 HOH HOH A . F 5 HOH 464 964 807 HOH HOH A . F 5 HOH 465 965 2672 HOH HOH A . F 5 HOH 466 966 2539 HOH HOH A . F 5 HOH 467 967 3146 HOH HOH A . F 5 HOH 468 968 978 HOH HOH A . F 5 HOH 469 969 346 HOH HOH A . F 5 HOH 470 970 3182 HOH HOH A . F 5 HOH 471 971 3293 HOH HOH A . F 5 HOH 472 972 1312 HOH HOH A . F 5 HOH 473 973 304 HOH HOH A . F 5 HOH 474 974 1468 HOH HOH A . F 5 HOH 475 975 3281 HOH HOH A . F 5 HOH 476 976 660 HOH HOH A . F 5 HOH 477 977 373 HOH HOH A . F 5 HOH 478 978 2630 HOH HOH A . F 5 HOH 479 979 3140 HOH HOH A . F 5 HOH 480 980 1850 HOH HOH A . F 5 HOH 481 981 372 HOH HOH A . F 5 HOH 482 982 3247 HOH HOH A . F 5 HOH 483 983 371 HOH HOH A . F 5 HOH 484 984 3268 HOH HOH A . F 5 HOH 485 985 3204 HOH HOH A . F 5 HOH 486 986 1275 HOH HOH A . F 5 HOH 487 987 655 HOH HOH A . F 5 HOH 488 988 691 HOH HOH A . F 5 HOH 489 989 1075 HOH HOH A . F 5 HOH 490 990 963 HOH HOH A . F 5 HOH 491 991 3015 HOH HOH A . F 5 HOH 492 992 437 HOH HOH A . F 5 HOH 493 993 1343 HOH HOH A . F 5 HOH 494 994 711 HOH HOH A . F 5 HOH 495 995 342 HOH HOH A . F 5 HOH 496 996 2702 HOH HOH A . F 5 HOH 497 997 3029 HOH HOH A . F 5 HOH 498 998 736 HOH HOH A . F 5 HOH 499 999 333 HOH HOH A . F 5 HOH 500 1000 2863 HOH HOH A . F 5 HOH 501 1001 3301 HOH HOH A . F 5 HOH 502 1002 2611 HOH HOH A . F 5 HOH 503 1003 553 HOH HOH A . F 5 HOH 504 1004 603 HOH HOH A . F 5 HOH 505 1005 2956 HOH HOH A . F 5 HOH 506 1006 399 HOH HOH A . F 5 HOH 507 1007 694 HOH HOH A . F 5 HOH 508 1008 1117 HOH HOH A . F 5 HOH 509 1009 3302 HOH HOH A . F 5 HOH 510 1010 2912 HOH HOH A . F 5 HOH 511 1011 485 HOH HOH A . F 5 HOH 512 1012 169 HOH HOH A . F 5 HOH 513 1013 2145 HOH HOH A . F 5 HOH 514 1014 1415 HOH HOH A . F 5 HOH 515 1015 533 HOH HOH A . F 5 HOH 516 1016 2960 HOH HOH A . F 5 HOH 517 1017 769 HOH HOH A . F 5 HOH 518 1018 2959 HOH HOH A . F 5 HOH 519 1019 1213 HOH HOH A . F 5 HOH 520 1020 3215 HOH HOH A . F 5 HOH 521 1021 3036 HOH HOH A . F 5 HOH 522 1022 819 HOH HOH A . F 5 HOH 523 1023 1012 HOH HOH A . F 5 HOH 524 1024 301 HOH HOH A . F 5 HOH 525 1025 546 HOH HOH A . F 5 HOH 526 1026 307 HOH HOH A . F 5 HOH 527 1027 2918 HOH HOH A . F 5 HOH 528 1028 328 HOH HOH A . F 5 HOH 529 1029 2998 HOH HOH A . F 5 HOH 530 1030 3294 HOH HOH A . F 5 HOH 531 1031 1155 HOH HOH A . F 5 HOH 532 1032 2892 HOH HOH A . F 5 HOH 533 1033 2964 HOH HOH A . F 5 HOH 534 1034 341 HOH HOH A . F 5 HOH 535 1035 1020 HOH HOH A . F 5 HOH 536 1036 2587 HOH HOH A . F 5 HOH 537 1037 2797 HOH HOH A . F 5 HOH 538 1038 3277 HOH HOH A . F 5 HOH 539 1039 2976 HOH HOH A . F 5 HOH 540 1040 3143 HOH HOH A . F 5 HOH 541 1041 1219 HOH HOH A . F 5 HOH 542 1042 310 HOH HOH A . F 5 HOH 543 1043 2257 HOH HOH A . F 5 HOH 544 1044 2875 HOH HOH A . F 5 HOH 545 1045 2414 HOH HOH A . F 5 HOH 546 1046 417 HOH HOH A . F 5 HOH 547 1047 308 HOH HOH A . F 5 HOH 548 1048 1957 HOH HOH A . F 5 HOH 549 1049 302 HOH HOH A . F 5 HOH 550 1050 2436 HOH HOH A . F 5 HOH 551 1051 2718 HOH HOH A . F 5 HOH 552 1052 1306 HOH HOH A . F 5 HOH 553 1053 1206 HOH HOH A . F 5 HOH 554 1054 2143 HOH HOH A . F 5 HOH 555 1056 761 HOH HOH A . F 5 HOH 556 1057 3032 HOH HOH A . F 5 HOH 557 1058 2859 HOH HOH A . F 5 HOH 558 1059 504 HOH HOH A . F 5 HOH 559 1060 353 HOH HOH A . F 5 HOH 560 1061 3292 HOH HOH A . F 5 HOH 561 1062 322 HOH HOH A . F 5 HOH 562 1064 2652 HOH HOH A . F 5 HOH 563 1065 2891 HOH HOH A . F 5 HOH 564 1066 2618 HOH HOH A . F 5 HOH 565 1067 2847 HOH HOH A . F 5 HOH 566 1068 321 HOH HOH A . F 5 HOH 567 1069 325 HOH HOH A . F 5 HOH 568 1070 515 HOH HOH A . F 5 HOH 569 1071 318 HOH HOH A . F 5 HOH 570 1072 2742 HOH HOH A . F 5 HOH 571 1073 1057 HOH HOH A . F 5 HOH 572 1074 441 HOH HOH A . F 5 HOH 573 1075 2563 HOH HOH A . F 5 HOH 574 1076 2980 HOH HOH A . F 5 HOH 575 1077 3153 HOH HOH A . F 5 HOH 576 1078 2613 HOH HOH A . F 5 HOH 577 1079 1215 HOH HOH A . F 5 HOH 578 1080 480 HOH HOH A . F 5 HOH 579 1081 1723 HOH HOH A . F 5 HOH 580 1082 1421 HOH HOH A . F 5 HOH 581 1083 3283 HOH HOH A . F 5 HOH 582 1084 3063 HOH HOH A . F 5 HOH 583 1085 895 HOH HOH A . F 5 HOH 584 1086 2899 HOH HOH A . F 5 HOH 585 1087 3104 HOH HOH A . F 5 HOH 586 1088 468 HOH HOH A . F 5 HOH 587 1089 737 HOH HOH A . F 5 HOH 588 1090 2925 HOH HOH A . F 5 HOH 589 1091 299 HOH HOH A . F 5 HOH 590 1092 707 HOH HOH A . F 5 HOH 591 1093 705 HOH HOH A . F 5 HOH 592 1094 2452 HOH HOH A . F 5 HOH 593 1095 1131 HOH HOH A . F 5 HOH 594 1096 1910 HOH HOH A . F 5 HOH 595 1097 754 HOH HOH A . F 5 HOH 596 1098 360 HOH HOH A . F 5 HOH 597 1099 2996 HOH HOH A . F 5 HOH 598 1100 715 HOH HOH A . F 5 HOH 599 1101 2831 HOH HOH A . F 5 HOH 600 1102 298 HOH HOH A . F 5 HOH 601 1103 344 HOH HOH A . F 5 HOH 602 1104 297 HOH HOH A . F 5 HOH 603 1105 2512 HOH HOH A . F 5 HOH 604 1106 330 HOH HOH A . F 5 HOH 605 1107 875 HOH HOH A . F 5 HOH 606 1108 2878 HOH HOH A . F 5 HOH 607 1109 2927 HOH HOH A . F 5 HOH 608 1110 3076 HOH HOH A . F 5 HOH 609 1111 2044 HOH HOH A . F 5 HOH 610 1112 3152 HOH HOH A . F 5 HOH 611 1113 2986 HOH HOH A . F 5 HOH 612 1114 846 HOH HOH A . F 5 HOH 613 1115 1403 HOH HOH A . F 5 HOH 614 1116 501 HOH HOH A . F 5 HOH 615 1117 2744 HOH HOH A . F 5 HOH 616 1118 1065 HOH HOH A . F 5 HOH 617 1119 496 HOH HOH A . F 5 HOH 618 1120 693 HOH HOH A . F 5 HOH 619 1121 854 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ILE -4 ? CG1 ? A ILE 1 CG1 2 1 Y 1 A ILE -4 ? CG2 ? A ILE 1 CG2 3 1 Y 1 A ILE -4 ? CD1 ? A ILE 1 CD1 4 1 Y 1 A GLN 186 ? CG ? A GLN 191 CG 5 1 Y 1 A GLN 186 ? CD ? A GLN 191 CD 6 1 Y 1 A GLN 186 ? OE1 ? A GLN 191 OE1 7 1 Y 1 A GLN 186 ? NE2 ? A GLN 191 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 2.0_5936 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 39JO _cell.details ? _cell.formula_units_Z ? _cell.length_a 83.290 _cell.length_a_esd ? _cell.length_b 84.130 _cell.length_b_esd ? _cell.length_c 131.900 _cell.length_c_esd ? _cell.volume 924248.058 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 39JO _symmetry.cell_setting ? _symmetry.Int_Tables_number 24 _symmetry.space_group_name_Hall 'I 2b 2c' _symmetry.space_group_name_H-M 'I 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 39JO _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.86 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.99 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M calcium acetate, 0.1 M Bis-Tris propane, 15-20% w/v PEG4000' _exptl_crystal_grow.pdbx_pH_range 6.5-7.0 _exptl_crystal_grow.temp 293.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2026-07-30 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.954 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'CLSI BEAMLINE 08ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.954 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 08ID-1 _diffrn_source.pdbx_synchrotron_site CLSI # _reflns.B_iso_Wilson_estimate 23.23 _reflns.entry_id 39JO _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.75 _reflns.d_resolution_low 44.05 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 88018 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.75 _reflns_shell.d_res_low 1.80 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.07 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3142 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.51 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 31.48 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 39JO _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.75 _refine.ls_d_res_low 44.05 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 87998 _refine.ls_number_reflns_R_free 3848 _refine.ls_number_reflns_R_work 84150 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.40 _refine.ls_percent_reflns_R_free 4.37 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1620 _refine.ls_R_factor_R_free 0.1936 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1605 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.5449 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2374 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.75 _refine_hist.d_res_low 44.05 _refine_hist.number_atoms_solvent 621 _refine_hist.number_atoms_total 3472 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2826 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 25 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0049 ? 2930 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.7275 ? 3960 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0505 ? 440 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0056 ? 522 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 17.3932 ? 1087 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.75 1.77 . . 112 2486 76.14 . . . . 0.3679 . . . . . . . . . . . . . . . 0.3597 'X-RAY DIFFRACTION' 1.77 1.80 . . 124 2544 80.95 . . . . 0.3511 . . . . . . . . . . . . . . . 0.3822 'X-RAY DIFFRACTION' 1.80 1.82 . . 125 2764 86.24 . . . . 0.3227 . . . . . . . . . . . . . . . 0.3685 'X-RAY DIFFRACTION' 1.82 1.85 . . 139 2918 91.31 . . . . 0.3126 . . . . . . . . . . . . . . . 0.3390 'X-RAY DIFFRACTION' 1.85 1.87 . . 138 3049 96.25 . . . . 0.2853 . . . . . . . . . . . . . . . 0.2958 'X-RAY DIFFRACTION' 1.87 1.90 . . 141 3183 99.97 . . . . 0.2729 . . . . . . . . . . . . . . . 0.2779 'X-RAY DIFFRACTION' 1.90 1.93 . . 148 3240 99.94 . . . . 0.2540 . . . . . . . . . . . . . . . 0.2973 'X-RAY DIFFRACTION' 1.93 1.97 . . 140 3206 99.94 . . . . 0.2209 . . . . . . . . . . . . . . . 0.2661 'X-RAY DIFFRACTION' 1.97 2.00 . . 144 3219 100.00 . . . . 0.1996 . . . . . . . . . . . . . . . 0.2107 'X-RAY DIFFRACTION' 2.00 2.04 . . 147 3161 100.00 . . . . 0.1930 . . . . . . . . . . . . . . . 0.2484 'X-RAY DIFFRACTION' 2.04 2.08 . . 143 3209 99.97 . . . . 0.1838 . . . . . . . . . . . . . . . 0.2094 'X-RAY DIFFRACTION' 2.08 2.13 . . 144 3183 100.00 . . . . 0.1765 . . . . . . . . . . . . . . . 0.2315 'X-RAY DIFFRACTION' 2.13 2.18 . . 154 3212 99.94 . . . . 0.1733 . . . . . . . . . . . . . . . 0.2208 'X-RAY DIFFRACTION' 2.18 2.23 . . 138 3206 99.97 . . . . 0.1627 . . . . . . . . . . . . . . . 0.2099 'X-RAY DIFFRACTION' 2.23 2.29 . . 151 3185 100.00 . . . . 0.1545 . . . . . . . . . . . . . . . 0.2156 'X-RAY DIFFRACTION' 2.29 2.36 . . 143 3193 99.94 . . . . 0.1443 . . . . . . . . . . . . . . . 0.1695 'X-RAY DIFFRACTION' 2.36 2.44 . . 145 3196 99.94 . . . . 0.1417 . . . . . . . . . . . . . . . 0.1741 'X-RAY DIFFRACTION' 2.44 2.52 . . 149 3223 99.94 . . . . 0.1403 . . . . . . . . . . . . . . . 0.1570 'X-RAY DIFFRACTION' 2.52 2.62 . . 142 3178 100.00 . . . . 0.1492 . . . . . . . . . . . . . . . 0.1687 'X-RAY DIFFRACTION' 2.62 2.74 . . 150 3208 99.97 . . . . 0.1493 . . . . . . . . . . . . . . . 0.1918 'X-RAY DIFFRACTION' 2.74 2.89 . . 155 3206 99.97 . . . . 0.1503 . . . . . . . . . . . . . . . 0.1843 'X-RAY DIFFRACTION' 2.89 3.07 . . 141 3183 99.97 . . . . 0.1495 . . . . . . . . . . . . . . . 0.2068 'X-RAY DIFFRACTION' 3.07 3.31 . . 144 3190 100.00 . . . . 0.1316 . . . . . . . . . . . . . . . 0.1820 'X-RAY DIFFRACTION' 3.31 3.64 . . 148 3209 100.00 . . . . 0.1317 . . . . . . . . . . . . . . . 0.1539 'X-RAY DIFFRACTION' 3.64 4.17 . . 148 3190 99.97 . . . . 0.1195 . . . . . . . . . . . . . . . 0.1658 'X-RAY DIFFRACTION' 4.17 5.25 . . 150 3205 100.00 . . . . 0.1127 . . . . . . . . . . . . . . . 0.1263 'X-RAY DIFFRACTION' 5.25 44.05 . . 145 3204 99.70 . . . . 0.1749 . . . . . . . . . . . . . . . 0.2197 # _struct.entry_id 39JO _struct.title 'X-ray crystallographic structure model of Lactococcus lactis prolidase mutant Del101' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 39JO _struct_keywords.text 'Xaa-Pro dipeptidase, Imidodipeptidase, Dipeptidase, Metalloprotease, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A8WBX8_9LACT _struct_ref.pdbx_db_accession A8WBX8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSKIERISAFLNDKEVDMTFITNPTTLNYLTGLAIDPHERIAGLMIFRDSTPMLFTPALEVEKAKEHTSGLDIFGYEDSQ NPWEVVKNHVKSDVKSIAVEFSDIPLAKTEGLKAQFGDINFVNLTPLIERMRLIKSADEIEKMKVAGDFADKCFEIGFAT AAERNGVTESDIVAKIEYEMKRMGVPQMSFDTLVLSGARAANPHGAPENVEIQENKLLLFDLGVMSGGYASDATRTIAIG QPNDFDAEIHKIVKEAQQAAMDFIKPGVTAHEVDAVARDLITKAGYGEYFNHRLGHGIGMDVHEYPSIVAGNDLVIQEGM CFSNEPGIYIPGKVGVRIEDCLYVTENGCESFTHTDHDLLIF ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 39JO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 366 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A8WBX8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 362 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 361 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 39JO ILE A 1 ? UNP A8WBX8 ? ? 'expression tag' -4 1 1 39JO GLY A 2 ? UNP A8WBX8 ? ? 'expression tag' -3 2 1 39JO SER A 3 ? UNP A8WBX8 ? ? 'expression tag' -2 3 1 39JO GLU A 4 ? UNP A8WBX8 ? ? 'expression tag' -1 4 1 39JO PHE A 5 ? UNP A8WBX8 ? ? 'expression tag' 0 5 1 39JO ? A ? ? UNP A8WBX8 PHE 101 deletion ? 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4470 ? 1 MORE -41 ? 1 'SSA (A^2)' 29820 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_564 x,-y+1,-z-1/2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 84.1300000000 0.0000000000 0.0000000000 -1.0000000000 -65.9500000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 3 ? GLU A 20 ? SER A -2 GLU A 15 1 ? 18 HELX_P HELX_P2 AA2 ASN A 28 ? GLY A 37 ? ASN A 23 GLY A 32 1 ? 10 HELX_P HELX_P3 AA3 GLU A 65 ? THR A 73 ? GLU A 60 THR A 68 1 ? 9 HELX_P HELX_P4 AA4 ASN A 86 ? VAL A 95 ? ASN A 81 VAL A 90 1 ? 10 HELX_P HELX_P5 AA5 PRO A 109 ? GLY A 121 ? PRO A 104 GLY A 116 1 ? 13 HELX_P HELX_P6 AA6 LEU A 128 ? LEU A 137 ? LEU A 123 LEU A 132 1 ? 10 HELX_P HELX_P7 AA7 SER A 140 ? GLU A 167 ? SER A 135 GLU A 162 1 ? 28 HELX_P HELX_P8 AA8 THR A 172 ? MET A 187 ? THR A 167 MET A 182 1 ? 16 HELX_P HELX_P9 AA9 ALA A 202 ? ASN A 206 ? ALA A 197 ASN A 201 5 ? 5 HELX_P HELX_P10 AB1 ASN A 247 ? ILE A 268 ? ASN A 242 ILE A 263 1 ? 22 HELX_P HELX_P11 AB2 THR A 273 ? ALA A 288 ? THR A 268 ALA A 283 1 ? 16 HELX_P HELX_P12 AB3 TYR A 290 ? PHE A 294 ? TYR A 285 PHE A 289 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 225 OD1 ? ? ? 1_555 C MN . MN ? ? A ASP 220 A MN 402 1_555 ? ? ? ? ? ? ? 2.115 ? ? metalc2 metalc ? ? A ASP 225 OD2 ? ? ? 1_555 C MN . MN ? ? A ASP 220 A MN 402 1_555 ? ? ? ? ? ? ? 2.500 ? ? metalc3 metalc ? ? A ASP 236 OD2 ? ? ? 1_555 B MN . MN ? ? A ASP 231 A MN 401 1_555 ? ? ? ? ? ? ? 2.191 ? ? metalc4 metalc ? ? A ASP 236 OD1 ? ? ? 1_555 C MN . MN ? ? A ASP 231 A MN 402 1_555 ? ? ? ? ? ? ? 2.089 ? ? metalc5 metalc ? ? A HIS 300 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 295 A MN 401 1_555 ? ? ? ? ? ? ? 2.189 ? ? metalc6 metalc ? ? A GLU 329 OE2 ? ? ? 1_555 B MN . MN ? ? A GLU 324 A MN 401 1_555 ? ? ? ? ? ? ? 2.332 ? ? metalc7 metalc ? ? A GLU 343 OE2 ? ? ? 1_555 B MN . MN ? ? A GLU 338 A MN 401 1_555 ? ? ? ? ? ? ? 2.175 ? ? metalc8 metalc ? ? A GLU 343 OE1 ? ? ? 1_555 C MN . MN ? ? A GLU 338 A MN 402 1_555 ? ? ? ? ? ? ? 2.203 ? ? metalc9 metalc ? ? B MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 401 A HOH 504 1_555 ? ? ? ? ? ? ? 2.244 ? ? metalc10 metalc ? ? B MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 401 A HOH 604 1_555 ? ? ? ? ? ? ? 2.243 ? ? metalc11 metalc ? ? C MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 402 A HOH 504 1_555 ? ? ? ? ? ? ? 2.228 ? ? metalc12 metalc ? ? C MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 402 A HOH 874 1_555 ? ? ? ? ? ? ? 2.340 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 225 ? A ASP 220 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 OD2 ? A ASP 225 ? A ASP 220 ? 1_555 55.9 ? 2 OD1 ? A ASP 225 ? A ASP 220 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 OD1 ? A ASP 236 ? A ASP 231 ? 1_555 96.1 ? 3 OD2 ? A ASP 225 ? A ASP 220 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 OD1 ? A ASP 236 ? A ASP 231 ? 1_555 150.5 ? 4 OD1 ? A ASP 225 ? A ASP 220 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 OE1 ? A GLU 343 ? A GLU 338 ? 1_555 99.7 ? 5 OD2 ? A ASP 225 ? A ASP 220 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 OE1 ? A GLU 343 ? A GLU 338 ? 1_555 105.1 ? 6 OD1 ? A ASP 236 ? A ASP 231 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 OE1 ? A GLU 343 ? A GLU 338 ? 1_555 87.1 ? 7 OD1 ? A ASP 225 ? A ASP 220 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O ? F HOH . ? A HOH 504 ? 1_555 145.8 ? 8 OD2 ? A ASP 225 ? A ASP 220 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O ? F HOH . ? A HOH 504 ? 1_555 90.0 ? 9 OD1 ? A ASP 236 ? A ASP 231 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O ? F HOH . ? A HOH 504 ? 1_555 118.0 ? 10 OE1 ? A GLU 343 ? A GLU 338 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O ? F HOH . ? A HOH 504 ? 1_555 85.8 ? 11 OD1 ? A ASP 225 ? A ASP 220 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O ? F HOH . ? A HOH 874 ? 1_555 94.6 ? 12 OD2 ? A ASP 225 ? A ASP 220 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O ? F HOH . ? A HOH 874 ? 1_555 84.9 ? 13 OD1 ? A ASP 236 ? A ASP 231 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O ? F HOH . ? A HOH 874 ? 1_555 89.1 ? 14 OE1 ? A GLU 343 ? A GLU 338 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O ? F HOH . ? A HOH 874 ? 1_555 165.5 ? 15 O ? F HOH . ? A HOH 504 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O ? F HOH . ? A HOH 874 ? 1_555 83.6 ? 16 OD2 ? A ASP 236 ? A ASP 231 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 NE2 ? A HIS 300 ? A HIS 295 ? 1_555 92.2 ? 17 OD2 ? A ASP 236 ? A ASP 231 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 OE2 ? A GLU 329 ? A GLU 324 ? 1_555 157.6 ? 18 NE2 ? A HIS 300 ? A HIS 295 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 OE2 ? A GLU 329 ? A GLU 324 ? 1_555 85.4 ? 19 OD2 ? A ASP 236 ? A ASP 231 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 OE2 ? A GLU 343 ? A GLU 338 ? 1_555 82.9 ? 20 NE2 ? A HIS 300 ? A HIS 295 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 OE2 ? A GLU 343 ? A GLU 338 ? 1_555 121.7 ? 21 OE2 ? A GLU 329 ? A GLU 324 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 OE2 ? A GLU 343 ? A GLU 338 ? 1_555 79.5 ? 22 OD2 ? A ASP 236 ? A ASP 231 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 O ? F HOH . ? A HOH 504 ? 1_555 105.1 ? 23 NE2 ? A HIS 300 ? A HIS 295 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 O ? F HOH . ? A HOH 504 ? 1_555 151.6 ? 24 OE2 ? A GLU 329 ? A GLU 324 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 O ? F HOH . ? A HOH 504 ? 1_555 86.6 ? 25 OE2 ? A GLU 343 ? A GLU 338 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 O ? F HOH . ? A HOH 504 ? 1_555 83.3 ? 26 OD2 ? A ASP 236 ? A ASP 231 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 O ? F HOH . ? A HOH 604 ? 1_555 93.7 ? 27 NE2 ? A HIS 300 ? A HIS 295 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 O ? F HOH . ? A HOH 604 ? 1_555 82.2 ? 28 OE2 ? A GLU 329 ? A GLU 324 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 O ? F HOH . ? A HOH 604 ? 1_555 108.0 ? 29 OE2 ? A GLU 343 ? A GLU 338 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 O ? F HOH . ? A HOH 604 ? 1_555 155.8 ? 30 O ? F HOH . ? A HOH 504 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 O ? F HOH . ? A HOH 604 ? 1_555 74.5 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TYR _struct_mon_prot_cis.label_seq_id 309 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TYR _struct_mon_prot_cis.auth_seq_id 304 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 310 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 305 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 4.39 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? AA3 ? 4 ? AA4 ? 2 ? AA5 ? 2 ? AA6 ? 3 ? AA7 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA7 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 23 ? THR A 24 ? MET A 18 THR A 19 AA1 2 SER A 101 ? VAL A 104 ? SER A 96 VAL A 99 AA1 3 ASN A 124 ? ASN A 127 ? ASN A 119 ASN A 122 AA2 1 GLY A 48 ? MET A 50 ? GLY A 43 MET A 45 AA2 2 MET A 58 ? PRO A 62 ? MET A 53 PRO A 57 AA2 3 ASP A 77 ? TYR A 81 ? ASP A 72 TYR A 76 AA3 1 LEU A 197 ? SER A 200 ? LEU A 192 SER A 195 AA3 2 LYS A 220 ? LEU A 226 ? LYS A 215 LEU A 221 AA3 3 ALA A 237 ? ILE A 243 ? ALA A 232 ILE A 238 AA3 4 ILE A 365 ? PHE A 366 ? ILE A 360 PHE A 361 AA4 1 MET A 229 ? SER A 230 ? MET A 224 SER A 225 AA4 2 TYR A 233 ? ALA A 234 ? TYR A 228 ALA A 229 AA5 1 GLY A 299 ? GLY A 301 ? GLY A 294 GLY A 296 AA5 2 GLU A 308 ? ILE A 312 ? GLU A 303 ILE A 307 AA6 1 CYS A 325 ? ASN A 328 ? CYS A 320 ASN A 323 AA6 2 ASP A 344 ? VAL A 348 ? ASP A 339 VAL A 343 AA6 3 CYS A 353 ? SER A 355 ? CYS A 348 SER A 350 AA7 1 GLY A 331 ? ILE A 334 ? GLY A 326 ILE A 329 AA7 2 VAL A 338 ? ARG A 341 ? VAL A 333 ARG A 336 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N MET A 23 ? N MET A 18 O ALA A 103 ? O ALA A 98 AA1 2 3 N VAL A 104 ? N VAL A 99 O VAL A 126 ? O VAL A 121 AA2 1 2 N MET A 50 ? N MET A 45 O MET A 58 ? O MET A 53 AA2 2 3 N LEU A 59 ? N LEU A 54 O ASP A 77 ? O ASP A 72 AA3 1 2 N LEU A 197 ? N LEU A 192 O ASP A 225 ? O ASP A 220 AA3 2 3 N PHE A 224 ? N PHE A 219 O ARG A 239 ? O ARG A 234 AA3 3 4 N ALA A 242 ? N ALA A 237 O PHE A 366 ? O PHE A 361 AA4 1 2 N SER A 230 ? N SER A 225 O TYR A 233 ? O TYR A 228 AA5 1 2 N GLY A 299 ? N GLY A 294 O ILE A 312 ? O ILE A 307 AA6 1 2 N ASN A 328 ? N ASN A 323 O ASP A 344 ? O ASP A 339 AA6 2 3 N TYR A 347 ? N TYR A 342 O GLU A 354 ? O GLU A 349 AA7 1 2 N ILE A 334 ? N ILE A 329 O VAL A 338 ? O VAL A 333 # _pdbx_entry_details.entry_id 39JO _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 38 ? A 56.25 -110.32 2 1 HIS A 38 ? B 59.41 -111.22 3 1 ASP A 49 ? ? -146.24 48.20 4 1 ARG A 163 ? ? 49.73 -129.19 5 1 LYS A 332 ? ? -121.40 -57.51 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 609 ? F HOH . 2 1 A HOH 975 ? F HOH . 3 1 A HOH 1048 ? F HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z+1/2 3 -x+1/2,y,-z 4 -x,-y+1/2,z 5 x+1/2,y+1/2,z+1/2 6 x+1/2,-y+1/2,-z+1 7 -x+1,y+1/2,-z+1/2 8 -x+1/2,-y+1,z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -37.75152196417511 35.62876260545912 -50.614499321599524 0.21346552192038873 ? -0.0011871526495808268 ? 0.001790230557837518 ? 0.14852197647030504 ? 0.02137188312876164 ? 0.22197473520590205 ? 3.2678986812271082 ? 0.10757081483181183 ? 0.7958380455268789 ? 2.8237607281023567 ? 0.0532611503936276 ? 1.0017225116530457 ? -0.03177630428164447 ? 0.014140929973788472 ? 0.26264470568007453 ? -0.15264112318998183 ? 0.005910823949605823 ? 0.3742426385417212 ? 0.05080697728671605 ? -0.035935590917994885 ? 0.007076288263144568 ? 2 'X-RAY DIFFRACTION' ? refined -20.354829904479892 19.23614994070901 -22.98701564768878 0.1975325635206911 ? -0.005081659952354593 ? -0.004563914147186564 ? 0.18930128819611644 ? 0.003159695503840641 ? 0.18937016078059177 ? 0.990127100643267 ? -0.03570489021237932 ? -0.2376635981729044 ? 1.2250167956962996 ? -0.3113651870037704 ? 1.1258228908762682 ? 0.02056256683860255 ? -0.020576727581489124 ? -0.025523423464905434 ? 0.03769527564831195 ? -0.0414938136695451 ? 0.0365581316209163 ? 0.014446237937823658 ? 0.06064970112263191 ? 0.022732349256315888 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A -4 ? A 140 A 135 ? ? ;chain 'A' and (resid -4 through 135 ) ; 2 'X-RAY DIFFRACTION' 2 A 141 A 136 ? A 366 A 361 ? ? ;chain 'A' and (resid 136 through 361 ) ; # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 1119 ? 6.44 . 2 1 O ? A HOH 1120 ? 6.44 . 3 1 O ? A HOH 1121 ? 6.84 . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACT C C N N 1 ACT O O N N 2 ACT OXT O N N 3 ACT CH3 C N N 4 ACT H1 H N N 5 ACT H2 H N N 6 ACT H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASN N N N N 48 ASN CA C N S 49 ASN C C N N 50 ASN O O N N 51 ASN CB C N N 52 ASN CG C N N 53 ASN OD1 O N N 54 ASN ND2 N N N 55 ASN OXT O N N 56 ASN H H N N 57 ASN H2 H N N 58 ASN HA H N N 59 ASN HB2 H N N 60 ASN HB3 H N N 61 ASN HD21 H N N 62 ASN HD22 H N N 63 ASN HXT H N N 64 ASP N N N N 65 ASP CA C N S 66 ASP C C N N 67 ASP O O N N 68 ASP CB C N N 69 ASP CG C N N 70 ASP OD1 O N N 71 ASP OD2 O N N 72 ASP OXT O N N 73 ASP H H N N 74 ASP H2 H N N 75 ASP HA H N N 76 ASP HB2 H N N 77 ASP HB3 H N N 78 ASP HD2 H N N 79 ASP HXT H N N 80 CYS N N N N 81 CYS CA C N R 82 CYS C C N N 83 CYS O O N N 84 CYS CB C N N 85 CYS SG S N N 86 CYS OXT O N N 87 CYS H H N N 88 CYS H2 H N N 89 CYS HA H N N 90 CYS HB2 H N N 91 CYS HB3 H N N 92 CYS HG H N N 93 CYS HXT H N N 94 GLN N N N N 95 GLN CA C N S 96 GLN C C N N 97 GLN O O N N 98 GLN CB C N N 99 GLN CG C N N 100 GLN CD C N N 101 GLN OE1 O N N 102 GLN NE2 N N N 103 GLN OXT O N N 104 GLN H H N N 105 GLN H2 H N N 106 GLN HA H N N 107 GLN HB2 H N N 108 GLN HB3 H N N 109 GLN HG2 H N N 110 GLN HG3 H N N 111 GLN HE21 H N N 112 GLN HE22 H N N 113 GLN HXT H N N 114 GLU N N N N 115 GLU CA C N S 116 GLU C C N N 117 GLU O O N N 118 GLU CB C N N 119 GLU CG C N N 120 GLU CD C N N 121 GLU OE1 O N N 122 GLU OE2 O N N 123 GLU OXT O N N 124 GLU H H N N 125 GLU H2 H N N 126 GLU HA H N N 127 GLU HB2 H N N 128 GLU HB3 H N N 129 GLU HG2 H N N 130 GLU HG3 H N N 131 GLU HE2 H N N 132 GLU HXT H N N 133 GLY N N N N 134 GLY CA C N N 135 GLY C C N N 136 GLY O O N N 137 GLY OXT O N N 138 GLY H H N N 139 GLY H2 H N N 140 GLY HA2 H N N 141 GLY HA3 H N N 142 GLY HXT H N N 143 HIS N N N N 144 HIS CA C N S 145 HIS C C N N 146 HIS O O N N 147 HIS CB C N N 148 HIS CG C Y N 149 HIS ND1 N Y N 150 HIS CD2 C Y N 151 HIS CE1 C Y N 152 HIS NE2 N Y N 153 HIS OXT O N N 154 HIS H H N N 155 HIS H2 H N N 156 HIS HA H N N 157 HIS HB2 H N N 158 HIS HB3 H N N 159 HIS HD1 H N N 160 HIS HD2 H N N 161 HIS HE1 H N N 162 HIS HE2 H N N 163 HIS HXT H N N 164 HOH O O N N 165 HOH H1 H N N 166 HOH H2 H N N 167 ILE N N N N 168 ILE CA C N S 169 ILE C C N N 170 ILE O O N N 171 ILE CB C N S 172 ILE CG1 C N N 173 ILE CG2 C N N 174 ILE CD1 C N N 175 ILE OXT O N N 176 ILE H H N N 177 ILE H2 H N N 178 ILE HA H N N 179 ILE HB H N N 180 ILE HG12 H N N 181 ILE HG13 H N N 182 ILE HG21 H N N 183 ILE HG22 H N N 184 ILE HG23 H N N 185 ILE HD11 H N N 186 ILE HD12 H N N 187 ILE HD13 H N N 188 ILE HXT H N N 189 LEU N N N N 190 LEU CA C N S 191 LEU C C N N 192 LEU O O N N 193 LEU CB C N N 194 LEU CG C N N 195 LEU CD1 C N N 196 LEU CD2 C N N 197 LEU OXT O N N 198 LEU H H N N 199 LEU H2 H N N 200 LEU HA H N N 201 LEU HB2 H N N 202 LEU HB3 H N N 203 LEU HG H N N 204 LEU HD11 H N N 205 LEU HD12 H N N 206 LEU HD13 H N N 207 LEU HD21 H N N 208 LEU HD22 H N N 209 LEU HD23 H N N 210 LEU HXT H N N 211 LYS N N N N 212 LYS CA C N S 213 LYS C C N N 214 LYS O O N N 215 LYS CB C N N 216 LYS CG C N N 217 LYS CD C N N 218 LYS CE C N N 219 LYS NZ N N N 220 LYS OXT O N N 221 LYS H H N N 222 LYS H2 H N N 223 LYS HA H N N 224 LYS HB2 H N N 225 LYS HB3 H N N 226 LYS HG2 H N N 227 LYS HG3 H N N 228 LYS HD2 H N N 229 LYS HD3 H N N 230 LYS HE2 H N N 231 LYS HE3 H N N 232 LYS HZ1 H N N 233 LYS HZ2 H N N 234 LYS HZ3 H N N 235 LYS HXT H N N 236 MET N N N N 237 MET CA C N S 238 MET C C N N 239 MET O O N N 240 MET CB C N N 241 MET CG C N N 242 MET SD S N N 243 MET CE C N N 244 MET OXT O N N 245 MET H H N N 246 MET H2 H N N 247 MET HA H N N 248 MET HB2 H N N 249 MET HB3 H N N 250 MET HG2 H N N 251 MET HG3 H N N 252 MET HE1 H N N 253 MET HE2 H N N 254 MET HE3 H N N 255 MET HXT H N N 256 MN MN MN N N 257 P6G O1 O N N 258 P6G C2 C N N 259 P6G C3 C N N 260 P6G O4 O N N 261 P6G C5 C N N 262 P6G C6 C N N 263 P6G O7 O N N 264 P6G C8 C N N 265 P6G C9 C N N 266 P6G O10 O N N 267 P6G C11 C N N 268 P6G C12 C N N 269 P6G O13 O N N 270 P6G C14 C N N 271 P6G C15 C N N 272 P6G O16 O N N 273 P6G C17 C N N 274 P6G C18 C N N 275 P6G O19 O N N 276 P6G H1 H N N 277 P6G H21 H N N 278 P6G H22 H N N 279 P6G H31 H N N 280 P6G H32 H N N 281 P6G H51 H N N 282 P6G H52 H N N 283 P6G H61 H N N 284 P6G H62 H N N 285 P6G H81 H N N 286 P6G H82 H N N 287 P6G H91 H N N 288 P6G H92 H N N 289 P6G H111 H N N 290 P6G H112 H N N 291 P6G H121 H N N 292 P6G H122 H N N 293 P6G H141 H N N 294 P6G H142 H N N 295 P6G H151 H N N 296 P6G H152 H N N 297 P6G H171 H N N 298 P6G H172 H N N 299 P6G H181 H N N 300 P6G H182 H N N 301 P6G H19 H N N 302 PHE N N N N 303 PHE CA C N S 304 PHE C C N N 305 PHE O O N N 306 PHE CB C N N 307 PHE CG C Y N 308 PHE CD1 C Y N 309 PHE CD2 C Y N 310 PHE CE1 C Y N 311 PHE CE2 C Y N 312 PHE CZ C Y N 313 PHE OXT O N N 314 PHE H H N N 315 PHE H2 H N N 316 PHE HA H N N 317 PHE HB2 H N N 318 PHE HB3 H N N 319 PHE HD1 H N N 320 PHE HD2 H N N 321 PHE HE1 H N N 322 PHE HE2 H N N 323 PHE HZ H N N 324 PHE HXT H N N 325 PRO N N N N 326 PRO CA C N S 327 PRO C C N N 328 PRO O O N N 329 PRO CB C N N 330 PRO CG C N N 331 PRO CD C N N 332 PRO OXT O N N 333 PRO H H N N 334 PRO HA H N N 335 PRO HB2 H N N 336 PRO HB3 H N N 337 PRO HG2 H N N 338 PRO HG3 H N N 339 PRO HD2 H N N 340 PRO HD3 H N N 341 PRO HXT H N N 342 SER N N N N 343 SER CA C N S 344 SER C C N N 345 SER O O N N 346 SER CB C N N 347 SER OG O N N 348 SER OXT O N N 349 SER H H N N 350 SER H2 H N N 351 SER HA H N N 352 SER HB2 H N N 353 SER HB3 H N N 354 SER HG H N N 355 SER HXT H N N 356 THR N N N N 357 THR CA C N S 358 THR C C N N 359 THR O O N N 360 THR CB C N R 361 THR OG1 O N N 362 THR CG2 C N N 363 THR OXT O N N 364 THR H H N N 365 THR H2 H N N 366 THR HA H N N 367 THR HB H N N 368 THR HG1 H N N 369 THR HG21 H N N 370 THR HG22 H N N 371 THR HG23 H N N 372 THR HXT H N N 373 TRP N N N N 374 TRP CA C N S 375 TRP C C N N 376 TRP O O N N 377 TRP CB C N N 378 TRP CG C Y N 379 TRP CD1 C Y N 380 TRP CD2 C Y N 381 TRP NE1 N Y N 382 TRP CE2 C Y N 383 TRP CE3 C Y N 384 TRP CZ2 C Y N 385 TRP CZ3 C Y N 386 TRP CH2 C Y N 387 TRP OXT O N N 388 TRP H H N N 389 TRP H2 H N N 390 TRP HA H N N 391 TRP HB2 H N N 392 TRP HB3 H N N 393 TRP HD1 H N N 394 TRP HE1 H N N 395 TRP HE3 H N N 396 TRP HZ2 H N N 397 TRP HZ3 H N N 398 TRP HH2 H N N 399 TRP HXT H N N 400 TYR N N N N 401 TYR CA C N S 402 TYR C C N N 403 TYR O O N N 404 TYR CB C N N 405 TYR CG C Y N 406 TYR CD1 C Y N 407 TYR CD2 C Y N 408 TYR CE1 C Y N 409 TYR CE2 C Y N 410 TYR CZ C Y N 411 TYR OH O N N 412 TYR OXT O N N 413 TYR H H N N 414 TYR H2 H N N 415 TYR HA H N N 416 TYR HB2 H N N 417 TYR HB3 H N N 418 TYR HD1 H N N 419 TYR HD2 H N N 420 TYR HE1 H N N 421 TYR HE2 H N N 422 TYR HH H N N 423 TYR HXT H N N 424 VAL N N N N 425 VAL CA C N S 426 VAL C C N N 427 VAL O O N N 428 VAL CB C N N 429 VAL CG1 C N N 430 VAL CG2 C N N 431 VAL OXT O N N 432 VAL H H N N 433 VAL H2 H N N 434 VAL HA H N N 435 VAL HB H N N 436 VAL HG11 H N N 437 VAL HG12 H N N 438 VAL HG13 H N N 439 VAL HG21 H N N 440 VAL HG22 H N N 441 VAL HG23 H N N 442 VAL HXT H N N 443 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACT C O doub N N 1 ACT C OXT sing N N 2 ACT C CH3 sing N N 3 ACT CH3 H1 sing N N 4 ACT CH3 H2 sing N N 5 ACT CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASN N CA sing N N 45 ASN N H sing N N 46 ASN N H2 sing N N 47 ASN CA C sing N N 48 ASN CA CB sing N N 49 ASN CA HA sing N N 50 ASN C O doub N N 51 ASN C OXT sing N N 52 ASN CB CG sing N N 53 ASN CB HB2 sing N N 54 ASN CB HB3 sing N N 55 ASN CG OD1 doub N N 56 ASN CG ND2 sing N N 57 ASN ND2 HD21 sing N N 58 ASN ND2 HD22 sing N N 59 ASN OXT HXT sing N N 60 ASP N CA sing N N 61 ASP N H sing N N 62 ASP N H2 sing N N 63 ASP CA C sing N N 64 ASP CA CB sing N N 65 ASP CA HA sing N N 66 ASP C O doub N N 67 ASP C OXT sing N N 68 ASP CB CG sing N N 69 ASP CB HB2 sing N N 70 ASP CB HB3 sing N N 71 ASP CG OD1 doub N N 72 ASP CG OD2 sing N N 73 ASP OD2 HD2 sing N N 74 ASP OXT HXT sing N N 75 CYS N CA sing N N 76 CYS N H sing N N 77 CYS N H2 sing N N 78 CYS CA C sing N N 79 CYS CA CB sing N N 80 CYS CA HA sing N N 81 CYS C O doub N N 82 CYS C OXT sing N N 83 CYS CB SG sing N N 84 CYS CB HB2 sing N N 85 CYS CB HB3 sing N N 86 CYS SG HG sing N N 87 CYS OXT HXT sing N N 88 GLN N CA sing N N 89 GLN N H sing N N 90 GLN N H2 sing N N 91 GLN CA C sing N N 92 GLN CA CB sing N N 93 GLN CA HA sing N N 94 GLN C O doub N N 95 GLN C OXT sing N N 96 GLN CB CG sing N N 97 GLN CB HB2 sing N N 98 GLN CB HB3 sing N N 99 GLN CG CD sing N N 100 GLN CG HG2 sing N N 101 GLN CG HG3 sing N N 102 GLN CD OE1 doub N N 103 GLN CD NE2 sing N N 104 GLN NE2 HE21 sing N N 105 GLN NE2 HE22 sing N N 106 GLN OXT HXT sing N N 107 GLU N CA sing N N 108 GLU N H sing N N 109 GLU N H2 sing N N 110 GLU CA C sing N N 111 GLU CA CB sing N N 112 GLU CA HA sing N N 113 GLU C O doub N N 114 GLU C OXT sing N N 115 GLU CB CG sing N N 116 GLU CB HB2 sing N N 117 GLU CB HB3 sing N N 118 GLU CG CD sing N N 119 GLU CG HG2 sing N N 120 GLU CG HG3 sing N N 121 GLU CD OE1 doub N N 122 GLU CD OE2 sing N N 123 GLU OE2 HE2 sing N N 124 GLU OXT HXT sing N N 125 GLY N CA sing N N 126 GLY N H sing N N 127 GLY N H2 sing N N 128 GLY CA C sing N N 129 GLY CA HA2 sing N N 130 GLY CA HA3 sing N N 131 GLY C O doub N N 132 GLY C OXT sing N N 133 GLY OXT HXT sing N N 134 HIS N CA sing N N 135 HIS N H sing N N 136 HIS N H2 sing N N 137 HIS CA C sing N N 138 HIS CA CB sing N N 139 HIS CA HA sing N N 140 HIS C O doub N N 141 HIS C OXT sing N N 142 HIS CB CG sing N N 143 HIS CB HB2 sing N N 144 HIS CB HB3 sing N N 145 HIS CG ND1 sing Y N 146 HIS CG CD2 doub Y N 147 HIS ND1 CE1 doub Y N 148 HIS ND1 HD1 sing N N 149 HIS CD2 NE2 sing Y N 150 HIS CD2 HD2 sing N N 151 HIS CE1 NE2 sing Y N 152 HIS CE1 HE1 sing N N 153 HIS NE2 HE2 sing N N 154 HIS OXT HXT sing N N 155 HOH O H1 sing N N 156 HOH O H2 sing N N 157 ILE N CA sing N N 158 ILE N H sing N N 159 ILE N H2 sing N N 160 ILE CA C sing N N 161 ILE CA CB sing N N 162 ILE CA HA sing N N 163 ILE C O doub N N 164 ILE C OXT sing N N 165 ILE CB CG1 sing N N 166 ILE CB CG2 sing N N 167 ILE CB HB sing N N 168 ILE CG1 CD1 sing N N 169 ILE CG1 HG12 sing N N 170 ILE CG1 HG13 sing N N 171 ILE CG2 HG21 sing N N 172 ILE CG2 HG22 sing N N 173 ILE CG2 HG23 sing N N 174 ILE CD1 HD11 sing N N 175 ILE CD1 HD12 sing N N 176 ILE CD1 HD13 sing N N 177 ILE OXT HXT sing N N 178 LEU N CA sing N N 179 LEU N H sing N N 180 LEU N H2 sing N N 181 LEU CA C sing N N 182 LEU CA CB sing N N 183 LEU CA HA sing N N 184 LEU C O doub N N 185 LEU C OXT sing N N 186 LEU CB CG sing N N 187 LEU CB HB2 sing N N 188 LEU CB HB3 sing N N 189 LEU CG CD1 sing N N 190 LEU CG CD2 sing N N 191 LEU CG HG sing N N 192 LEU CD1 HD11 sing N N 193 LEU CD1 HD12 sing N N 194 LEU CD1 HD13 sing N N 195 LEU CD2 HD21 sing N N 196 LEU CD2 HD22 sing N N 197 LEU CD2 HD23 sing N N 198 LEU OXT HXT sing N N 199 LYS N CA sing N N 200 LYS N H sing N N 201 LYS N H2 sing N N 202 LYS CA C sing N N 203 LYS CA CB sing N N 204 LYS CA HA sing N N 205 LYS C O doub N N 206 LYS C OXT sing N N 207 LYS CB CG sing N N 208 LYS CB HB2 sing N N 209 LYS CB HB3 sing N N 210 LYS CG CD sing N N 211 LYS CG HG2 sing N N 212 LYS CG HG3 sing N N 213 LYS CD CE sing N N 214 LYS CD HD2 sing N N 215 LYS CD HD3 sing N N 216 LYS CE NZ sing N N 217 LYS CE HE2 sing N N 218 LYS CE HE3 sing N N 219 LYS NZ HZ1 sing N N 220 LYS NZ HZ2 sing N N 221 LYS NZ HZ3 sing N N 222 LYS OXT HXT sing N N 223 MET N CA sing N N 224 MET N H sing N N 225 MET N H2 sing N N 226 MET CA C sing N N 227 MET CA CB sing N N 228 MET CA HA sing N N 229 MET C O doub N N 230 MET C OXT sing N N 231 MET CB CG sing N N 232 MET CB HB2 sing N N 233 MET CB HB3 sing N N 234 MET CG SD sing N N 235 MET CG HG2 sing N N 236 MET CG HG3 sing N N 237 MET SD CE sing N N 238 MET CE HE1 sing N N 239 MET CE HE2 sing N N 240 MET CE HE3 sing N N 241 MET OXT HXT sing N N 242 P6G O1 C2 sing N N 243 P6G O1 H1 sing N N 244 P6G C2 C3 sing N N 245 P6G C2 H21 sing N N 246 P6G C2 H22 sing N N 247 P6G C3 O4 sing N N 248 P6G C3 H31 sing N N 249 P6G C3 H32 sing N N 250 P6G O4 C5 sing N N 251 P6G C5 C6 sing N N 252 P6G C5 H51 sing N N 253 P6G C5 H52 sing N N 254 P6G C6 O7 sing N N 255 P6G C6 H61 sing N N 256 P6G C6 H62 sing N N 257 P6G O7 C8 sing N N 258 P6G C8 C9 sing N N 259 P6G C8 H81 sing N N 260 P6G C8 H82 sing N N 261 P6G C9 O10 sing N N 262 P6G C9 H91 sing N N 263 P6G C9 H92 sing N N 264 P6G O10 C11 sing N N 265 P6G C11 C12 sing N N 266 P6G C11 H111 sing N N 267 P6G C11 H112 sing N N 268 P6G C12 O13 sing N N 269 P6G C12 H121 sing N N 270 P6G C12 H122 sing N N 271 P6G O13 C14 sing N N 272 P6G C14 C15 sing N N 273 P6G C14 H141 sing N N 274 P6G C14 H142 sing N N 275 P6G C15 O16 sing N N 276 P6G C15 H151 sing N N 277 P6G C15 H152 sing N N 278 P6G O16 C17 sing N N 279 P6G C17 C18 sing N N 280 P6G C17 H171 sing N N 281 P6G C17 H172 sing N N 282 P6G C18 O19 sing N N 283 P6G C18 H181 sing N N 284 P6G C18 H182 sing N N 285 P6G O19 H19 sing N N 286 PHE N CA sing N N 287 PHE N H sing N N 288 PHE N H2 sing N N 289 PHE CA C sing N N 290 PHE CA CB sing N N 291 PHE CA HA sing N N 292 PHE C O doub N N 293 PHE C OXT sing N N 294 PHE CB CG sing N N 295 PHE CB HB2 sing N N 296 PHE CB HB3 sing N N 297 PHE CG CD1 doub Y N 298 PHE CG CD2 sing Y N 299 PHE CD1 CE1 sing Y N 300 PHE CD1 HD1 sing N N 301 PHE CD2 CE2 doub Y N 302 PHE CD2 HD2 sing N N 303 PHE CE1 CZ doub Y N 304 PHE CE1 HE1 sing N N 305 PHE CE2 CZ sing Y N 306 PHE CE2 HE2 sing N N 307 PHE CZ HZ sing N N 308 PHE OXT HXT sing N N 309 PRO N CA sing N N 310 PRO N CD sing N N 311 PRO N H sing N N 312 PRO CA C sing N N 313 PRO CA CB sing N N 314 PRO CA HA sing N N 315 PRO C O doub N N 316 PRO C OXT sing N N 317 PRO CB CG sing N N 318 PRO CB HB2 sing N N 319 PRO CB HB3 sing N N 320 PRO CG CD sing N N 321 PRO CG HG2 sing N N 322 PRO CG HG3 sing N N 323 PRO CD HD2 sing N N 324 PRO CD HD3 sing N N 325 PRO OXT HXT sing N N 326 SER N CA sing N N 327 SER N H sing N N 328 SER N H2 sing N N 329 SER CA C sing N N 330 SER CA CB sing N N 331 SER CA HA sing N N 332 SER C O doub N N 333 SER C OXT sing N N 334 SER CB OG sing N N 335 SER CB HB2 sing N N 336 SER CB HB3 sing N N 337 SER OG HG sing N N 338 SER OXT HXT sing N N 339 THR N CA sing N N 340 THR N H sing N N 341 THR N H2 sing N N 342 THR CA C sing N N 343 THR CA CB sing N N 344 THR CA HA sing N N 345 THR C O doub N N 346 THR C OXT sing N N 347 THR CB OG1 sing N N 348 THR CB CG2 sing N N 349 THR CB HB sing N N 350 THR OG1 HG1 sing N N 351 THR CG2 HG21 sing N N 352 THR CG2 HG22 sing N N 353 THR CG2 HG23 sing N N 354 THR OXT HXT sing N N 355 TRP N CA sing N N 356 TRP N H sing N N 357 TRP N H2 sing N N 358 TRP CA C sing N N 359 TRP CA CB sing N N 360 TRP CA HA sing N N 361 TRP C O doub N N 362 TRP C OXT sing N N 363 TRP CB CG sing N N 364 TRP CB HB2 sing N N 365 TRP CB HB3 sing N N 366 TRP CG CD1 doub Y N 367 TRP CG CD2 sing Y N 368 TRP CD1 NE1 sing Y N 369 TRP CD1 HD1 sing N N 370 TRP CD2 CE2 doub Y N 371 TRP CD2 CE3 sing Y N 372 TRP NE1 CE2 sing Y N 373 TRP NE1 HE1 sing N N 374 TRP CE2 CZ2 sing Y N 375 TRP CE3 CZ3 doub Y N 376 TRP CE3 HE3 sing N N 377 TRP CZ2 CH2 doub Y N 378 TRP CZ2 HZ2 sing N N 379 TRP CZ3 CH2 sing Y N 380 TRP CZ3 HZ3 sing N N 381 TRP CH2 HH2 sing N N 382 TRP OXT HXT sing N N 383 TYR N CA sing N N 384 TYR N H sing N N 385 TYR N H2 sing N N 386 TYR CA C sing N N 387 TYR CA CB sing N N 388 TYR CA HA sing N N 389 TYR C O doub N N 390 TYR C OXT sing N N 391 TYR CB CG sing N N 392 TYR CB HB2 sing N N 393 TYR CB HB3 sing N N 394 TYR CG CD1 doub Y N 395 TYR CG CD2 sing Y N 396 TYR CD1 CE1 sing Y N 397 TYR CD1 HD1 sing N N 398 TYR CD2 CE2 doub Y N 399 TYR CD2 HD2 sing N N 400 TYR CE1 CZ doub Y N 401 TYR CE1 HE1 sing N N 402 TYR CE2 CZ sing Y N 403 TYR CE2 HE2 sing N N 404 TYR CZ OH sing N N 405 TYR OH HH sing N N 406 TYR OXT HXT sing N N 407 VAL N CA sing N N 408 VAL N H sing N N 409 VAL N H2 sing N N 410 VAL CA C sing N N 411 VAL CA CB sing N N 412 VAL CA HA sing N N 413 VAL C O doub N N 414 VAL C OXT sing N N 415 VAL CB CG1 sing N N 416 VAL CB CG2 sing N N 417 VAL CB HB sing N N 418 VAL CG1 HG11 sing N N 419 VAL CG1 HG12 sing N N 420 VAL CG1 HG13 sing N N 421 VAL CG2 HG21 sing N N 422 VAL CG2 HG22 sing N N 423 VAL CG2 HG23 sing N N 424 VAL OXT HXT sing N N 425 # _pdbx_audit_support.funding_organization 'Natural Sciences and Engineering Research Council (NSERC, Canada)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number RGPIN-2022-04991 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6XMR _pdbx_initial_refinement_model.details ? # _space_group.crystal_system orthorhombic _space_group.IT_number 24 _space_group.name_H-M_alt 'I 21 21 21' _space_group.name_Hall 'I 2b 2c' _space_group.id 1 # _atom_sites.entry_id 39JO _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.012006 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011886 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007582 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MN ? ? 20.23591 4.67902 ? ? 2.76514 44.01191 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #