data_39PB # _entry.id 39PB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.417 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 39PB pdb_000039pb 10.2210/pdb39pb/pdb WWPDB D_1000312869 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-10-28 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 39PB _pdbx_database_status.recvd_initial_deposition_date 2026-10-20 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 swlovell@ku.edu Scott Lovell ? 'principal investigator/group leader' 0000-0002-3215-4472 3 isabelle.phan@seattlechildrens.org Isabelle Phan ? 'principal investigator/group leader' 0000-0001-6873-3401 4 Bart.Staker@seattlechildrens.org Bart Staker ? 'principal investigator/group leader' 0000-0001-9570-5086 5 peter.myler@seattlechildrens.org Peter Myler ? 'principal investigator/group leader' 0000-0002-0056-0513 # _audit_author.name 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of a septum formation protein Maf from Coccidioides immitis (AMP complex)' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ung, A.R.' 1 0000-0002-9906-0710 primary 'Lovell, S.' 2 0000-0002-3215-4472 primary 'Battaile, K.P.' 3 0000-0003-0833-3259 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Septum formation protein Maf' 27396.418 1 ? ? P42-L268 ? 2 non-polymer syn 'ADENOSINE MONOPHOSPHATE' 347.221 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 water nat water 18.015 25 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAHHHHHHMGTLEAQTQGPGSPPPLSLPVLNQLRSKRVILASASPRRKQIISFLGLRNVEIIPSNTPEDFPKTLTPFEYV LQTATHKAITVYQQEVNNLEKGEPALILAADTIVVDISTGDILEKPRSEAHHISMLKLLRDVMDHKVYTAVAAIVPLESA RDPGYALETVVEETKVRFDPDVTDELILAYVRTREGVDKAGGYGMQGLGSILVQRIEGSYDNVIGLPLRATLRLIEKAMA KAEDDDLL ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHHMGTLEAQTQGPGSPPPLSLPVLNQLRSKRVILASASPRRKQIISFLGLRNVEIIPSNTPEDFPKTLTPFEYV LQTATHKAITVYQQEVNNLEKGEPALILAADTIVVDISTGDILEKPRSEAHHISMLKLLRDVMDHKVYTAVAAIVPLESA RDPGYALETVVEETKVRFDPDVTDELILAYVRTREGVDKAGGYGMQGLGSILVQRIEGSYDNVIGLPLRATLRLIEKAMA KAEDDDLL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ADENOSINE MONOPHOSPHATE' AMP 3 GLYCEROL GOL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 MET n 1 10 GLY n 1 11 THR n 1 12 LEU n 1 13 GLU n 1 14 ALA n 1 15 GLN n 1 16 THR n 1 17 GLN n 1 18 GLY n 1 19 PRO n 1 20 GLY n 1 21 SER n 1 22 PRO n 1 23 PRO n 1 24 PRO n 1 25 LEU n 1 26 SER n 1 27 LEU n 1 28 PRO n 1 29 VAL n 1 30 LEU n 1 31 ASN n 1 32 GLN n 1 33 LEU n 1 34 ARG n 1 35 SER n 1 36 LYS n 1 37 ARG n 1 38 VAL n 1 39 ILE n 1 40 LEU n 1 41 ALA n 1 42 SER n 1 43 ALA n 1 44 SER n 1 45 PRO n 1 46 ARG n 1 47 ARG n 1 48 LYS n 1 49 GLN n 1 50 ILE n 1 51 ILE n 1 52 SER n 1 53 PHE n 1 54 LEU n 1 55 GLY n 1 56 LEU n 1 57 ARG n 1 58 ASN n 1 59 VAL n 1 60 GLU n 1 61 ILE n 1 62 ILE n 1 63 PRO n 1 64 SER n 1 65 ASN n 1 66 THR n 1 67 PRO n 1 68 GLU n 1 69 ASP n 1 70 PHE n 1 71 PRO n 1 72 LYS n 1 73 THR n 1 74 LEU n 1 75 THR n 1 76 PRO n 1 77 PHE n 1 78 GLU n 1 79 TYR n 1 80 VAL n 1 81 LEU n 1 82 GLN n 1 83 THR n 1 84 ALA n 1 85 THR n 1 86 HIS n 1 87 LYS n 1 88 ALA n 1 89 ILE n 1 90 THR n 1 91 VAL n 1 92 TYR n 1 93 GLN n 1 94 GLN n 1 95 GLU n 1 96 VAL n 1 97 ASN n 1 98 ASN n 1 99 LEU n 1 100 GLU n 1 101 LYS n 1 102 GLY n 1 103 GLU n 1 104 PRO n 1 105 ALA n 1 106 LEU n 1 107 ILE n 1 108 LEU n 1 109 ALA n 1 110 ALA n 1 111 ASP n 1 112 THR n 1 113 ILE n 1 114 VAL n 1 115 VAL n 1 116 ASP n 1 117 ILE n 1 118 SER n 1 119 THR n 1 120 GLY n 1 121 ASP n 1 122 ILE n 1 123 LEU n 1 124 GLU n 1 125 LYS n 1 126 PRO n 1 127 ARG n 1 128 SER n 1 129 GLU n 1 130 ALA n 1 131 HIS n 1 132 HIS n 1 133 ILE n 1 134 SER n 1 135 MET n 1 136 LEU n 1 137 LYS n 1 138 LEU n 1 139 LEU n 1 140 ARG n 1 141 ASP n 1 142 VAL n 1 143 MET n 1 144 ASP n 1 145 HIS n 1 146 LYS n 1 147 VAL n 1 148 TYR n 1 149 THR n 1 150 ALA n 1 151 VAL n 1 152 ALA n 1 153 ALA n 1 154 ILE n 1 155 VAL n 1 156 PRO n 1 157 LEU n 1 158 GLU n 1 159 SER n 1 160 ALA n 1 161 ARG n 1 162 ASP n 1 163 PRO n 1 164 GLY n 1 165 TYR n 1 166 ALA n 1 167 LEU n 1 168 GLU n 1 169 THR n 1 170 VAL n 1 171 VAL n 1 172 GLU n 1 173 GLU n 1 174 THR n 1 175 LYS n 1 176 VAL n 1 177 ARG n 1 178 PHE n 1 179 ASP n 1 180 PRO n 1 181 ASP n 1 182 VAL n 1 183 THR n 1 184 ASP n 1 185 GLU n 1 186 LEU n 1 187 ILE n 1 188 LEU n 1 189 ALA n 1 190 TYR n 1 191 VAL n 1 192 ARG n 1 193 THR n 1 194 ARG n 1 195 GLU n 1 196 GLY n 1 197 VAL n 1 198 ASP n 1 199 LYS n 1 200 ALA n 1 201 GLY n 1 202 GLY n 1 203 TYR n 1 204 GLY n 1 205 MET n 1 206 GLN n 1 207 GLY n 1 208 LEU n 1 209 GLY n 1 210 SER n 1 211 ILE n 1 212 LEU n 1 213 VAL n 1 214 GLN n 1 215 ARG n 1 216 ILE n 1 217 GLU n 1 218 GLY n 1 219 SER n 1 220 TYR n 1 221 ASP n 1 222 ASN n 1 223 VAL n 1 224 ILE n 1 225 GLY n 1 226 LEU n 1 227 PRO n 1 228 LEU n 1 229 ARG n 1 230 ALA n 1 231 THR n 1 232 LEU n 1 233 ARG n 1 234 LEU n 1 235 ILE n 1 236 GLU n 1 237 LYS n 1 238 ALA n 1 239 MET n 1 240 ALA n 1 241 LYS n 1 242 ALA n 1 243 GLU n 1 244 ASP n 1 245 ASP n 1 246 ASP n 1 247 LEU n 1 248 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 248 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CIMG_03133 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Coccidioides immitis RS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 246410 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name CoimA.00961.a.A2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 AMP non-polymer . 'ADENOSINE MONOPHOSPHATE' ? 'C10 H14 N5 O7 P' 347.221 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 21 ? ? ? A . n A 1 2 ALA 2 22 ? ? ? A . n A 1 3 HIS 3 23 ? ? ? A . n A 1 4 HIS 4 24 ? ? ? A . n A 1 5 HIS 5 25 ? ? ? A . n A 1 6 HIS 6 26 ? ? ? A . n A 1 7 HIS 7 27 ? ? ? A . n A 1 8 HIS 8 28 ? ? ? A . n A 1 9 MET 9 29 ? ? ? A . n A 1 10 GLY 10 30 ? ? ? A . n A 1 11 THR 11 31 ? ? ? A . n A 1 12 LEU 12 32 ? ? ? A . n A 1 13 GLU 13 33 ? ? ? A . n A 1 14 ALA 14 34 ? ? ? A . n A 1 15 GLN 15 35 ? ? ? A . n A 1 16 THR 16 36 ? ? ? A . n A 1 17 GLN 17 37 ? ? ? A . n A 1 18 GLY 18 38 ? ? ? A . n A 1 19 PRO 19 39 ? ? ? A . n A 1 20 GLY 20 40 ? ? ? A . n A 1 21 SER 21 41 41 SER SER A . n A 1 22 PRO 22 42 42 PRO PRO A . n A 1 23 PRO 23 43 43 PRO PRO A . n A 1 24 PRO 24 44 44 PRO PRO A . n A 1 25 LEU 25 45 45 LEU LEU A . n A 1 26 SER 26 46 46 SER SER A . n A 1 27 LEU 27 47 47 LEU LEU A . n A 1 28 PRO 28 48 48 PRO PRO A . n A 1 29 VAL 29 49 49 VAL VAL A . n A 1 30 LEU 30 50 50 LEU LEU A . n A 1 31 ASN 31 51 51 ASN ASN A . n A 1 32 GLN 32 52 52 GLN GLN A . n A 1 33 LEU 33 53 53 LEU LEU A . n A 1 34 ARG 34 54 54 ARG ARG A . n A 1 35 SER 35 55 55 SER SER A . n A 1 36 LYS 36 56 56 LYS LYS A . n A 1 37 ARG 37 57 57 ARG ARG A . n A 1 38 VAL 38 58 58 VAL VAL A . n A 1 39 ILE 39 59 59 ILE ILE A . n A 1 40 LEU 40 60 60 LEU LEU A . n A 1 41 ALA 41 61 61 ALA ALA A . n A 1 42 SER 42 62 62 SER SER A . n A 1 43 ALA 43 63 63 ALA ALA A . n A 1 44 SER 44 64 64 SER SER A . n A 1 45 PRO 45 65 65 PRO PRO A . n A 1 46 ARG 46 66 66 ARG ARG A . n A 1 47 ARG 47 67 67 ARG ARG A . n A 1 48 LYS 48 68 68 LYS LYS A . n A 1 49 GLN 49 69 69 GLN GLN A . n A 1 50 ILE 50 70 70 ILE ILE A . n A 1 51 ILE 51 71 71 ILE ILE A . n A 1 52 SER 52 72 72 SER SER A . n A 1 53 PHE 53 73 73 PHE PHE A . n A 1 54 LEU 54 74 74 LEU LEU A . n A 1 55 GLY 55 75 75 GLY GLY A . n A 1 56 LEU 56 76 76 LEU LEU A . n A 1 57 ARG 57 77 77 ARG ARG A . n A 1 58 ASN 58 78 78 ASN ASN A . n A 1 59 VAL 59 79 79 VAL VAL A . n A 1 60 GLU 60 80 80 GLU GLU A . n A 1 61 ILE 61 81 81 ILE ILE A . n A 1 62 ILE 62 82 82 ILE ILE A . n A 1 63 PRO 63 83 83 PRO PRO A . n A 1 64 SER 64 84 84 SER SER A . n A 1 65 ASN 65 85 85 ASN ASN A . n A 1 66 THR 66 86 86 THR THR A . n A 1 67 PRO 67 87 87 PRO PRO A . n A 1 68 GLU 68 88 88 GLU GLU A . n A 1 69 ASP 69 89 89 ASP ASP A . n A 1 70 PHE 70 90 90 PHE PHE A . n A 1 71 PRO 71 91 91 PRO PRO A . n A 1 72 LYS 72 92 92 LYS LYS A . n A 1 73 THR 73 93 93 THR THR A . n A 1 74 LEU 74 94 94 LEU LEU A . n A 1 75 THR 75 95 95 THR THR A . n A 1 76 PRO 76 96 96 PRO PRO A . n A 1 77 PHE 77 97 97 PHE PHE A . n A 1 78 GLU 78 98 98 GLU GLU A . n A 1 79 TYR 79 99 99 TYR TYR A . n A 1 80 VAL 80 100 100 VAL VAL A . n A 1 81 LEU 81 101 101 LEU LEU A . n A 1 82 GLN 82 102 102 GLN GLN A . n A 1 83 THR 83 103 103 THR THR A . n A 1 84 ALA 84 104 104 ALA ALA A . n A 1 85 THR 85 105 105 THR THR A . n A 1 86 HIS 86 106 106 HIS HIS A . n A 1 87 LYS 87 107 107 LYS LYS A . n A 1 88 ALA 88 108 108 ALA ALA A . n A 1 89 ILE 89 109 109 ILE ILE A . n A 1 90 THR 90 110 110 THR THR A . n A 1 91 VAL 91 111 111 VAL VAL A . n A 1 92 TYR 92 112 112 TYR TYR A . n A 1 93 GLN 93 113 113 GLN GLN A . n A 1 94 GLN 94 114 114 GLN GLN A . n A 1 95 GLU 95 115 115 GLU GLU A . n A 1 96 VAL 96 116 116 VAL VAL A . n A 1 97 ASN 97 117 117 ASN ASN A . n A 1 98 ASN 98 118 118 ASN ASN A . n A 1 99 LEU 99 119 119 LEU LEU A . n A 1 100 GLU 100 120 120 GLU GLU A . n A 1 101 LYS 101 121 121 LYS LYS A . n A 1 102 GLY 102 122 122 GLY GLY A . n A 1 103 GLU 103 123 123 GLU GLU A . n A 1 104 PRO 104 124 124 PRO PRO A . n A 1 105 ALA 105 125 125 ALA ALA A . n A 1 106 LEU 106 126 126 LEU LEU A . n A 1 107 ILE 107 127 127 ILE ILE A . n A 1 108 LEU 108 128 128 LEU LEU A . n A 1 109 ALA 109 129 129 ALA ALA A . n A 1 110 ALA 110 130 130 ALA ALA A . n A 1 111 ASP 111 131 131 ASP ASP A . n A 1 112 THR 112 132 132 THR THR A . n A 1 113 ILE 113 133 133 ILE ILE A . n A 1 114 VAL 114 134 134 VAL VAL A . n A 1 115 VAL 115 135 135 VAL VAL A . n A 1 116 ASP 116 136 136 ASP ASP A . n A 1 117 ILE 117 137 137 ILE ILE A . n A 1 118 SER 118 138 138 SER SER A . n A 1 119 THR 119 139 139 THR THR A . n A 1 120 GLY 120 140 140 GLY GLY A . n A 1 121 ASP 121 141 141 ASP ASP A . n A 1 122 ILE 122 142 142 ILE ILE A . n A 1 123 LEU 123 143 143 LEU LEU A . n A 1 124 GLU 124 144 144 GLU GLU A . n A 1 125 LYS 125 145 145 LYS LYS A . n A 1 126 PRO 126 146 146 PRO PRO A . n A 1 127 ARG 127 147 147 ARG ARG A . n A 1 128 SER 128 148 148 SER SER A . n A 1 129 GLU 129 149 149 GLU GLU A . n A 1 130 ALA 130 150 150 ALA ALA A . n A 1 131 HIS 131 151 151 HIS HIS A . n A 1 132 HIS 132 152 152 HIS HIS A . n A 1 133 ILE 133 153 153 ILE ILE A . n A 1 134 SER 134 154 154 SER SER A . n A 1 135 MET 135 155 155 MET MET A . n A 1 136 LEU 136 156 156 LEU LEU A . n A 1 137 LYS 137 157 157 LYS LYS A . n A 1 138 LEU 138 158 158 LEU LEU A . n A 1 139 LEU 139 159 159 LEU LEU A . n A 1 140 ARG 140 160 160 ARG ARG A . n A 1 141 ASP 141 161 161 ASP ASP A . n A 1 142 VAL 142 162 162 VAL VAL A . n A 1 143 MET 143 163 163 MET MET A . n A 1 144 ASP 144 164 164 ASP ASP A . n A 1 145 HIS 145 165 165 HIS HIS A . n A 1 146 LYS 146 166 166 LYS LYS A . n A 1 147 VAL 147 167 167 VAL VAL A . n A 1 148 TYR 148 168 168 TYR TYR A . n A 1 149 THR 149 169 169 THR THR A . n A 1 150 ALA 150 170 170 ALA ALA A . n A 1 151 VAL 151 171 171 VAL VAL A . n A 1 152 ALA 152 172 172 ALA ALA A . n A 1 153 ALA 153 173 173 ALA ALA A . n A 1 154 ILE 154 174 174 ILE ILE A . n A 1 155 VAL 155 175 175 VAL VAL A . n A 1 156 PRO 156 176 176 PRO PRO A . n A 1 157 LEU 157 177 177 LEU LEU A . n A 1 158 GLU 158 178 178 GLU GLU A . n A 1 159 SER 159 179 179 SER SER A . n A 1 160 ALA 160 180 180 ALA ALA A . n A 1 161 ARG 161 181 181 ARG ARG A . n A 1 162 ASP 162 182 182 ASP ASP A . n A 1 163 PRO 163 183 183 PRO PRO A . n A 1 164 GLY 164 184 184 GLY GLY A . n A 1 165 TYR 165 185 185 TYR TYR A . n A 1 166 ALA 166 186 186 ALA ALA A . n A 1 167 LEU 167 187 187 LEU LEU A . n A 1 168 GLU 168 188 188 GLU GLU A . n A 1 169 THR 169 189 189 THR THR A . n A 1 170 VAL 170 190 190 VAL VAL A . n A 1 171 VAL 171 191 191 VAL VAL A . n A 1 172 GLU 172 192 192 GLU GLU A . n A 1 173 GLU 173 193 193 GLU GLU A . n A 1 174 THR 174 194 194 THR THR A . n A 1 175 LYS 175 195 195 LYS LYS A . n A 1 176 VAL 176 196 196 VAL VAL A . n A 1 177 ARG 177 197 197 ARG ARG A . n A 1 178 PHE 178 198 198 PHE PHE A . n A 1 179 ASP 179 199 199 ASP ASP A . n A 1 180 PRO 180 200 200 PRO PRO A . n A 1 181 ASP 181 201 201 ASP ASP A . n A 1 182 VAL 182 202 202 VAL VAL A . n A 1 183 THR 183 203 203 THR THR A . n A 1 184 ASP 184 204 204 ASP ASP A . n A 1 185 GLU 185 205 205 GLU GLU A . n A 1 186 LEU 186 206 206 LEU LEU A . n A 1 187 ILE 187 207 207 ILE ILE A . n A 1 188 LEU 188 208 208 LEU LEU A . n A 1 189 ALA 189 209 209 ALA ALA A . n A 1 190 TYR 190 210 210 TYR TYR A . n A 1 191 VAL 191 211 211 VAL VAL A . n A 1 192 ARG 192 212 212 ARG ARG A . n A 1 193 THR 193 213 213 THR THR A . n A 1 194 ARG 194 214 214 ARG ARG A . n A 1 195 GLU 195 215 215 GLU GLU A . n A 1 196 GLY 196 216 216 GLY GLY A . n A 1 197 VAL 197 217 217 VAL VAL A . n A 1 198 ASP 198 218 218 ASP ASP A . n A 1 199 LYS 199 219 219 LYS LYS A . n A 1 200 ALA 200 220 220 ALA ALA A . n A 1 201 GLY 201 221 221 GLY GLY A . n A 1 202 GLY 202 222 222 GLY GLY A . n A 1 203 TYR 203 223 223 TYR TYR A . n A 1 204 GLY 204 224 224 GLY GLY A . n A 1 205 MET 205 225 225 MET MET A . n A 1 206 GLN 206 226 226 GLN GLN A . n A 1 207 GLY 207 227 227 GLY GLY A . n A 1 208 LEU 208 228 228 LEU LEU A . n A 1 209 GLY 209 229 229 GLY GLY A . n A 1 210 SER 210 230 230 SER SER A . n A 1 211 ILE 211 231 231 ILE ILE A . n A 1 212 LEU 212 232 232 LEU LEU A . n A 1 213 VAL 213 233 233 VAL VAL A . n A 1 214 GLN 214 234 234 GLN GLN A . n A 1 215 ARG 215 235 235 ARG ARG A . n A 1 216 ILE 216 236 236 ILE ILE A . n A 1 217 GLU 217 237 237 GLU GLU A . n A 1 218 GLY 218 238 238 GLY GLY A . n A 1 219 SER 219 239 239 SER SER A . n A 1 220 TYR 220 240 240 TYR TYR A . n A 1 221 ASP 221 241 241 ASP ASP A . n A 1 222 ASN 222 242 242 ASN ASN A . n A 1 223 VAL 223 243 243 VAL VAL A . n A 1 224 ILE 224 244 244 ILE ILE A . n A 1 225 GLY 225 245 245 GLY GLY A . n A 1 226 LEU 226 246 246 LEU LEU A . n A 1 227 PRO 227 247 247 PRO PRO A . n A 1 228 LEU 228 248 248 LEU LEU A . n A 1 229 ARG 229 249 249 ARG ARG A . n A 1 230 ALA 230 250 250 ALA ALA A . n A 1 231 THR 231 251 251 THR THR A . n A 1 232 LEU 232 252 252 LEU LEU A . n A 1 233 ARG 233 253 253 ARG ARG A . n A 1 234 LEU 234 254 254 LEU LEU A . n A 1 235 ILE 235 255 255 ILE ILE A . n A 1 236 GLU 236 256 256 GLU GLU A . n A 1 237 LYS 237 257 257 LYS LYS A . n A 1 238 ALA 238 258 258 ALA ALA A . n A 1 239 MET 239 259 259 MET MET A . n A 1 240 ALA 240 260 260 ALA ALA A . n A 1 241 LYS 241 261 261 LYS LYS A . n A 1 242 ALA 242 262 262 ALA ALA A . n A 1 243 GLU 243 263 263 GLU GLU A . n A 1 244 ASP 244 264 264 ASP ASP A . n A 1 245 ASP 245 265 ? ? ? A . n A 1 246 ASP 246 266 ? ? ? A . n A 1 247 LEU 247 267 ? ? ? A . n A 1 248 LEU 248 268 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id AMP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id AMP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 AMP 1 301 1 AMP AMP A . C 3 GOL 1 302 2 GOL GOL A . D 4 HOH 1 401 26 HOH HOH A . D 4 HOH 2 402 8 HOH HOH A . D 4 HOH 3 403 9 HOH HOH A . D 4 HOH 4 404 6 HOH HOH A . D 4 HOH 5 405 23 HOH HOH A . D 4 HOH 6 406 4 HOH HOH A . D 4 HOH 7 407 14 HOH HOH A . D 4 HOH 8 408 3 HOH HOH A . D 4 HOH 9 409 11 HOH HOH A . D 4 HOH 10 410 7 HOH HOH A . D 4 HOH 11 411 17 HOH HOH A . D 4 HOH 12 412 13 HOH HOH A . D 4 HOH 13 413 1 HOH HOH A . D 4 HOH 14 414 25 HOH HOH A . D 4 HOH 15 415 22 HOH HOH A . D 4 HOH 16 416 2 HOH HOH A . D 4 HOH 17 417 12 HOH HOH A . D 4 HOH 18 418 15 HOH HOH A . D 4 HOH 19 419 20 HOH HOH A . D 4 HOH 20 420 5 HOH HOH A . D 4 HOH 21 421 16 HOH HOH A . D 4 HOH 22 422 10 HOH HOH A . D 4 HOH 23 423 19 HOH HOH A . D 4 HOH 24 424 18 HOH HOH A . D 4 HOH 25 425 24 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 88 ? CG ? A GLU 68 CG 2 1 Y 1 A GLU 88 ? CD ? A GLU 68 CD 3 1 Y 1 A GLU 88 ? OE1 ? A GLU 68 OE1 4 1 Y 1 A GLU 88 ? OE2 ? A GLU 68 OE2 5 1 Y 1 A ASP 89 ? CG ? A ASP 69 CG 6 1 Y 1 A ASP 89 ? OD1 ? A ASP 69 OD1 7 1 Y 1 A ASP 89 ? OD2 ? A ASP 69 OD2 8 1 Y 1 A LYS 92 ? CG ? A LYS 72 CG 9 1 Y 1 A LYS 92 ? CD ? A LYS 72 CD 10 1 Y 1 A LYS 92 ? CE ? A LYS 72 CE 11 1 Y 1 A LYS 92 ? NZ ? A LYS 72 NZ 12 1 Y 1 A LYS 145 ? CG ? A LYS 125 CG 13 1 Y 1 A LYS 145 ? CD ? A LYS 125 CD 14 1 Y 1 A LYS 145 ? CE ? A LYS 125 CE 15 1 Y 1 A LYS 145 ? NZ ? A LYS 125 NZ 16 1 Y 1 A ARG 181 ? CG ? A ARG 161 CG 17 1 Y 1 A ARG 181 ? CD ? A ARG 161 CD 18 1 Y 1 A ARG 181 ? NE ? A ARG 161 NE 19 1 Y 1 A ARG 181 ? CZ ? A ARG 161 CZ 20 1 Y 1 A ARG 181 ? NH1 ? A ARG 161 NH1 21 1 Y 1 A ARG 181 ? NH2 ? A ARG 161 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(2.2.1_6174: ???)' ? 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 39PB _cell.details ? _cell.formula_units_Z ? _cell.length_a 76.223 _cell.length_a_esd ? _cell.length_b 76.223 _cell.length_b_esd ? _cell.length_c 174.841 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 39PB _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 39PB _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.63 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 73.46 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Morpheus Fusion G7: 12.5% (v/v) MPD; 12.5% PEG 1000; 12.5% (w/v) PEG 3350; 0.05M Tris (base); 0.05M BICINE pH 8.5; 0.3% w/v NDSB 195, 0.3% w/v NDSB 201, 0.3% w/v NDSB 211, 0.3% w/v NDSB 221, 0.3% w/v NDSB 256; 0.03M Sodium fluoride; 0.03M Sodium bromide; 0.03M Sodium iodide , CoimA.00961.a.A2.PW39528 at 13.2 mg/mL. cocrystallization with 25 mM AMP disodium salt and 20 mM Magnesium chloride hexahydrate. plate 21398 G7 drop 1, Puck: PSL-0109, Cryo: direct. ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 XE 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2026-09-26 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Double Crystal Si 111' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9786 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9786 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 39PB _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.33 _reflns.d_resolution_low 46.30 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22907 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25.6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.00 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.088 _reflns.pdbx_Rpim_I_all 0.018 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 587279 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.086 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.33 _reflns_shell.d_res_low 2.41 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 55108 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2195 _reflns_shell.percent_possible_obs 99.9 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 25.1 _reflns_shell.pdbx_chi_squared 0.96 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 1.8 _reflns_shell.pdbx_Rrim_I_all 2.028 _reflns_shell.pdbx_Rpim_I_all 0.402 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.904 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.987 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 39PB _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.33 _refine.ls_d_res_low 46.30 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22776 _refine.ls_number_reflns_R_free 1085 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.72 _refine.ls_percent_reflns_R_free 4.76 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2113 _refine.ls_R_factor_R_free 0.2586 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2091 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.20 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.34 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.33 _refine_hist.d_res_low 46.30 _refine_hist.number_atoms_solvent 25 _refine_hist.number_atoms_total 1771 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1717 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 ? 1776 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.728 ? 2421 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 17.703 ? 671 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.044 ? 293 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 308 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.33 2.44 . . 142 2631 99.00 . . . . 0.3540 . . . . . . . . . . . . . . . 0.4347 'X-RAY DIFFRACTION' 2.44 2.56 . . 120 2664 100.00 . . . . 0.2837 . . . . . . . . . . . . . . . 0.2623 'X-RAY DIFFRACTION' 2.56 2.73 . . 139 2646 100.00 . . . . 0.2468 . . . . . . . . . . . . . . . 0.2870 'X-RAY DIFFRACTION' 2.73 2.94 . . 149 2659 99.00 . . . . 0.2748 . . . . . . . . . . . . . . . 0.3199 'X-RAY DIFFRACTION' 2.94 3.23 . . 139 2665 100.00 . . . . 0.2636 . . . . . . . . . . . . . . . 0.3226 'X-RAY DIFFRACTION' 3.23 3.70 . . 131 2729 100.00 . . . . 0.2262 . . . . . . . . . . . . . . . 0.2687 'X-RAY DIFFRACTION' 3.70 4.66 . . 113 2779 100.00 . . . . 0.1773 . . . . . . . . . . . . . . . 0.2337 'X-RAY DIFFRACTION' 4.66 46.30 . . 152 2918 100.00 . . . . 0.1784 . . . . . . . . . . . . . . . 0.2213 # _struct.entry_id 39PB _struct.title 'Crystal structure of a septum formation protein Maf from Coccidioides immitis (AMP complex)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 39PB _struct_keywords.text ;SSGCID, STRUCTURAL GENOMICS, SEATTLE STRUCTURAL GENOMICS CENTER FOR INFECTIOUS DISEASE, septum formation protein Maf, Coccidioides immitis, CELL CYCLE ; _struct_keywords.pdbx_keywords 'CELL CYCLE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code J3KAP5_COCIM _struct_ref.pdbx_db_accession J3KAP5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PPPLSLPVLNQLRSKRVILASASPRRKQIISFLGLRNVEIIPSNTPEDFPKTLTPFEYVLQTATHKAITVYQQEVNNLEK GEPALILAADTIVVDISTGDILEKPRSEAHHISMLKLLRDVMDHKVYTAVAAIVPLESARDPGYALETVVEETKVRFDPD VTDELILAYVRTREGVDKAGGYGMQGLGSILVQRIEGSYDNVIGLPLRATLRLIEKAMAKAEDDDLL ; _struct_ref.pdbx_align_begin 42 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 39PB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 248 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession J3KAP5 _struct_ref_seq.db_align_beg 42 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 268 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 42 _struct_ref_seq.pdbx_auth_seq_align_end 268 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 39PB MET A 1 ? UNP J3KAP5 ? ? 'expression tag' 21 1 1 39PB ALA A 2 ? UNP J3KAP5 ? ? 'expression tag' 22 2 1 39PB HIS A 3 ? UNP J3KAP5 ? ? 'expression tag' 23 3 1 39PB HIS A 4 ? UNP J3KAP5 ? ? 'expression tag' 24 4 1 39PB HIS A 5 ? UNP J3KAP5 ? ? 'expression tag' 25 5 1 39PB HIS A 6 ? UNP J3KAP5 ? ? 'expression tag' 26 6 1 39PB HIS A 7 ? UNP J3KAP5 ? ? 'expression tag' 27 7 1 39PB HIS A 8 ? UNP J3KAP5 ? ? 'expression tag' 28 8 1 39PB MET A 9 ? UNP J3KAP5 ? ? 'expression tag' 29 9 1 39PB GLY A 10 ? UNP J3KAP5 ? ? 'expression tag' 30 10 1 39PB THR A 11 ? UNP J3KAP5 ? ? 'expression tag' 31 11 1 39PB LEU A 12 ? UNP J3KAP5 ? ? 'expression tag' 32 12 1 39PB GLU A 13 ? UNP J3KAP5 ? ? 'expression tag' 33 13 1 39PB ALA A 14 ? UNP J3KAP5 ? ? 'expression tag' 34 14 1 39PB GLN A 15 ? UNP J3KAP5 ? ? 'expression tag' 35 15 1 39PB THR A 16 ? UNP J3KAP5 ? ? 'expression tag' 36 16 1 39PB GLN A 17 ? UNP J3KAP5 ? ? 'expression tag' 37 17 1 39PB GLY A 18 ? UNP J3KAP5 ? ? 'expression tag' 38 18 1 39PB PRO A 19 ? UNP J3KAP5 ? ? 'expression tag' 39 19 1 39PB GLY A 20 ? UNP J3KAP5 ? ? 'expression tag' 40 20 1 39PB SER A 21 ? UNP J3KAP5 ? ? 'expression tag' 41 21 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4100 ? 1 MORE -25 ? 1 'SSA (A^2)' 19560 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 27 ? ARG A 34 ? LEU A 47 ARG A 54 1 ? 8 HELX_P HELX_P2 AA2 SER A 44 ? PHE A 53 ? SER A 64 PHE A 73 1 ? 10 HELX_P HELX_P3 AA3 THR A 75 ? VAL A 96 ? THR A 95 VAL A 116 1 ? 22 HELX_P HELX_P4 AA4 SER A 128 ? MET A 143 ? SER A 148 MET A 163 1 ? 16 HELX_P HELX_P5 AA5 THR A 183 ? ARG A 194 ? THR A 203 ARG A 214 1 ? 12 HELX_P HELX_P6 AA6 GLU A 195 ? TYR A 203 ? GLU A 215 TYR A 223 5 ? 9 HELX_P HELX_P7 AA7 GLY A 207 ? ILE A 211 ? GLY A 227 ILE A 231 5 ? 5 HELX_P HELX_P8 AA8 SER A 219 ? GLY A 225 ? SER A 239 GLY A 245 1 ? 7 HELX_P HELX_P9 AA9 PRO A 227 ? ASP A 244 ? PRO A 247 ASP A 264 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 162 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 182 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 163 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 183 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.83 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 59 ? ILE A 61 ? VAL A 79 ILE A 81 AA1 2 VAL A 38 ? LEU A 40 ? VAL A 58 LEU A 60 AA1 3 LEU A 106 ? VAL A 115 ? LEU A 126 VAL A 135 AA1 4 ILE A 122 ? LEU A 123 ? ILE A 142 LEU A 143 AA2 1 VAL A 59 ? ILE A 61 ? VAL A 79 ILE A 81 AA2 2 VAL A 38 ? LEU A 40 ? VAL A 58 LEU A 60 AA2 3 LEU A 106 ? VAL A 115 ? LEU A 126 VAL A 135 AA2 4 ASP A 144 ? PRO A 156 ? ASP A 164 PRO A 176 AA2 5 TYR A 165 ? PHE A 178 ? TYR A 185 PHE A 198 AA2 6 VAL A 213 ? GLU A 217 ? VAL A 233 GLU A 237 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 60 ? O GLU A 80 N LEU A 40 ? N LEU A 60 AA1 2 3 N ILE A 39 ? N ILE A 59 O LEU A 108 ? O LEU A 128 AA1 3 4 N VAL A 114 ? N VAL A 134 O LEU A 123 ? O LEU A 143 AA2 1 2 O GLU A 60 ? O GLU A 80 N LEU A 40 ? N LEU A 60 AA2 2 3 N ILE A 39 ? N ILE A 59 O LEU A 108 ? O LEU A 128 AA2 3 4 N VAL A 115 ? N VAL A 135 O LYS A 146 ? O LYS A 166 AA2 4 5 N VAL A 155 ? N VAL A 175 O ALA A 166 ? O ALA A 186 AA2 5 6 N ARG A 177 ? N ARG A 197 O ARG A 215 ? O ARG A 235 # _pdbx_entry_details.entry_id 39PB _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 163 ? ? 72.57 -74.73 2 1 ALA A 180 ? ? -69.41 4.88 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.initial_of_center SSGCID # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -0.6574 -18.7157 12.6640 0.5308 ? -0.0646 ? -0.0440 ? 0.6210 ? -0.0136 ? 0.6293 ? 8.7974 ? -0.8329 ? 2.3054 ? 3.9177 ? 0.3223 ? 3.2137 ? -0.2103 ? -0.6143 ? 0.6415 ? 0.1994 ? 0.1771 ? 0.0303 ? -0.3379 ? 0.2747 ? 0.1705 ? 2 'X-RAY DIFFRACTION' ? refined 3.4125 -31.7100 1.0091 0.8707 ? 0.0311 ? -0.0281 ? 0.8173 ? -0.0854 ? 0.7392 ? 3.6901 ? -0.1231 ? 1.4636 ? 2.6732 ? -1.2232 ? 1.2637 ? -0.0063 ? 1.0094 ? -0.5415 ? -0.8727 ? 0.4485 ? 0.0755 ? 0.1239 ? 1.1040 ? 0.0129 ? 3 'X-RAY DIFFRACTION' ? refined -5.6959 -27.6519 -6.3148 0.5932 ? -0.0251 ? -0.0548 ? 0.4938 ? -0.0648 ? 0.5500 ? 1.2291 ? -0.2820 ? 1.9989 ? 0.1843 ? -0.2470 ? 3.5470 ? 0.1747 ? 0.0704 ? -0.0385 ? -0.1287 ? -0.1109 ? -0.1403 ? 0.3132 ? 0.4598 ? -0.1060 ? 4 'X-RAY DIFFRACTION' ? refined -10.8992 -26.1841 -4.5782 0.7262 ? -0.1173 ? -0.1085 ? 0.4272 ? -0.0481 ? 0.6204 ? 1.9982 ? -0.5239 ? -0.6811 ? 0.6992 ? 0.7165 ? 0.8571 ? 0.1708 ? -0.2027 ? -0.3746 ? -0.0296 ? 0.2416 ? 0.1926 ? 0.0514 ? -0.4629 ? 0.0000 ? 5 'X-RAY DIFFRACTION' ? refined -9.3831 -16.6134 -12.3101 0.8513 ? -0.1365 ? -0.0086 ? 0.7963 ? -0.1108 ? 0.7617 ? 0.0597 ? -0.0609 ? 0.0268 ? 0.0616 ? -0.0283 ? 0.0230 ? 0.2513 ? -0.0368 ? 0.4811 ? 0.4496 ? 0.0194 ? -0.4609 ? -1.1569 ? 0.1643 ? -0.0002 ? 6 'X-RAY DIFFRACTION' ? refined -16.5263 -19.9294 -3.6694 0.7066 ? -0.0973 ? -0.0487 ? 0.5926 ? -0.0318 ? 0.6070 ? 0.1630 ? -0.1561 ? -0.2022 ? 0.4212 ? 0.0758 ? 0.2958 ? -0.2288 ? -0.5388 ? 0.0260 ? 0.1218 ? 0.2203 ? -0.2396 ? -0.2035 ? -0.3586 ? -0.0007 ? 7 'X-RAY DIFFRACTION' ? refined -5.1005 -30.4580 15.8748 0.6466 ? -0.0969 ? -0.0178 ? 0.6691 ? 0.0180 ? 0.5784 ? 1.4421 ? 0.2453 ? 1.7727 ? 4.8794 ? -1.9836 ? 3.2552 ? -0.2683 ? -0.6115 ? 0.1710 ? 0.1926 ? 0.1502 ? 0.6889 ? -0.2807 ? -0.3176 ? -0.1332 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 41 through 74 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 75 through 115 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 116 through 176 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 177 through 213 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 214 through 227 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 228 through 247 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 248 through 264 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 21 ? A MET 1 2 1 Y 1 A ALA 22 ? A ALA 2 3 1 Y 1 A HIS 23 ? A HIS 3 4 1 Y 1 A HIS 24 ? A HIS 4 5 1 Y 1 A HIS 25 ? A HIS 5 6 1 Y 1 A HIS 26 ? A HIS 6 7 1 Y 1 A HIS 27 ? A HIS 7 8 1 Y 1 A HIS 28 ? A HIS 8 9 1 Y 1 A MET 29 ? A MET 9 10 1 Y 1 A GLY 30 ? A GLY 10 11 1 Y 1 A THR 31 ? A THR 11 12 1 Y 1 A LEU 32 ? A LEU 12 13 1 Y 1 A GLU 33 ? A GLU 13 14 1 Y 1 A ALA 34 ? A ALA 14 15 1 Y 1 A GLN 35 ? A GLN 15 16 1 Y 1 A THR 36 ? A THR 16 17 1 Y 1 A GLN 37 ? A GLN 17 18 1 Y 1 A GLY 38 ? A GLY 18 19 1 Y 1 A PRO 39 ? A PRO 19 20 1 Y 1 A GLY 40 ? A GLY 20 21 1 Y 1 A ASP 265 ? A ASP 245 22 1 Y 1 A ASP 266 ? A ASP 246 23 1 Y 1 A LEU 267 ? A LEU 247 24 1 Y 1 A LEU 268 ? A LEU 248 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 AMP P P N N 14 AMP O1P O N N 15 AMP O2P O N N 16 AMP O3P O N N 17 AMP "O5'" O N N 18 AMP "C5'" C N N 19 AMP "C4'" C N R 20 AMP "O4'" O N N 21 AMP "C3'" C N S 22 AMP "O3'" O N N 23 AMP "C2'" C N R 24 AMP "O2'" O N N 25 AMP "C1'" C N R 26 AMP N9 N Y N 27 AMP C8 C Y N 28 AMP N7 N Y N 29 AMP C5 C Y N 30 AMP C6 C Y N 31 AMP N6 N N N 32 AMP N1 N Y N 33 AMP C2 C Y N 34 AMP N3 N Y N 35 AMP C4 C Y N 36 AMP HOP2 H N N 37 AMP HOP3 H N N 38 AMP "H5'1" H N N 39 AMP "H5'2" H N N 40 AMP "H4'" H N N 41 AMP "H3'" H N N 42 AMP "HO3'" H N N 43 AMP "H2'" H N N 44 AMP "HO2'" H N N 45 AMP "H1'" H N N 46 AMP H8 H N N 47 AMP HN61 H N N 48 AMP HN62 H N N 49 AMP H2 H N N 50 ARG N N N N 51 ARG CA C N S 52 ARG C C N N 53 ARG O O N N 54 ARG CB C N N 55 ARG CG C N N 56 ARG CD C N N 57 ARG NE N N N 58 ARG CZ C N N 59 ARG NH1 N N N 60 ARG NH2 N N N 61 ARG OXT O N N 62 ARG H H N N 63 ARG H2 H N N 64 ARG HA H N N 65 ARG HB2 H N N 66 ARG HB3 H N N 67 ARG HG2 H N N 68 ARG HG3 H N N 69 ARG HD2 H N N 70 ARG HD3 H N N 71 ARG HE H N N 72 ARG HH11 H N N 73 ARG HH12 H N N 74 ARG HH21 H N N 75 ARG HH22 H N N 76 ARG HXT H N N 77 ASN N N N N 78 ASN CA C N S 79 ASN C C N N 80 ASN O O N N 81 ASN CB C N N 82 ASN CG C N N 83 ASN OD1 O N N 84 ASN ND2 N N N 85 ASN OXT O N N 86 ASN H H N N 87 ASN H2 H N N 88 ASN HA H N N 89 ASN HB2 H N N 90 ASN HB3 H N N 91 ASN HD21 H N N 92 ASN HD22 H N N 93 ASN HXT H N N 94 ASP N N N N 95 ASP CA C N S 96 ASP C C N N 97 ASP O O N N 98 ASP CB C N N 99 ASP CG C N N 100 ASP OD1 O N N 101 ASP OD2 O N N 102 ASP OXT O N N 103 ASP H H N N 104 ASP H2 H N N 105 ASP HA H N N 106 ASP HB2 H N N 107 ASP HB3 H N N 108 ASP HD2 H N N 109 ASP HXT H N N 110 GLN N N N N 111 GLN CA C N S 112 GLN C C N N 113 GLN O O N N 114 GLN CB C N N 115 GLN CG C N N 116 GLN CD C N N 117 GLN OE1 O N N 118 GLN NE2 N N N 119 GLN OXT O N N 120 GLN H H N N 121 GLN H2 H N N 122 GLN HA H N N 123 GLN HB2 H N N 124 GLN HB3 H N N 125 GLN HG2 H N N 126 GLN HG3 H N N 127 GLN HE21 H N N 128 GLN HE22 H N N 129 GLN HXT H N N 130 GLU N N N N 131 GLU CA C N S 132 GLU C C N N 133 GLU O O N N 134 GLU CB C N N 135 GLU CG C N N 136 GLU CD C N N 137 GLU OE1 O N N 138 GLU OE2 O N N 139 GLU OXT O N N 140 GLU H H N N 141 GLU H2 H N N 142 GLU HA H N N 143 GLU HB2 H N N 144 GLU HB3 H N N 145 GLU HG2 H N N 146 GLU HG3 H N N 147 GLU HE2 H N N 148 GLU HXT H N N 149 GLY N N N N 150 GLY CA C N N 151 GLY C C N N 152 GLY O O N N 153 GLY OXT O N N 154 GLY H H N N 155 GLY H2 H N N 156 GLY HA2 H N N 157 GLY HA3 H N N 158 GLY HXT H N N 159 GOL C1 C N N 160 GOL O1 O N N 161 GOL C2 C N N 162 GOL O2 O N N 163 GOL C3 C N N 164 GOL O3 O N N 165 GOL H11 H N N 166 GOL H12 H N N 167 GOL HO1 H N N 168 GOL H2 H N N 169 GOL HO2 H N N 170 GOL H31 H N N 171 GOL H32 H N N 172 GOL HO3 H N N 173 HIS N N N N 174 HIS CA C N S 175 HIS C C N N 176 HIS O O N N 177 HIS CB C N N 178 HIS CG C Y N 179 HIS ND1 N Y N 180 HIS CD2 C Y N 181 HIS CE1 C Y N 182 HIS NE2 N Y N 183 HIS OXT O N N 184 HIS H H N N 185 HIS H2 H N N 186 HIS HA H N N 187 HIS HB2 H N N 188 HIS HB3 H N N 189 HIS HD1 H N N 190 HIS HD2 H N N 191 HIS HE1 H N N 192 HIS HE2 H N N 193 HIS HXT H N N 194 HOH O O N N 195 HOH H1 H N N 196 HOH H2 H N N 197 ILE N N N N 198 ILE CA C N S 199 ILE C C N N 200 ILE O O N N 201 ILE CB C N S 202 ILE CG1 C N N 203 ILE CG2 C N N 204 ILE CD1 C N N 205 ILE OXT O N N 206 ILE H H N N 207 ILE H2 H N N 208 ILE HA H N N 209 ILE HB H N N 210 ILE HG12 H N N 211 ILE HG13 H N N 212 ILE HG21 H N N 213 ILE HG22 H N N 214 ILE HG23 H N N 215 ILE HD11 H N N 216 ILE HD12 H N N 217 ILE HD13 H N N 218 ILE HXT H N N 219 LEU N N N N 220 LEU CA C N S 221 LEU C C N N 222 LEU O O N N 223 LEU CB C N N 224 LEU CG C N N 225 LEU CD1 C N N 226 LEU CD2 C N N 227 LEU OXT O N N 228 LEU H H N N 229 LEU H2 H N N 230 LEU HA H N N 231 LEU HB2 H N N 232 LEU HB3 H N N 233 LEU HG H N N 234 LEU HD11 H N N 235 LEU HD12 H N N 236 LEU HD13 H N N 237 LEU HD21 H N N 238 LEU HD22 H N N 239 LEU HD23 H N N 240 LEU HXT H N N 241 LYS N N N N 242 LYS CA C N S 243 LYS C C N N 244 LYS O O N N 245 LYS CB C N N 246 LYS CG C N N 247 LYS CD C N N 248 LYS CE C N N 249 LYS NZ N N N 250 LYS OXT O N N 251 LYS H H N N 252 LYS H2 H N N 253 LYS HA H N N 254 LYS HB2 H N N 255 LYS HB3 H N N 256 LYS HG2 H N N 257 LYS HG3 H N N 258 LYS HD2 H N N 259 LYS HD3 H N N 260 LYS HE2 H N N 261 LYS HE3 H N N 262 LYS HZ1 H N N 263 LYS HZ2 H N N 264 LYS HZ3 H N N 265 LYS HXT H N N 266 MET N N N N 267 MET CA C N S 268 MET C C N N 269 MET O O N N 270 MET CB C N N 271 MET CG C N N 272 MET SD S N N 273 MET CE C N N 274 MET OXT O N N 275 MET H H N N 276 MET H2 H N N 277 MET HA H N N 278 MET HB2 H N N 279 MET HB3 H N N 280 MET HG2 H N N 281 MET HG3 H N N 282 MET HE1 H N N 283 MET HE2 H N N 284 MET HE3 H N N 285 MET HXT H N N 286 PHE N N N N 287 PHE CA C N S 288 PHE C C N N 289 PHE O O N N 290 PHE CB C N N 291 PHE CG C Y N 292 PHE CD1 C Y N 293 PHE CD2 C Y N 294 PHE CE1 C Y N 295 PHE CE2 C Y N 296 PHE CZ C Y N 297 PHE OXT O N N 298 PHE H H N N 299 PHE H2 H N N 300 PHE HA H N N 301 PHE HB2 H N N 302 PHE HB3 H N N 303 PHE HD1 H N N 304 PHE HD2 H N N 305 PHE HE1 H N N 306 PHE HE2 H N N 307 PHE HZ H N N 308 PHE HXT H N N 309 PRO N N N N 310 PRO CA C N S 311 PRO C C N N 312 PRO O O N N 313 PRO CB C N N 314 PRO CG C N N 315 PRO CD C N N 316 PRO OXT O N N 317 PRO H H N N 318 PRO HA H N N 319 PRO HB2 H N N 320 PRO HB3 H N N 321 PRO HG2 H N N 322 PRO HG3 H N N 323 PRO HD2 H N N 324 PRO HD3 H N N 325 PRO HXT H N N 326 SER N N N N 327 SER CA C N S 328 SER C C N N 329 SER O O N N 330 SER CB C N N 331 SER OG O N N 332 SER OXT O N N 333 SER H H N N 334 SER H2 H N N 335 SER HA H N N 336 SER HB2 H N N 337 SER HB3 H N N 338 SER HG H N N 339 SER HXT H N N 340 THR N N N N 341 THR CA C N S 342 THR C C N N 343 THR O O N N 344 THR CB C N R 345 THR OG1 O N N 346 THR CG2 C N N 347 THR OXT O N N 348 THR H H N N 349 THR H2 H N N 350 THR HA H N N 351 THR HB H N N 352 THR HG1 H N N 353 THR HG21 H N N 354 THR HG22 H N N 355 THR HG23 H N N 356 THR HXT H N N 357 TYR N N N N 358 TYR CA C N S 359 TYR C C N N 360 TYR O O N N 361 TYR CB C N N 362 TYR CG C Y N 363 TYR CD1 C Y N 364 TYR CD2 C Y N 365 TYR CE1 C Y N 366 TYR CE2 C Y N 367 TYR CZ C Y N 368 TYR OH O N N 369 TYR OXT O N N 370 TYR H H N N 371 TYR H2 H N N 372 TYR HA H N N 373 TYR HB2 H N N 374 TYR HB3 H N N 375 TYR HD1 H N N 376 TYR HD2 H N N 377 TYR HE1 H N N 378 TYR HE2 H N N 379 TYR HH H N N 380 TYR HXT H N N 381 VAL N N N N 382 VAL CA C N S 383 VAL C C N N 384 VAL O O N N 385 VAL CB C N N 386 VAL CG1 C N N 387 VAL CG2 C N N 388 VAL OXT O N N 389 VAL H H N N 390 VAL H2 H N N 391 VAL HA H N N 392 VAL HB H N N 393 VAL HG11 H N N 394 VAL HG12 H N N 395 VAL HG13 H N N 396 VAL HG21 H N N 397 VAL HG22 H N N 398 VAL HG23 H N N 399 VAL HXT H N N 400 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 AMP P O1P doub N N 13 AMP P O2P sing N N 14 AMP P O3P sing N N 15 AMP P "O5'" sing N N 16 AMP O2P HOP2 sing N N 17 AMP O3P HOP3 sing N N 18 AMP "O5'" "C5'" sing N N 19 AMP "C5'" "C4'" sing N N 20 AMP "C5'" "H5'1" sing N N 21 AMP "C5'" "H5'2" sing N N 22 AMP "C4'" "O4'" sing N N 23 AMP "C4'" "C3'" sing N N 24 AMP "C4'" "H4'" sing N N 25 AMP "O4'" "C1'" sing N N 26 AMP "C3'" "O3'" sing N N 27 AMP "C3'" "C2'" sing N N 28 AMP "C3'" "H3'" sing N N 29 AMP "O3'" "HO3'" sing N N 30 AMP "C2'" "O2'" sing N N 31 AMP "C2'" "C1'" sing N N 32 AMP "C2'" "H2'" sing N N 33 AMP "O2'" "HO2'" sing N N 34 AMP "C1'" N9 sing N N 35 AMP "C1'" "H1'" sing N N 36 AMP N9 C8 sing Y N 37 AMP N9 C4 sing Y N 38 AMP C8 N7 doub Y N 39 AMP C8 H8 sing N N 40 AMP N7 C5 sing Y N 41 AMP C5 C6 sing Y N 42 AMP C5 C4 doub Y N 43 AMP C6 N6 sing N N 44 AMP C6 N1 doub Y N 45 AMP N6 HN61 sing N N 46 AMP N6 HN62 sing N N 47 AMP N1 C2 sing Y N 48 AMP C2 N3 doub Y N 49 AMP C2 H2 sing N N 50 AMP N3 C4 sing Y N 51 ARG N CA sing N N 52 ARG N H sing N N 53 ARG N H2 sing N N 54 ARG CA C sing N N 55 ARG CA CB sing N N 56 ARG CA HA sing N N 57 ARG C O doub N N 58 ARG C OXT sing N N 59 ARG CB CG sing N N 60 ARG CB HB2 sing N N 61 ARG CB HB3 sing N N 62 ARG CG CD sing N N 63 ARG CG HG2 sing N N 64 ARG CG HG3 sing N N 65 ARG CD NE sing N N 66 ARG CD HD2 sing N N 67 ARG CD HD3 sing N N 68 ARG NE CZ sing N N 69 ARG NE HE sing N N 70 ARG CZ NH1 sing N N 71 ARG CZ NH2 doub N N 72 ARG NH1 HH11 sing N N 73 ARG NH1 HH12 sing N N 74 ARG NH2 HH21 sing N N 75 ARG NH2 HH22 sing N N 76 ARG OXT HXT sing N N 77 ASN N CA sing N N 78 ASN N H sing N N 79 ASN N H2 sing N N 80 ASN CA C sing N N 81 ASN CA CB sing N N 82 ASN CA HA sing N N 83 ASN C O doub N N 84 ASN C OXT sing N N 85 ASN CB CG sing N N 86 ASN CB HB2 sing N N 87 ASN CB HB3 sing N N 88 ASN CG OD1 doub N N 89 ASN CG ND2 sing N N 90 ASN ND2 HD21 sing N N 91 ASN ND2 HD22 sing N N 92 ASN OXT HXT sing N N 93 ASP N CA sing N N 94 ASP N H sing N N 95 ASP N H2 sing N N 96 ASP CA C sing N N 97 ASP CA CB sing N N 98 ASP CA HA sing N N 99 ASP C O doub N N 100 ASP C OXT sing N N 101 ASP CB CG sing N N 102 ASP CB HB2 sing N N 103 ASP CB HB3 sing N N 104 ASP CG OD1 doub N N 105 ASP CG OD2 sing N N 106 ASP OD2 HD2 sing N N 107 ASP OXT HXT sing N N 108 GLN N CA sing N N 109 GLN N H sing N N 110 GLN N H2 sing N N 111 GLN CA C sing N N 112 GLN CA CB sing N N 113 GLN CA HA sing N N 114 GLN C O doub N N 115 GLN C OXT sing N N 116 GLN CB CG sing N N 117 GLN CB HB2 sing N N 118 GLN CB HB3 sing N N 119 GLN CG CD sing N N 120 GLN CG HG2 sing N N 121 GLN CG HG3 sing N N 122 GLN CD OE1 doub N N 123 GLN CD NE2 sing N N 124 GLN NE2 HE21 sing N N 125 GLN NE2 HE22 sing N N 126 GLN OXT HXT sing N N 127 GLU N CA sing N N 128 GLU N H sing N N 129 GLU N H2 sing N N 130 GLU CA C sing N N 131 GLU CA CB sing N N 132 GLU CA HA sing N N 133 GLU C O doub N N 134 GLU C OXT sing N N 135 GLU CB CG sing N N 136 GLU CB HB2 sing N N 137 GLU CB HB3 sing N N 138 GLU CG CD sing N N 139 GLU CG HG2 sing N N 140 GLU CG HG3 sing N N 141 GLU CD OE1 doub N N 142 GLU CD OE2 sing N N 143 GLU OE2 HE2 sing N N 144 GLU OXT HXT sing N N 145 GLY N CA sing N N 146 GLY N H sing N N 147 GLY N H2 sing N N 148 GLY CA C sing N N 149 GLY CA HA2 sing N N 150 GLY CA HA3 sing N N 151 GLY C O doub N N 152 GLY C OXT sing N N 153 GLY OXT HXT sing N N 154 GOL C1 O1 sing N N 155 GOL C1 C2 sing N N 156 GOL C1 H11 sing N N 157 GOL C1 H12 sing N N 158 GOL O1 HO1 sing N N 159 GOL C2 O2 sing N N 160 GOL C2 C3 sing N N 161 GOL C2 H2 sing N N 162 GOL O2 HO2 sing N N 163 GOL C3 O3 sing N N 164 GOL C3 H31 sing N N 165 GOL C3 H32 sing N N 166 GOL O3 HO3 sing N N 167 HIS N CA sing N N 168 HIS N H sing N N 169 HIS N H2 sing N N 170 HIS CA C sing N N 171 HIS CA CB sing N N 172 HIS CA HA sing N N 173 HIS C O doub N N 174 HIS C OXT sing N N 175 HIS CB CG sing N N 176 HIS CB HB2 sing N N 177 HIS CB HB3 sing N N 178 HIS CG ND1 sing Y N 179 HIS CG CD2 doub Y N 180 HIS ND1 CE1 doub Y N 181 HIS ND1 HD1 sing N N 182 HIS CD2 NE2 sing Y N 183 HIS CD2 HD2 sing N N 184 HIS CE1 NE2 sing Y N 185 HIS CE1 HE1 sing N N 186 HIS NE2 HE2 sing N N 187 HIS OXT HXT sing N N 188 HOH O H1 sing N N 189 HOH O H2 sing N N 190 ILE N CA sing N N 191 ILE N H sing N N 192 ILE N H2 sing N N 193 ILE CA C sing N N 194 ILE CA CB sing N N 195 ILE CA HA sing N N 196 ILE C O doub N N 197 ILE C OXT sing N N 198 ILE CB CG1 sing N N 199 ILE CB CG2 sing N N 200 ILE CB HB sing N N 201 ILE CG1 CD1 sing N N 202 ILE CG1 HG12 sing N N 203 ILE CG1 HG13 sing N N 204 ILE CG2 HG21 sing N N 205 ILE CG2 HG22 sing N N 206 ILE CG2 HG23 sing N N 207 ILE CD1 HD11 sing N N 208 ILE CD1 HD12 sing N N 209 ILE CD1 HD13 sing N N 210 ILE OXT HXT sing N N 211 LEU N CA sing N N 212 LEU N H sing N N 213 LEU N H2 sing N N 214 LEU CA C sing N N 215 LEU CA CB sing N N 216 LEU CA HA sing N N 217 LEU C O doub N N 218 LEU C OXT sing N N 219 LEU CB CG sing N N 220 LEU CB HB2 sing N N 221 LEU CB HB3 sing N N 222 LEU CG CD1 sing N N 223 LEU CG CD2 sing N N 224 LEU CG HG sing N N 225 LEU CD1 HD11 sing N N 226 LEU CD1 HD12 sing N N 227 LEU CD1 HD13 sing N N 228 LEU CD2 HD21 sing N N 229 LEU CD2 HD22 sing N N 230 LEU CD2 HD23 sing N N 231 LEU OXT HXT sing N N 232 LYS N CA sing N N 233 LYS N H sing N N 234 LYS N H2 sing N N 235 LYS CA C sing N N 236 LYS CA CB sing N N 237 LYS CA HA sing N N 238 LYS C O doub N N 239 LYS C OXT sing N N 240 LYS CB CG sing N N 241 LYS CB HB2 sing N N 242 LYS CB HB3 sing N N 243 LYS CG CD sing N N 244 LYS CG HG2 sing N N 245 LYS CG HG3 sing N N 246 LYS CD CE sing N N 247 LYS CD HD2 sing N N 248 LYS CD HD3 sing N N 249 LYS CE NZ sing N N 250 LYS CE HE2 sing N N 251 LYS CE HE3 sing N N 252 LYS NZ HZ1 sing N N 253 LYS NZ HZ2 sing N N 254 LYS NZ HZ3 sing N N 255 LYS OXT HXT sing N N 256 MET N CA sing N N 257 MET N H sing N N 258 MET N H2 sing N N 259 MET CA C sing N N 260 MET CA CB sing N N 261 MET CA HA sing N N 262 MET C O doub N N 263 MET C OXT sing N N 264 MET CB CG sing N N 265 MET CB HB2 sing N N 266 MET CB HB3 sing N N 267 MET CG SD sing N N 268 MET CG HG2 sing N N 269 MET CG HG3 sing N N 270 MET SD CE sing N N 271 MET CE HE1 sing N N 272 MET CE HE2 sing N N 273 MET CE HE3 sing N N 274 MET OXT HXT sing N N 275 PHE N CA sing N N 276 PHE N H sing N N 277 PHE N H2 sing N N 278 PHE CA C sing N N 279 PHE CA CB sing N N 280 PHE CA HA sing N N 281 PHE C O doub N N 282 PHE C OXT sing N N 283 PHE CB CG sing N N 284 PHE CB HB2 sing N N 285 PHE CB HB3 sing N N 286 PHE CG CD1 doub Y N 287 PHE CG CD2 sing Y N 288 PHE CD1 CE1 sing Y N 289 PHE CD1 HD1 sing N N 290 PHE CD2 CE2 doub Y N 291 PHE CD2 HD2 sing N N 292 PHE CE1 CZ doub Y N 293 PHE CE1 HE1 sing N N 294 PHE CE2 CZ sing Y N 295 PHE CE2 HE2 sing N N 296 PHE CZ HZ sing N N 297 PHE OXT HXT sing N N 298 PRO N CA sing N N 299 PRO N CD sing N N 300 PRO N H sing N N 301 PRO CA C sing N N 302 PRO CA CB sing N N 303 PRO CA HA sing N N 304 PRO C O doub N N 305 PRO C OXT sing N N 306 PRO CB CG sing N N 307 PRO CB HB2 sing N N 308 PRO CB HB3 sing N N 309 PRO CG CD sing N N 310 PRO CG HG2 sing N N 311 PRO CG HG3 sing N N 312 PRO CD HD2 sing N N 313 PRO CD HD3 sing N N 314 PRO OXT HXT sing N N 315 SER N CA sing N N 316 SER N H sing N N 317 SER N H2 sing N N 318 SER CA C sing N N 319 SER CA CB sing N N 320 SER CA HA sing N N 321 SER C O doub N N 322 SER C OXT sing N N 323 SER CB OG sing N N 324 SER CB HB2 sing N N 325 SER CB HB3 sing N N 326 SER OG HG sing N N 327 SER OXT HXT sing N N 328 THR N CA sing N N 329 THR N H sing N N 330 THR N H2 sing N N 331 THR CA C sing N N 332 THR CA CB sing N N 333 THR CA HA sing N N 334 THR C O doub N N 335 THR C OXT sing N N 336 THR CB OG1 sing N N 337 THR CB CG2 sing N N 338 THR CB HB sing N N 339 THR OG1 HG1 sing N N 340 THR CG2 HG21 sing N N 341 THR CG2 HG22 sing N N 342 THR CG2 HG23 sing N N 343 THR OXT HXT sing N N 344 TYR N CA sing N N 345 TYR N H sing N N 346 TYR N H2 sing N N 347 TYR CA C sing N N 348 TYR CA CB sing N N 349 TYR CA HA sing N N 350 TYR C O doub N N 351 TYR C OXT sing N N 352 TYR CB CG sing N N 353 TYR CB HB2 sing N N 354 TYR CB HB3 sing N N 355 TYR CG CD1 doub Y N 356 TYR CG CD2 sing Y N 357 TYR CD1 CE1 sing Y N 358 TYR CD1 HD1 sing N N 359 TYR CD2 CE2 doub Y N 360 TYR CD2 HD2 sing N N 361 TYR CE1 CZ doub Y N 362 TYR CE1 HE1 sing N N 363 TYR CE2 CZ sing Y N 364 TYR CE2 HE2 sing N N 365 TYR CZ OH sing N N 366 TYR OH HH sing N N 367 TYR OXT HXT sing N N 368 VAL N CA sing N N 369 VAL N H sing N N 370 VAL N H2 sing N N 371 VAL CA C sing N N 372 VAL CA CB sing N N 373 VAL CA HA sing N N 374 VAL C O doub N N 375 VAL C OXT sing N N 376 VAL CB CG1 sing N N 377 VAL CB CG2 sing N N 378 VAL CB HB sing N N 379 VAL CG1 HG11 sing N N 380 VAL CG1 HG12 sing N N 381 VAL CG1 HG13 sing N N 382 VAL CG2 HG21 sing N N 383 VAL CG2 HG22 sing N N 384 VAL CG2 HG23 sing N N 385 VAL OXT HXT sing N N 386 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 75N93022C00036 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code AF-J3KAP5-F1 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 39PB _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.013119 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013119 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005719 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_ # loop_ #