data_39PE # _entry.id 39PE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.417 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 39PE pdb_000039pe 10.2210/pdb39pe/pdb WWPDB D_1000312875 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-10-28 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 39PE _pdbx_database_status.recvd_initial_deposition_date 2026-10-20 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 swlovell@ku.edu Scott Lovell ? 'principal investigator/group leader' 0000-0002-3215-4472 3 isabelle.phan@seattlechildrens.org Isabelle Phan ? 'principal investigator/group leader' 0000-0001-6873-3401 4 Bart.Staker@seattlechildrens.org Bart Staker ? 'principal investigator/group leader' 0000-0001-9570-5086 5 peter.myler@seattlechildrens.org Peter Myler ? 'principal investigator/group leader' 0000-0002-0056-0513 # _audit_author.name 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of a septum formation protein Maf from Coccidioides immitis (UMP complex)' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ung, A.R.' 1 0000-0002-9906-0710 primary 'Lovell, S.' 2 0000-0002-3215-4472 primary 'Battaile, K.P.' 3 0000-0003-0833-3259 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Septum formation protein Maf' 27396.418 1 ? ? P42-L268 ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 non-polymer syn ;2'-DEOXYURIDINE 5'-MONOPHOSPHATE ; 308.182 1 ? ? ? ? 4 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' 195.237 1 ? ? ? ? 5 non-polymer syn IMIDAZOLE 69.085 1 ? ? ? ? 6 water nat water 18.015 23 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAHHHHHHMGTLEAQTQGPGSPPPLSLPVLNQLRSKRVILASASPRRKQIISFLGLRNVEIIPSNTPEDFPKTLTPFEYV LQTATHKAITVYQQEVNNLEKGEPALILAADTIVVDISTGDILEKPRSEAHHISMLKLLRDVMDHKVYTAVAAIVPLESA RDPGYALETVVEETKVRFDPDVTDELILAYVRTREGVDKAGGYGMQGLGSILVQRIEGSYDNVIGLPLRATLRLIEKAMA KAEDDDLL ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHHMGTLEAQTQGPGSPPPLSLPVLNQLRSKRVILASASPRRKQIISFLGLRNVEIIPSNTPEDFPKTLTPFEYV LQTATHKAITVYQQEVNNLEKGEPALILAADTIVVDISTGDILEKPRSEAHHISMLKLLRDVMDHKVYTAVAAIVPLESA RDPGYALETVVEETKVRFDPDVTDELILAYVRTREGVDKAGGYGMQGLGSILVQRIEGSYDNVIGLPLRATLRLIEKAMA KAEDDDLL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 ;2'-DEOXYURIDINE 5'-MONOPHOSPHATE ; UMP 4 '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' MES 5 IMIDAZOLE IMD 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 MET n 1 10 GLY n 1 11 THR n 1 12 LEU n 1 13 GLU n 1 14 ALA n 1 15 GLN n 1 16 THR n 1 17 GLN n 1 18 GLY n 1 19 PRO n 1 20 GLY n 1 21 SER n 1 22 PRO n 1 23 PRO n 1 24 PRO n 1 25 LEU n 1 26 SER n 1 27 LEU n 1 28 PRO n 1 29 VAL n 1 30 LEU n 1 31 ASN n 1 32 GLN n 1 33 LEU n 1 34 ARG n 1 35 SER n 1 36 LYS n 1 37 ARG n 1 38 VAL n 1 39 ILE n 1 40 LEU n 1 41 ALA n 1 42 SER n 1 43 ALA n 1 44 SER n 1 45 PRO n 1 46 ARG n 1 47 ARG n 1 48 LYS n 1 49 GLN n 1 50 ILE n 1 51 ILE n 1 52 SER n 1 53 PHE n 1 54 LEU n 1 55 GLY n 1 56 LEU n 1 57 ARG n 1 58 ASN n 1 59 VAL n 1 60 GLU n 1 61 ILE n 1 62 ILE n 1 63 PRO n 1 64 SER n 1 65 ASN n 1 66 THR n 1 67 PRO n 1 68 GLU n 1 69 ASP n 1 70 PHE n 1 71 PRO n 1 72 LYS n 1 73 THR n 1 74 LEU n 1 75 THR n 1 76 PRO n 1 77 PHE n 1 78 GLU n 1 79 TYR n 1 80 VAL n 1 81 LEU n 1 82 GLN n 1 83 THR n 1 84 ALA n 1 85 THR n 1 86 HIS n 1 87 LYS n 1 88 ALA n 1 89 ILE n 1 90 THR n 1 91 VAL n 1 92 TYR n 1 93 GLN n 1 94 GLN n 1 95 GLU n 1 96 VAL n 1 97 ASN n 1 98 ASN n 1 99 LEU n 1 100 GLU n 1 101 LYS n 1 102 GLY n 1 103 GLU n 1 104 PRO n 1 105 ALA n 1 106 LEU n 1 107 ILE n 1 108 LEU n 1 109 ALA n 1 110 ALA n 1 111 ASP n 1 112 THR n 1 113 ILE n 1 114 VAL n 1 115 VAL n 1 116 ASP n 1 117 ILE n 1 118 SER n 1 119 THR n 1 120 GLY n 1 121 ASP n 1 122 ILE n 1 123 LEU n 1 124 GLU n 1 125 LYS n 1 126 PRO n 1 127 ARG n 1 128 SER n 1 129 GLU n 1 130 ALA n 1 131 HIS n 1 132 HIS n 1 133 ILE n 1 134 SER n 1 135 MET n 1 136 LEU n 1 137 LYS n 1 138 LEU n 1 139 LEU n 1 140 ARG n 1 141 ASP n 1 142 VAL n 1 143 MET n 1 144 ASP n 1 145 HIS n 1 146 LYS n 1 147 VAL n 1 148 TYR n 1 149 THR n 1 150 ALA n 1 151 VAL n 1 152 ALA n 1 153 ALA n 1 154 ILE n 1 155 VAL n 1 156 PRO n 1 157 LEU n 1 158 GLU n 1 159 SER n 1 160 ALA n 1 161 ARG n 1 162 ASP n 1 163 PRO n 1 164 GLY n 1 165 TYR n 1 166 ALA n 1 167 LEU n 1 168 GLU n 1 169 THR n 1 170 VAL n 1 171 VAL n 1 172 GLU n 1 173 GLU n 1 174 THR n 1 175 LYS n 1 176 VAL n 1 177 ARG n 1 178 PHE n 1 179 ASP n 1 180 PRO n 1 181 ASP n 1 182 VAL n 1 183 THR n 1 184 ASP n 1 185 GLU n 1 186 LEU n 1 187 ILE n 1 188 LEU n 1 189 ALA n 1 190 TYR n 1 191 VAL n 1 192 ARG n 1 193 THR n 1 194 ARG n 1 195 GLU n 1 196 GLY n 1 197 VAL n 1 198 ASP n 1 199 LYS n 1 200 ALA n 1 201 GLY n 1 202 GLY n 1 203 TYR n 1 204 GLY n 1 205 MET n 1 206 GLN n 1 207 GLY n 1 208 LEU n 1 209 GLY n 1 210 SER n 1 211 ILE n 1 212 LEU n 1 213 VAL n 1 214 GLN n 1 215 ARG n 1 216 ILE n 1 217 GLU n 1 218 GLY n 1 219 SER n 1 220 TYR n 1 221 ASP n 1 222 ASN n 1 223 VAL n 1 224 ILE n 1 225 GLY n 1 226 LEU n 1 227 PRO n 1 228 LEU n 1 229 ARG n 1 230 ALA n 1 231 THR n 1 232 LEU n 1 233 ARG n 1 234 LEU n 1 235 ILE n 1 236 GLU n 1 237 LYS n 1 238 ALA n 1 239 MET n 1 240 ALA n 1 241 LYS n 1 242 ALA n 1 243 GLU n 1 244 ASP n 1 245 ASP n 1 246 ASP n 1 247 LEU n 1 248 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 248 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CIMG_03133 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Coccidioides immitis RS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 246410 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name CoimA.00961.a.A2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IMD non-polymer . IMIDAZOLE ? 'C3 H5 N2 1' 69.085 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MES non-polymer . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ? 'C6 H13 N O4 S' 195.237 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UMP non-polymer . ;2'-DEOXYURIDINE 5'-MONOPHOSPHATE ; DUMP 'C9 H13 N2 O8 P' 308.182 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 21 ? ? ? A . n A 1 2 ALA 2 22 ? ? ? A . n A 1 3 HIS 3 23 ? ? ? A . n A 1 4 HIS 4 24 ? ? ? A . n A 1 5 HIS 5 25 ? ? ? A . n A 1 6 HIS 6 26 ? ? ? A . n A 1 7 HIS 7 27 ? ? ? A . n A 1 8 HIS 8 28 ? ? ? A . n A 1 9 MET 9 29 ? ? ? A . n A 1 10 GLY 10 30 ? ? ? A . n A 1 11 THR 11 31 ? ? ? A . n A 1 12 LEU 12 32 ? ? ? A . n A 1 13 GLU 13 33 ? ? ? A . n A 1 14 ALA 14 34 ? ? ? A . n A 1 15 GLN 15 35 ? ? ? A . n A 1 16 THR 16 36 ? ? ? A . n A 1 17 GLN 17 37 ? ? ? A . n A 1 18 GLY 18 38 ? ? ? A . n A 1 19 PRO 19 39 ? ? ? A . n A 1 20 GLY 20 40 ? ? ? A . n A 1 21 SER 21 41 41 SER SER A . n A 1 22 PRO 22 42 42 PRO PRO A . n A 1 23 PRO 23 43 43 PRO PRO A . n A 1 24 PRO 24 44 44 PRO PRO A . n A 1 25 LEU 25 45 45 LEU LEU A . n A 1 26 SER 26 46 46 SER SER A . n A 1 27 LEU 27 47 47 LEU LEU A . n A 1 28 PRO 28 48 48 PRO PRO A . n A 1 29 VAL 29 49 49 VAL VAL A . n A 1 30 LEU 30 50 50 LEU LEU A . n A 1 31 ASN 31 51 51 ASN ASN A . n A 1 32 GLN 32 52 52 GLN GLN A . n A 1 33 LEU 33 53 53 LEU LEU A . n A 1 34 ARG 34 54 54 ARG ARG A . n A 1 35 SER 35 55 55 SER SER A . n A 1 36 LYS 36 56 56 LYS LYS A . n A 1 37 ARG 37 57 57 ARG ARG A . n A 1 38 VAL 38 58 58 VAL VAL A . n A 1 39 ILE 39 59 59 ILE ILE A . n A 1 40 LEU 40 60 60 LEU LEU A . n A 1 41 ALA 41 61 61 ALA ALA A . n A 1 42 SER 42 62 62 SER SER A . n A 1 43 ALA 43 63 63 ALA ALA A . n A 1 44 SER 44 64 64 SER SER A . n A 1 45 PRO 45 65 65 PRO PRO A . n A 1 46 ARG 46 66 66 ARG ARG A . n A 1 47 ARG 47 67 67 ARG ARG A . n A 1 48 LYS 48 68 68 LYS LYS A . n A 1 49 GLN 49 69 69 GLN GLN A . n A 1 50 ILE 50 70 70 ILE ILE A . n A 1 51 ILE 51 71 71 ILE ILE A . n A 1 52 SER 52 72 72 SER SER A . n A 1 53 PHE 53 73 73 PHE PHE A . n A 1 54 LEU 54 74 74 LEU LEU A . n A 1 55 GLY 55 75 75 GLY GLY A . n A 1 56 LEU 56 76 76 LEU LEU A . n A 1 57 ARG 57 77 77 ARG ARG A . n A 1 58 ASN 58 78 78 ASN ASN A . n A 1 59 VAL 59 79 79 VAL VAL A . n A 1 60 GLU 60 80 80 GLU GLU A . n A 1 61 ILE 61 81 81 ILE ILE A . n A 1 62 ILE 62 82 82 ILE ILE A . n A 1 63 PRO 63 83 83 PRO PRO A . n A 1 64 SER 64 84 84 SER SER A . n A 1 65 ASN 65 85 85 ASN ASN A . n A 1 66 THR 66 86 86 THR THR A . n A 1 67 PRO 67 87 87 PRO PRO A . n A 1 68 GLU 68 88 88 GLU GLU A . n A 1 69 ASP 69 89 89 ASP ASP A . n A 1 70 PHE 70 90 90 PHE PHE A . n A 1 71 PRO 71 91 91 PRO PRO A . n A 1 72 LYS 72 92 92 LYS LYS A . n A 1 73 THR 73 93 93 THR THR A . n A 1 74 LEU 74 94 94 LEU LEU A . n A 1 75 THR 75 95 95 THR THR A . n A 1 76 PRO 76 96 96 PRO PRO A . n A 1 77 PHE 77 97 97 PHE PHE A . n A 1 78 GLU 78 98 98 GLU GLU A . n A 1 79 TYR 79 99 99 TYR TYR A . n A 1 80 VAL 80 100 100 VAL VAL A . n A 1 81 LEU 81 101 101 LEU LEU A . n A 1 82 GLN 82 102 102 GLN GLN A . n A 1 83 THR 83 103 103 THR THR A . n A 1 84 ALA 84 104 104 ALA ALA A . n A 1 85 THR 85 105 105 THR THR A . n A 1 86 HIS 86 106 106 HIS HIS A . n A 1 87 LYS 87 107 107 LYS LYS A . n A 1 88 ALA 88 108 108 ALA ALA A . n A 1 89 ILE 89 109 109 ILE ILE A . n A 1 90 THR 90 110 110 THR THR A . n A 1 91 VAL 91 111 111 VAL VAL A . n A 1 92 TYR 92 112 112 TYR TYR A . n A 1 93 GLN 93 113 113 GLN GLN A . n A 1 94 GLN 94 114 114 GLN GLN A . n A 1 95 GLU 95 115 115 GLU GLU A . n A 1 96 VAL 96 116 116 VAL VAL A . n A 1 97 ASN 97 117 117 ASN ASN A . n A 1 98 ASN 98 118 118 ASN ASN A . n A 1 99 LEU 99 119 119 LEU LEU A . n A 1 100 GLU 100 120 120 GLU GLU A . n A 1 101 LYS 101 121 121 LYS LYS A . n A 1 102 GLY 102 122 122 GLY GLY A . n A 1 103 GLU 103 123 123 GLU GLU A . n A 1 104 PRO 104 124 124 PRO PRO A . n A 1 105 ALA 105 125 125 ALA ALA A . n A 1 106 LEU 106 126 126 LEU LEU A . n A 1 107 ILE 107 127 127 ILE ILE A . n A 1 108 LEU 108 128 128 LEU LEU A . n A 1 109 ALA 109 129 129 ALA ALA A . n A 1 110 ALA 110 130 130 ALA ALA A . n A 1 111 ASP 111 131 131 ASP ASP A . n A 1 112 THR 112 132 132 THR THR A . n A 1 113 ILE 113 133 133 ILE ILE A . n A 1 114 VAL 114 134 134 VAL VAL A . n A 1 115 VAL 115 135 135 VAL VAL A . n A 1 116 ASP 116 136 136 ASP ASP A . n A 1 117 ILE 117 137 137 ILE ILE A . n A 1 118 SER 118 138 138 SER SER A . n A 1 119 THR 119 139 139 THR THR A . n A 1 120 GLY 120 140 140 GLY GLY A . n A 1 121 ASP 121 141 141 ASP ASP A . n A 1 122 ILE 122 142 142 ILE ILE A . n A 1 123 LEU 123 143 143 LEU LEU A . n A 1 124 GLU 124 144 144 GLU GLU A . n A 1 125 LYS 125 145 145 LYS LYS A . n A 1 126 PRO 126 146 146 PRO PRO A . n A 1 127 ARG 127 147 147 ARG ARG A . n A 1 128 SER 128 148 148 SER SER A . n A 1 129 GLU 129 149 149 GLU GLU A . n A 1 130 ALA 130 150 150 ALA ALA A . n A 1 131 HIS 131 151 151 HIS HIS A . n A 1 132 HIS 132 152 152 HIS HIS A . n A 1 133 ILE 133 153 153 ILE ILE A . n A 1 134 SER 134 154 154 SER SER A . n A 1 135 MET 135 155 155 MET MET A . n A 1 136 LEU 136 156 156 LEU LEU A . n A 1 137 LYS 137 157 157 LYS LYS A . n A 1 138 LEU 138 158 158 LEU LEU A . n A 1 139 LEU 139 159 159 LEU LEU A . n A 1 140 ARG 140 160 160 ARG ARG A . n A 1 141 ASP 141 161 161 ASP ASP A . n A 1 142 VAL 142 162 162 VAL VAL A . n A 1 143 MET 143 163 163 MET MET A . n A 1 144 ASP 144 164 164 ASP ASP A . n A 1 145 HIS 145 165 165 HIS HIS A . n A 1 146 LYS 146 166 166 LYS LYS A . n A 1 147 VAL 147 167 167 VAL VAL A . n A 1 148 TYR 148 168 168 TYR TYR A . n A 1 149 THR 149 169 169 THR THR A . n A 1 150 ALA 150 170 170 ALA ALA A . n A 1 151 VAL 151 171 171 VAL VAL A . n A 1 152 ALA 152 172 172 ALA ALA A . n A 1 153 ALA 153 173 173 ALA ALA A . n A 1 154 ILE 154 174 174 ILE ILE A . n A 1 155 VAL 155 175 175 VAL VAL A . n A 1 156 PRO 156 176 176 PRO PRO A . n A 1 157 LEU 157 177 177 LEU LEU A . n A 1 158 GLU 158 178 178 GLU GLU A . n A 1 159 SER 159 179 179 SER SER A . n A 1 160 ALA 160 180 180 ALA ALA A . n A 1 161 ARG 161 181 181 ARG ARG A . n A 1 162 ASP 162 182 182 ASP ASP A . n A 1 163 PRO 163 183 183 PRO PRO A . n A 1 164 GLY 164 184 184 GLY GLY A . n A 1 165 TYR 165 185 185 TYR TYR A . n A 1 166 ALA 166 186 186 ALA ALA A . n A 1 167 LEU 167 187 187 LEU LEU A . n A 1 168 GLU 168 188 188 GLU GLU A . n A 1 169 THR 169 189 189 THR THR A . n A 1 170 VAL 170 190 190 VAL VAL A . n A 1 171 VAL 171 191 191 VAL VAL A . n A 1 172 GLU 172 192 192 GLU GLU A . n A 1 173 GLU 173 193 193 GLU GLU A . n A 1 174 THR 174 194 194 THR THR A . n A 1 175 LYS 175 195 195 LYS LYS A . n A 1 176 VAL 176 196 196 VAL VAL A . n A 1 177 ARG 177 197 197 ARG ARG A . n A 1 178 PHE 178 198 198 PHE PHE A . n A 1 179 ASP 179 199 199 ASP ASP A . n A 1 180 PRO 180 200 200 PRO PRO A . n A 1 181 ASP 181 201 201 ASP ASP A . n A 1 182 VAL 182 202 202 VAL VAL A . n A 1 183 THR 183 203 203 THR THR A . n A 1 184 ASP 184 204 204 ASP ASP A . n A 1 185 GLU 185 205 205 GLU GLU A . n A 1 186 LEU 186 206 206 LEU LEU A . n A 1 187 ILE 187 207 207 ILE ILE A . n A 1 188 LEU 188 208 208 LEU LEU A . n A 1 189 ALA 189 209 209 ALA ALA A . n A 1 190 TYR 190 210 210 TYR TYR A . n A 1 191 VAL 191 211 211 VAL VAL A . n A 1 192 ARG 192 212 212 ARG ARG A . n A 1 193 THR 193 213 213 THR THR A . n A 1 194 ARG 194 214 214 ARG ARG A . n A 1 195 GLU 195 215 215 GLU GLU A . n A 1 196 GLY 196 216 216 GLY GLY A . n A 1 197 VAL 197 217 217 VAL VAL A . n A 1 198 ASP 198 218 218 ASP ASP A . n A 1 199 LYS 199 219 219 LYS LYS A . n A 1 200 ALA 200 220 220 ALA ALA A . n A 1 201 GLY 201 221 221 GLY GLY A . n A 1 202 GLY 202 222 222 GLY GLY A . n A 1 203 TYR 203 223 223 TYR TYR A . n A 1 204 GLY 204 224 224 GLY GLY A . n A 1 205 MET 205 225 225 MET MET A . n A 1 206 GLN 206 226 226 GLN GLN A . n A 1 207 GLY 207 227 227 GLY GLY A . n A 1 208 LEU 208 228 228 LEU LEU A . n A 1 209 GLY 209 229 229 GLY GLY A . n A 1 210 SER 210 230 230 SER SER A . n A 1 211 ILE 211 231 231 ILE ILE A . n A 1 212 LEU 212 232 232 LEU LEU A . n A 1 213 VAL 213 233 233 VAL VAL A . n A 1 214 GLN 214 234 234 GLN GLN A . n A 1 215 ARG 215 235 235 ARG ARG A . n A 1 216 ILE 216 236 236 ILE ILE A . n A 1 217 GLU 217 237 237 GLU GLU A . n A 1 218 GLY 218 238 238 GLY GLY A . n A 1 219 SER 219 239 239 SER SER A . n A 1 220 TYR 220 240 240 TYR TYR A . n A 1 221 ASP 221 241 241 ASP ASP A . n A 1 222 ASN 222 242 242 ASN ASN A . n A 1 223 VAL 223 243 243 VAL VAL A . n A 1 224 ILE 224 244 244 ILE ILE A . n A 1 225 GLY 225 245 245 GLY GLY A . n A 1 226 LEU 226 246 246 LEU LEU A . n A 1 227 PRO 227 247 247 PRO PRO A . n A 1 228 LEU 228 248 248 LEU LEU A . n A 1 229 ARG 229 249 249 ARG ARG A . n A 1 230 ALA 230 250 250 ALA ALA A . n A 1 231 THR 231 251 251 THR THR A . n A 1 232 LEU 232 252 252 LEU LEU A . n A 1 233 ARG 233 253 253 ARG ARG A . n A 1 234 LEU 234 254 254 LEU LEU A . n A 1 235 ILE 235 255 255 ILE ILE A . n A 1 236 GLU 236 256 256 GLU GLU A . n A 1 237 LYS 237 257 257 LYS LYS A . n A 1 238 ALA 238 258 258 ALA ALA A . n A 1 239 MET 239 259 259 MET MET A . n A 1 240 ALA 240 260 260 ALA ALA A . n A 1 241 LYS 241 261 261 LYS LYS A . n A 1 242 ALA 242 262 262 ALA ALA A . n A 1 243 GLU 243 263 263 GLU GLU A . n A 1 244 ASP 244 264 264 ASP ASP A . n A 1 245 ASP 245 265 265 ASP ASP A . n A 1 246 ASP 246 266 266 ASP ASP A . n A 1 247 LEU 247 267 ? ? ? A . n A 1 248 LEU 248 268 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id UMP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id UMP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 301 1 CL CL A . C 3 UMP 1 302 1 UMP UMP A . D 4 MES 1 303 301 MES MES A . E 5 IMD 1 304 301 IMD IMD A . F 6 HOH 1 401 2 HOH HOH A . F 6 HOH 2 402 9 HOH HOH A . F 6 HOH 3 403 22 HOH HOH A . F 6 HOH 4 404 7 HOH HOH A . F 6 HOH 5 405 18 HOH HOH A . F 6 HOH 6 406 13 HOH HOH A . F 6 HOH 7 407 5 HOH HOH A . F 6 HOH 8 408 19 HOH HOH A . F 6 HOH 9 409 12 HOH HOH A . F 6 HOH 10 410 6 HOH HOH A . F 6 HOH 11 411 3 HOH HOH A . F 6 HOH 12 412 14 HOH HOH A . F 6 HOH 13 413 1 HOH HOH A . F 6 HOH 14 414 11 HOH HOH A . F 6 HOH 15 415 17 HOH HOH A . F 6 HOH 16 416 16 HOH HOH A . F 6 HOH 17 417 15 HOH HOH A . F 6 HOH 18 418 10 HOH HOH A . F 6 HOH 19 419 23 HOH HOH A . F 6 HOH 20 420 21 HOH HOH A . F 6 HOH 21 421 4 HOH HOH A . F 6 HOH 22 422 8 HOH HOH A . F 6 HOH 23 423 20 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 66 ? CG ? A ARG 46 CG 2 1 Y 1 A ARG 66 ? CD ? A ARG 46 CD 3 1 Y 1 A ARG 66 ? NE ? A ARG 46 NE 4 1 Y 1 A ARG 66 ? CZ ? A ARG 46 CZ 5 1 Y 1 A ARG 66 ? NH1 ? A ARG 46 NH1 6 1 Y 1 A ARG 66 ? NH2 ? A ARG 46 NH2 7 1 Y 1 A GLU 88 ? CG ? A GLU 68 CG 8 1 Y 1 A GLU 88 ? CD ? A GLU 68 CD 9 1 Y 1 A GLU 88 ? OE1 ? A GLU 68 OE1 10 1 Y 1 A GLU 88 ? OE2 ? A GLU 68 OE2 11 1 Y 1 A ASP 89 ? CG ? A ASP 69 CG 12 1 Y 1 A ASP 89 ? OD1 ? A ASP 69 OD1 13 1 Y 1 A ASP 89 ? OD2 ? A ASP 69 OD2 14 1 Y 1 A LYS 92 ? CG ? A LYS 72 CG 15 1 Y 1 A LYS 92 ? CD ? A LYS 72 CD 16 1 Y 1 A LYS 92 ? CE ? A LYS 72 CE 17 1 Y 1 A LYS 92 ? NZ ? A LYS 72 NZ 18 1 Y 1 A LYS 145 ? CG ? A LYS 125 CG 19 1 Y 1 A LYS 145 ? CD ? A LYS 125 CD 20 1 Y 1 A LYS 145 ? CE ? A LYS 125 CE 21 1 Y 1 A LYS 145 ? NZ ? A LYS 125 NZ 22 1 Y 1 A ARG 181 ? CG ? A ARG 161 CG 23 1 Y 1 A ARG 181 ? CD ? A ARG 161 CD 24 1 Y 1 A ARG 181 ? NE ? A ARG 161 NE 25 1 Y 1 A ARG 181 ? CZ ? A ARG 161 CZ 26 1 Y 1 A ARG 181 ? NH1 ? A ARG 161 NH1 27 1 Y 1 A ARG 181 ? NH2 ? A ARG 161 NH2 28 1 Y 1 A ASP 265 ? CG ? A ASP 245 CG 29 1 Y 1 A ASP 265 ? OD1 ? A ASP 245 OD1 30 1 Y 1 A ASP 265 ? OD2 ? A ASP 245 OD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(2.2.1_6174: ???)' ? 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 39PE _cell.details ? _cell.formula_units_Z ? _cell.length_a 76.542 _cell.length_a_esd ? _cell.length_b 76.542 _cell.length_b_esd ? _cell.length_c 176.111 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 39PE _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 39PE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.71 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 73.87 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Morpheus Fusion D6: 20% (v/v) Ethylene glycol; 10 % (w/v) PEG 8000; 0.04M Imidazole; 0.06M MES monohydrate (acid) pH 6.5; 0.3% w/v NDSB 195, 0.3% w/v NDSB 201, 0.3% w/v NDSB 211, 0.3% w/v NDSB 221, 0.3% w/v NDSB 256 , CoimA.00961.a.A2.PW39528 at 13.2 mg/mL. cocrystallization with 225 mM Uridine 5'-monophosphate (UMP) and 20 mM Magnesium chloride hexahydrate. plate 21394 and G9 drop 2, Puck: PSL-0108, Cryo: direct. ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 XE 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2026-09-26 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Double Crystal Si 111' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9786 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9786 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 39PE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.40 _reflns.d_resolution_low 46.58 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21331 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.99 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.106 _reflns.pdbx_Rpim_I_all 0.021 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 552251 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.104 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.40 _reflns_shell.d_res_low 2.49 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 55608 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2176 _reflns_shell.percent_possible_obs 100.0 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 25.6 _reflns_shell.pdbx_chi_squared 0.95 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 1.8 _reflns_shell.pdbx_Rrim_I_all 2.018 _reflns_shell.pdbx_Rpim_I_all 0.397 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.949 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.978 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 39PE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.40 _refine.ls_d_res_low 46.58 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21229 _refine.ls_number_reflns_R_free 1085 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.82 _refine.ls_percent_reflns_R_free 5.11 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2178 _refine.ls_R_factor_R_free 0.2443 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2165 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.89 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.35 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 46.58 _refine_hist.number_atoms_solvent 23 _refine_hist.number_atoms_total 1785 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1724 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 38 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 1808 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.591 ? 2466 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 18.134 ? 697 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.042 ? 298 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 315 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.40 2.51 . . 139 2429 99.00 . . . . 0.3168 . . . . . . . . . . . . . . . 0.3544 'X-RAY DIFFRACTION' 2.51 2.64 . . 130 2483 100.00 . . . . 0.2563 . . . . . . . . . . . . . . . 0.2576 'X-RAY DIFFRACTION' 2.64 2.81 . . 135 2447 100.00 . . . . 0.2486 . . . . . . . . . . . . . . . 0.3078 'X-RAY DIFFRACTION' 2.81 3.02 . . 159 2454 100.00 . . . . 0.2810 . . . . . . . . . . . . . . . 0.3486 'X-RAY DIFFRACTION' 3.02 3.33 . . 125 2519 100.00 . . . . 0.2438 . . . . . . . . . . . . . . . 0.2560 'X-RAY DIFFRACTION' 3.33 3.81 . . 126 2519 100.00 . . . . 0.2313 . . . . . . . . . . . . . . . 0.2658 'X-RAY DIFFRACTION' 3.81 4.80 . . 138 2566 100.00 . . . . 0.1782 . . . . . . . . . . . . . . . 0.2049 'X-RAY DIFFRACTION' 4.80 46.58 . . 133 2727 100.00 . . . . 0.1994 . . . . . . . . . . . . . . . 0.2153 # _struct.entry_id 39PE _struct.title 'Crystal structure of a septum formation protein Maf from Coccidioides immitis (UMP complex)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 39PE _struct_keywords.text ;SSGCID, STRUCTURAL GENOMICS, SEATTLE STRUCTURAL GENOMICS CENTER FOR INFECTIOUS DISEASE, septum formation protein Maf, Coccidioides immitis, CELL CYCLE ; _struct_keywords.pdbx_keywords 'CELL CYCLE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code J3KAP5_COCIM _struct_ref.pdbx_db_accession J3KAP5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PPPLSLPVLNQLRSKRVILASASPRRKQIISFLGLRNVEIIPSNTPEDFPKTLTPFEYVLQTATHKAITVYQQEVNNLEK GEPALILAADTIVVDISTGDILEKPRSEAHHISMLKLLRDVMDHKVYTAVAAIVPLESARDPGYALETVVEETKVRFDPD VTDELILAYVRTREGVDKAGGYGMQGLGSILVQRIEGSYDNVIGLPLRATLRLIEKAMAKAEDDDLL ; _struct_ref.pdbx_align_begin 42 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 39PE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 248 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession J3KAP5 _struct_ref_seq.db_align_beg 42 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 268 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 42 _struct_ref_seq.pdbx_auth_seq_align_end 268 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 39PE MET A 1 ? UNP J3KAP5 ? ? 'expression tag' 21 1 1 39PE ALA A 2 ? UNP J3KAP5 ? ? 'expression tag' 22 2 1 39PE HIS A 3 ? UNP J3KAP5 ? ? 'expression tag' 23 3 1 39PE HIS A 4 ? UNP J3KAP5 ? ? 'expression tag' 24 4 1 39PE HIS A 5 ? UNP J3KAP5 ? ? 'expression tag' 25 5 1 39PE HIS A 6 ? UNP J3KAP5 ? ? 'expression tag' 26 6 1 39PE HIS A 7 ? UNP J3KAP5 ? ? 'expression tag' 27 7 1 39PE HIS A 8 ? UNP J3KAP5 ? ? 'expression tag' 28 8 1 39PE MET A 9 ? UNP J3KAP5 ? ? 'expression tag' 29 9 1 39PE GLY A 10 ? UNP J3KAP5 ? ? 'expression tag' 30 10 1 39PE THR A 11 ? UNP J3KAP5 ? ? 'expression tag' 31 11 1 39PE LEU A 12 ? UNP J3KAP5 ? ? 'expression tag' 32 12 1 39PE GLU A 13 ? UNP J3KAP5 ? ? 'expression tag' 33 13 1 39PE ALA A 14 ? UNP J3KAP5 ? ? 'expression tag' 34 14 1 39PE GLN A 15 ? UNP J3KAP5 ? ? 'expression tag' 35 15 1 39PE THR A 16 ? UNP J3KAP5 ? ? 'expression tag' 36 16 1 39PE GLN A 17 ? UNP J3KAP5 ? ? 'expression tag' 37 17 1 39PE GLY A 18 ? UNP J3KAP5 ? ? 'expression tag' 38 18 1 39PE PRO A 19 ? UNP J3KAP5 ? ? 'expression tag' 39 19 1 39PE GLY A 20 ? UNP J3KAP5 ? ? 'expression tag' 40 20 1 39PE SER A 21 ? UNP J3KAP5 ? ? 'expression tag' 41 21 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5560 ? 1 MORE -17 ? 1 'SSA (A^2)' 19540 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 27 ? ARG A 34 ? LEU A 47 ARG A 54 1 ? 8 HELX_P HELX_P2 AA2 SER A 44 ? PHE A 53 ? SER A 64 PHE A 73 1 ? 10 HELX_P HELX_P3 AA3 THR A 75 ? VAL A 96 ? THR A 95 VAL A 116 1 ? 22 HELX_P HELX_P4 AA4 SER A 128 ? MET A 143 ? SER A 148 MET A 163 1 ? 16 HELX_P HELX_P5 AA5 THR A 183 ? ARG A 194 ? THR A 203 ARG A 214 1 ? 12 HELX_P HELX_P6 AA6 GLU A 195 ? TYR A 203 ? GLU A 215 TYR A 223 5 ? 9 HELX_P HELX_P7 AA7 GLY A 207 ? ILE A 211 ? GLY A 227 ILE A 231 5 ? 5 HELX_P HELX_P8 AA8 SER A 219 ? ILE A 224 ? SER A 239 ILE A 244 1 ? 6 HELX_P HELX_P9 AA9 PRO A 227 ? ASP A 244 ? PRO A 247 ASP A 264 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 162 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 182 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 163 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 183 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.74 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 59 ? ILE A 61 ? VAL A 79 ILE A 81 AA1 2 VAL A 38 ? LEU A 40 ? VAL A 58 LEU A 60 AA1 3 LEU A 106 ? VAL A 115 ? LEU A 126 VAL A 135 AA1 4 ILE A 122 ? LEU A 123 ? ILE A 142 LEU A 143 AA2 1 VAL A 59 ? ILE A 61 ? VAL A 79 ILE A 81 AA2 2 VAL A 38 ? LEU A 40 ? VAL A 58 LEU A 60 AA2 3 LEU A 106 ? VAL A 115 ? LEU A 126 VAL A 135 AA2 4 ASP A 144 ? PRO A 156 ? ASP A 164 PRO A 176 AA2 5 TYR A 165 ? PHE A 178 ? TYR A 185 PHE A 198 AA2 6 VAL A 213 ? GLU A 217 ? VAL A 233 GLU A 237 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 60 ? O GLU A 80 N VAL A 38 ? N VAL A 58 AA1 2 3 N ILE A 39 ? N ILE A 59 O LEU A 108 ? O LEU A 128 AA1 3 4 N VAL A 114 ? N VAL A 134 O LEU A 123 ? O LEU A 143 AA2 1 2 O GLU A 60 ? O GLU A 80 N VAL A 38 ? N VAL A 58 AA2 2 3 N ILE A 39 ? N ILE A 59 O LEU A 108 ? O LEU A 128 AA2 3 4 N VAL A 115 ? N VAL A 135 O LYS A 146 ? O LYS A 166 AA2 4 5 N HIS A 145 ? N HIS A 165 O VAL A 176 ? O VAL A 196 AA2 5 6 N ARG A 177 ? N ARG A 197 O GLN A 214 ? O GLN A 234 # _pdbx_entry_details.entry_id 39PE _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id MET _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 163 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 72.33 _pdbx_validate_torsion.psi -64.66 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.initial_of_center SSGCID # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -0.9169 -18.8487 12.9539 0.5691 ? -0.0929 ? -0.0364 ? 0.5914 ? -0.0349 ? 0.6754 ? 6.8515 ? -1.5319 ? 2.9860 ? 3.2366 ? -0.4576 ? 1.7068 ? -0.2848 ? -0.6758 ? 0.7003 ? 0.1936 ? 0.2669 ? -0.1786 ? -0.2111 ? 0.5823 ? 0.0579 ? 2 'X-RAY DIFFRACTION' ? refined -2.1458 -29.6659 -3.0972 0.5842 ? 0.0037 ? -0.0464 ? 0.5155 ? -0.0959 ? 0.6127 ? 2.3116 ? -0.3060 ? 3.6702 ? -0.2992 ? -0.2482 ? 5.0775 ? 0.3707 ? 0.3564 ? -0.3395 ? -0.0794 ? -0.0252 ? -0.1945 ? 0.5546 ? 0.7759 ? -0.0185 ? 3 'X-RAY DIFFRACTION' ? refined -12.5207 -22.8765 -5.8941 0.5696 ? -0.0761 ? -0.0481 ? 0.4672 ? -0.0037 ? 0.5939 ? 0.6222 ? -0.2762 ? -0.3365 ? 0.7425 ? 0.7189 ? 0.8222 ? 0.0749 ? -0.0720 ? -0.1742 ? 0.1278 ? 0.0342 ? -0.0709 ? -0.2010 ? -0.2403 ? 0.0012 ? 4 'X-RAY DIFFRACTION' ? refined -4.9456 -31.5027 16.9509 0.7255 ? -0.1046 ? -0.0243 ? 0.6228 ? 0.0841 ? 0.5367 ? 0.0399 ? 0.0580 ? 0.0041 ? 0.1051 ? -0.0094 ? 0.0047 ? -0.2233 ? -0.8978 ? -0.0730 ? 0.3086 ? 0.0174 ? 0.2754 ? 0.5085 ? -0.5497 ? -0.0278 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 41 through 74 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 75 through 176 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 177 through 247 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 248 through 266 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 21 ? A MET 1 2 1 Y 1 A ALA 22 ? A ALA 2 3 1 Y 1 A HIS 23 ? A HIS 3 4 1 Y 1 A HIS 24 ? A HIS 4 5 1 Y 1 A HIS 25 ? A HIS 5 6 1 Y 1 A HIS 26 ? A HIS 6 7 1 Y 1 A HIS 27 ? A HIS 7 8 1 Y 1 A HIS 28 ? A HIS 8 9 1 Y 1 A MET 29 ? A MET 9 10 1 Y 1 A GLY 30 ? A GLY 10 11 1 Y 1 A THR 31 ? A THR 11 12 1 Y 1 A LEU 32 ? A LEU 12 13 1 Y 1 A GLU 33 ? A GLU 13 14 1 Y 1 A ALA 34 ? A ALA 14 15 1 Y 1 A GLN 35 ? A GLN 15 16 1 Y 1 A THR 36 ? A THR 16 17 1 Y 1 A GLN 37 ? A GLN 17 18 1 Y 1 A GLY 38 ? A GLY 18 19 1 Y 1 A PRO 39 ? A PRO 19 20 1 Y 1 A GLY 40 ? A GLY 20 21 1 Y 1 A LEU 267 ? A LEU 247 22 1 Y 1 A LEU 268 ? A LEU 248 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 HOH O O N N 145 HOH H1 H N N 146 HOH H2 H N N 147 ILE N N N N 148 ILE CA C N S 149 ILE C C N N 150 ILE O O N N 151 ILE CB C N S 152 ILE CG1 C N N 153 ILE CG2 C N N 154 ILE CD1 C N N 155 ILE OXT O N N 156 ILE H H N N 157 ILE H2 H N N 158 ILE HA H N N 159 ILE HB H N N 160 ILE HG12 H N N 161 ILE HG13 H N N 162 ILE HG21 H N N 163 ILE HG22 H N N 164 ILE HG23 H N N 165 ILE HD11 H N N 166 ILE HD12 H N N 167 ILE HD13 H N N 168 ILE HXT H N N 169 IMD N1 N Y N 170 IMD C2 C Y N 171 IMD N3 N Y N 172 IMD C4 C Y N 173 IMD C5 C Y N 174 IMD HN1 H N N 175 IMD H2 H N N 176 IMD HN3 H N N 177 IMD H4 H N N 178 IMD H5 H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MES O1 O N N 227 MES C2 C N N 228 MES C3 C N N 229 MES N4 N N N 230 MES C5 C N N 231 MES C6 C N N 232 MES C7 C N N 233 MES C8 C N N 234 MES S S N N 235 MES O1S O N N 236 MES O2S O N N 237 MES O3S O N N 238 MES H21 H N N 239 MES H22 H N N 240 MES H31 H N N 241 MES H32 H N N 242 MES HN4 H N N 243 MES H51 H N N 244 MES H52 H N N 245 MES H61 H N N 246 MES H62 H N N 247 MES H71 H N N 248 MES H72 H N N 249 MES H81 H N N 250 MES H82 H N N 251 MET N N N N 252 MET CA C N S 253 MET C C N N 254 MET O O N N 255 MET CB C N N 256 MET CG C N N 257 MET SD S N N 258 MET CE C N N 259 MET OXT O N N 260 MET H H N N 261 MET H2 H N N 262 MET HA H N N 263 MET HB2 H N N 264 MET HB3 H N N 265 MET HG2 H N N 266 MET HG3 H N N 267 MET HE1 H N N 268 MET HE2 H N N 269 MET HE3 H N N 270 MET HXT H N N 271 PHE N N N N 272 PHE CA C N S 273 PHE C C N N 274 PHE O O N N 275 PHE CB C N N 276 PHE CG C Y N 277 PHE CD1 C Y N 278 PHE CD2 C Y N 279 PHE CE1 C Y N 280 PHE CE2 C Y N 281 PHE CZ C Y N 282 PHE OXT O N N 283 PHE H H N N 284 PHE H2 H N N 285 PHE HA H N N 286 PHE HB2 H N N 287 PHE HB3 H N N 288 PHE HD1 H N N 289 PHE HD2 H N N 290 PHE HE1 H N N 291 PHE HE2 H N N 292 PHE HZ H N N 293 PHE HXT H N N 294 PRO N N N N 295 PRO CA C N S 296 PRO C C N N 297 PRO O O N N 298 PRO CB C N N 299 PRO CG C N N 300 PRO CD C N N 301 PRO OXT O N N 302 PRO H H N N 303 PRO HA H N N 304 PRO HB2 H N N 305 PRO HB3 H N N 306 PRO HG2 H N N 307 PRO HG3 H N N 308 PRO HD2 H N N 309 PRO HD3 H N N 310 PRO HXT H N N 311 SER N N N N 312 SER CA C N S 313 SER C C N N 314 SER O O N N 315 SER CB C N N 316 SER OG O N N 317 SER OXT O N N 318 SER H H N N 319 SER H2 H N N 320 SER HA H N N 321 SER HB2 H N N 322 SER HB3 H N N 323 SER HG H N N 324 SER HXT H N N 325 THR N N N N 326 THR CA C N S 327 THR C C N N 328 THR O O N N 329 THR CB C N R 330 THR OG1 O N N 331 THR CG2 C N N 332 THR OXT O N N 333 THR H H N N 334 THR H2 H N N 335 THR HA H N N 336 THR HB H N N 337 THR HG1 H N N 338 THR HG21 H N N 339 THR HG22 H N N 340 THR HG23 H N N 341 THR HXT H N N 342 TYR N N N N 343 TYR CA C N S 344 TYR C C N N 345 TYR O O N N 346 TYR CB C N N 347 TYR CG C Y N 348 TYR CD1 C Y N 349 TYR CD2 C Y N 350 TYR CE1 C Y N 351 TYR CE2 C Y N 352 TYR CZ C Y N 353 TYR OH O N N 354 TYR OXT O N N 355 TYR H H N N 356 TYR H2 H N N 357 TYR HA H N N 358 TYR HB2 H N N 359 TYR HB3 H N N 360 TYR HD1 H N N 361 TYR HD2 H N N 362 TYR HE1 H N N 363 TYR HE2 H N N 364 TYR HH H N N 365 TYR HXT H N N 366 UMP N1 N N N 367 UMP C2 C N N 368 UMP N3 N N N 369 UMP C4 C N N 370 UMP C5 C N N 371 UMP C6 C N N 372 UMP O2 O N N 373 UMP O4 O N N 374 UMP "C1'" C N R 375 UMP "C2'" C N N 376 UMP "C3'" C N S 377 UMP "C4'" C N R 378 UMP "O3'" O N N 379 UMP "O4'" O N N 380 UMP "C5'" C N N 381 UMP "O5'" O N N 382 UMP P P N N 383 UMP OP1 O N N 384 UMP OP2 O N N 385 UMP OP3 O N N 386 UMP HN3 H N N 387 UMP H5 H N N 388 UMP H6 H N N 389 UMP "H1'" H N N 390 UMP "H2'" H N N 391 UMP "H2''" H N N 392 UMP "H3'" H N N 393 UMP "H4'" H N N 394 UMP "HO3'" H N N 395 UMP "H5'" H N N 396 UMP "H5''" H N N 397 UMP HOP2 H N N 398 UMP HOP3 H N N 399 VAL N N N N 400 VAL CA C N S 401 VAL C C N N 402 VAL O O N N 403 VAL CB C N N 404 VAL CG1 C N N 405 VAL CG2 C N N 406 VAL OXT O N N 407 VAL H H N N 408 VAL H2 H N N 409 VAL HA H N N 410 VAL HB H N N 411 VAL HG11 H N N 412 VAL HG12 H N N 413 VAL HG13 H N N 414 VAL HG21 H N N 415 VAL HG22 H N N 416 VAL HG23 H N N 417 VAL HXT H N N 418 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 IMD N1 C2 sing Y N 160 IMD N1 C5 sing Y N 161 IMD N1 HN1 sing N N 162 IMD C2 N3 doub Y N 163 IMD C2 H2 sing N N 164 IMD N3 C4 sing Y N 165 IMD N3 HN3 sing N N 166 IMD C4 C5 doub Y N 167 IMD C4 H4 sing N N 168 IMD C5 H5 sing N N 169 LEU N CA sing N N 170 LEU N H sing N N 171 LEU N H2 sing N N 172 LEU CA C sing N N 173 LEU CA CB sing N N 174 LEU CA HA sing N N 175 LEU C O doub N N 176 LEU C OXT sing N N 177 LEU CB CG sing N N 178 LEU CB HB2 sing N N 179 LEU CB HB3 sing N N 180 LEU CG CD1 sing N N 181 LEU CG CD2 sing N N 182 LEU CG HG sing N N 183 LEU CD1 HD11 sing N N 184 LEU CD1 HD12 sing N N 185 LEU CD1 HD13 sing N N 186 LEU CD2 HD21 sing N N 187 LEU CD2 HD22 sing N N 188 LEU CD2 HD23 sing N N 189 LEU OXT HXT sing N N 190 LYS N CA sing N N 191 LYS N H sing N N 192 LYS N H2 sing N N 193 LYS CA C sing N N 194 LYS CA CB sing N N 195 LYS CA HA sing N N 196 LYS C O doub N N 197 LYS C OXT sing N N 198 LYS CB CG sing N N 199 LYS CB HB2 sing N N 200 LYS CB HB3 sing N N 201 LYS CG CD sing N N 202 LYS CG HG2 sing N N 203 LYS CG HG3 sing N N 204 LYS CD CE sing N N 205 LYS CD HD2 sing N N 206 LYS CD HD3 sing N N 207 LYS CE NZ sing N N 208 LYS CE HE2 sing N N 209 LYS CE HE3 sing N N 210 LYS NZ HZ1 sing N N 211 LYS NZ HZ2 sing N N 212 LYS NZ HZ3 sing N N 213 LYS OXT HXT sing N N 214 MES O1 C2 sing N N 215 MES O1 C6 sing N N 216 MES C2 C3 sing N N 217 MES C2 H21 sing N N 218 MES C2 H22 sing N N 219 MES C3 N4 sing N N 220 MES C3 H31 sing N N 221 MES C3 H32 sing N N 222 MES N4 C5 sing N N 223 MES N4 C7 sing N N 224 MES N4 HN4 sing N N 225 MES C5 C6 sing N N 226 MES C5 H51 sing N N 227 MES C5 H52 sing N N 228 MES C6 H61 sing N N 229 MES C6 H62 sing N N 230 MES C7 C8 sing N N 231 MES C7 H71 sing N N 232 MES C7 H72 sing N N 233 MES C8 S sing N N 234 MES C8 H81 sing N N 235 MES C8 H82 sing N N 236 MES S O1S doub N N 237 MES S O2S doub N N 238 MES S O3S sing N N 239 MET N CA sing N N 240 MET N H sing N N 241 MET N H2 sing N N 242 MET CA C sing N N 243 MET CA CB sing N N 244 MET CA HA sing N N 245 MET C O doub N N 246 MET C OXT sing N N 247 MET CB CG sing N N 248 MET CB HB2 sing N N 249 MET CB HB3 sing N N 250 MET CG SD sing N N 251 MET CG HG2 sing N N 252 MET CG HG3 sing N N 253 MET SD CE sing N N 254 MET CE HE1 sing N N 255 MET CE HE2 sing N N 256 MET CE HE3 sing N N 257 MET OXT HXT sing N N 258 PHE N CA sing N N 259 PHE N H sing N N 260 PHE N H2 sing N N 261 PHE CA C sing N N 262 PHE CA CB sing N N 263 PHE CA HA sing N N 264 PHE C O doub N N 265 PHE C OXT sing N N 266 PHE CB CG sing N N 267 PHE CB HB2 sing N N 268 PHE CB HB3 sing N N 269 PHE CG CD1 doub Y N 270 PHE CG CD2 sing Y N 271 PHE CD1 CE1 sing Y N 272 PHE CD1 HD1 sing N N 273 PHE CD2 CE2 doub Y N 274 PHE CD2 HD2 sing N N 275 PHE CE1 CZ doub Y N 276 PHE CE1 HE1 sing N N 277 PHE CE2 CZ sing Y N 278 PHE CE2 HE2 sing N N 279 PHE CZ HZ sing N N 280 PHE OXT HXT sing N N 281 PRO N CA sing N N 282 PRO N CD sing N N 283 PRO N H sing N N 284 PRO CA C sing N N 285 PRO CA CB sing N N 286 PRO CA HA sing N N 287 PRO C O doub N N 288 PRO C OXT sing N N 289 PRO CB CG sing N N 290 PRO CB HB2 sing N N 291 PRO CB HB3 sing N N 292 PRO CG CD sing N N 293 PRO CG HG2 sing N N 294 PRO CG HG3 sing N N 295 PRO CD HD2 sing N N 296 PRO CD HD3 sing N N 297 PRO OXT HXT sing N N 298 SER N CA sing N N 299 SER N H sing N N 300 SER N H2 sing N N 301 SER CA C sing N N 302 SER CA CB sing N N 303 SER CA HA sing N N 304 SER C O doub N N 305 SER C OXT sing N N 306 SER CB OG sing N N 307 SER CB HB2 sing N N 308 SER CB HB3 sing N N 309 SER OG HG sing N N 310 SER OXT HXT sing N N 311 THR N CA sing N N 312 THR N H sing N N 313 THR N H2 sing N N 314 THR CA C sing N N 315 THR CA CB sing N N 316 THR CA HA sing N N 317 THR C O doub N N 318 THR C OXT sing N N 319 THR CB OG1 sing N N 320 THR CB CG2 sing N N 321 THR CB HB sing N N 322 THR OG1 HG1 sing N N 323 THR CG2 HG21 sing N N 324 THR CG2 HG22 sing N N 325 THR CG2 HG23 sing N N 326 THR OXT HXT sing N N 327 TYR N CA sing N N 328 TYR N H sing N N 329 TYR N H2 sing N N 330 TYR CA C sing N N 331 TYR CA CB sing N N 332 TYR CA HA sing N N 333 TYR C O doub N N 334 TYR C OXT sing N N 335 TYR CB CG sing N N 336 TYR CB HB2 sing N N 337 TYR CB HB3 sing N N 338 TYR CG CD1 doub Y N 339 TYR CG CD2 sing Y N 340 TYR CD1 CE1 sing Y N 341 TYR CD1 HD1 sing N N 342 TYR CD2 CE2 doub Y N 343 TYR CD2 HD2 sing N N 344 TYR CE1 CZ doub Y N 345 TYR CE1 HE1 sing N N 346 TYR CE2 CZ sing Y N 347 TYR CE2 HE2 sing N N 348 TYR CZ OH sing N N 349 TYR OH HH sing N N 350 TYR OXT HXT sing N N 351 UMP N1 C2 sing N N 352 UMP N1 C6 sing N N 353 UMP N1 "C1'" sing N N 354 UMP C2 N3 sing N N 355 UMP C2 O2 doub N N 356 UMP N3 C4 sing N N 357 UMP N3 HN3 sing N N 358 UMP C4 C5 sing N N 359 UMP C4 O4 doub N N 360 UMP C5 C6 doub N N 361 UMP C5 H5 sing N N 362 UMP C6 H6 sing N N 363 UMP "C1'" "C2'" sing N N 364 UMP "C1'" "O4'" sing N N 365 UMP "C1'" "H1'" sing N N 366 UMP "C2'" "C3'" sing N N 367 UMP "C2'" "H2'" sing N N 368 UMP "C2'" "H2''" sing N N 369 UMP "C3'" "C4'" sing N N 370 UMP "C3'" "O3'" sing N N 371 UMP "C3'" "H3'" sing N N 372 UMP "C4'" "O4'" sing N N 373 UMP "C4'" "C5'" sing N N 374 UMP "C4'" "H4'" sing N N 375 UMP "O3'" "HO3'" sing N N 376 UMP "C5'" "O5'" sing N N 377 UMP "C5'" "H5'" sing N N 378 UMP "C5'" "H5''" sing N N 379 UMP "O5'" P sing N N 380 UMP P OP1 doub N N 381 UMP P OP2 sing N N 382 UMP P OP3 sing N N 383 UMP OP2 HOP2 sing N N 384 UMP OP3 HOP3 sing N N 385 VAL N CA sing N N 386 VAL N H sing N N 387 VAL N H2 sing N N 388 VAL CA C sing N N 389 VAL CA CB sing N N 390 VAL CA HA sing N N 391 VAL C O doub N N 392 VAL C OXT sing N N 393 VAL CB CG1 sing N N 394 VAL CB CG2 sing N N 395 VAL CB HB sing N N 396 VAL CG1 HG11 sing N N 397 VAL CG1 HG12 sing N N 398 VAL CG1 HG13 sing N N 399 VAL CG2 HG21 sing N N 400 VAL CG2 HG22 sing N N 401 VAL CG2 HG23 sing N N 402 VAL OXT HXT sing N N 403 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 75N93022C00036 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code AF-J3KAP5-F1 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 39PE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.013065 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013065 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005678 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N O P S # loop_ # loop_ #