data_3A7S # _entry.id 3A7S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3A7S pdb_00003a7s 10.2210/pdb3a7s/pdb RCSB RCSB028918 ? ? WWPDB D_1000028918 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3A7S _pdbx_database_status.recvd_initial_deposition_date 2009-10-04 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nishio, K.' 1 'Kim, S.W.' 2 'Kawai, K.' 3 'Mizushima, T.' 4 'Yamane, T.' 5 'Hamazaki, J.' 6 'Murata, S.' 7 'Tanaka, K.' 8 # _citation.id primary _citation.title 'Crystal structure of the de-ubiquitinating enzyme UCH37 (human UCH-L5) catalytic domain' _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year 2009 _citation.journal_id_ASTM BBRCA9 _citation.country US _citation.journal_id_ISSN 1090-2104 _citation.journal_id_CSD 0146 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19836345 _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2009.10.062 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nishio, K.' 1 ? primary 'Kim, S.W.' 2 ? primary 'Kawai, K.' 3 ? primary 'Mizushima, T.' 4 ? primary 'Yamane, T.' 5 ? primary 'Hamazaki, J.' 6 ? primary 'Murata, S.' 7 ? primary 'Tanaka, K.' 8 ? primary 'Morimoto, Y.' 9 ? # _cell.entry_id 3A7S _cell.length_a 67.583 _cell.length_b 57.064 _cell.length_c 48.736 _cell.angle_alpha 90.00 _cell.angle_beta 100.91 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3A7S _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ubiquitin carboxyl-terminal hydrolase isozyme L5' 25667.932 1 3.4.19.12 C88A 'CATALYTIC DOMAIN, UNP residues 1-228' ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 water nat water 18.015 10 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'UCH-L5, Ubiquitin thioesterase L5, Ubiquitin C-terminal hydrolase UCH37' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFA KQVINNAAATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEE DAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK ; _entity_poly.pdbx_seq_one_letter_code_can ;MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFA KQVINNAAATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEE DAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 GLY n 1 4 ASN n 1 5 ALA n 1 6 GLY n 1 7 GLU n 1 8 TRP n 1 9 CYS n 1 10 LEU n 1 11 MET n 1 12 GLU n 1 13 SER n 1 14 ASP n 1 15 PRO n 1 16 GLY n 1 17 VAL n 1 18 PHE n 1 19 THR n 1 20 GLU n 1 21 LEU n 1 22 ILE n 1 23 LYS n 1 24 GLY n 1 25 PHE n 1 26 GLY n 1 27 CYS n 1 28 ARG n 1 29 GLY n 1 30 ALA n 1 31 GLN n 1 32 VAL n 1 33 GLU n 1 34 GLU n 1 35 ILE n 1 36 TRP n 1 37 SER n 1 38 LEU n 1 39 GLU n 1 40 PRO n 1 41 GLU n 1 42 ASN n 1 43 PHE n 1 44 GLU n 1 45 LYS n 1 46 LEU n 1 47 LYS n 1 48 PRO n 1 49 VAL n 1 50 HIS n 1 51 GLY n 1 52 LEU n 1 53 ILE n 1 54 PHE n 1 55 LEU n 1 56 PHE n 1 57 LYS n 1 58 TRP n 1 59 GLN n 1 60 PRO n 1 61 GLY n 1 62 GLU n 1 63 GLU n 1 64 PRO n 1 65 ALA n 1 66 GLY n 1 67 SER n 1 68 VAL n 1 69 VAL n 1 70 GLN n 1 71 ASP n 1 72 SER n 1 73 ARG n 1 74 LEU n 1 75 ASP n 1 76 THR n 1 77 ILE n 1 78 PHE n 1 79 PHE n 1 80 ALA n 1 81 LYS n 1 82 GLN n 1 83 VAL n 1 84 ILE n 1 85 ASN n 1 86 ASN n 1 87 ALA n 1 88 ALA n 1 89 ALA n 1 90 THR n 1 91 GLN n 1 92 ALA n 1 93 ILE n 1 94 VAL n 1 95 SER n 1 96 VAL n 1 97 LEU n 1 98 LEU n 1 99 ASN n 1 100 CYS n 1 101 THR n 1 102 HIS n 1 103 GLN n 1 104 ASP n 1 105 VAL n 1 106 HIS n 1 107 LEU n 1 108 GLY n 1 109 GLU n 1 110 THR n 1 111 LEU n 1 112 SER n 1 113 GLU n 1 114 PHE n 1 115 LYS n 1 116 GLU n 1 117 PHE n 1 118 SER n 1 119 GLN n 1 120 SER n 1 121 PHE n 1 122 ASP n 1 123 ALA n 1 124 ALA n 1 125 MET n 1 126 LYS n 1 127 GLY n 1 128 LEU n 1 129 ALA n 1 130 LEU n 1 131 SER n 1 132 ASN n 1 133 SER n 1 134 ASP n 1 135 VAL n 1 136 ILE n 1 137 ARG n 1 138 GLN n 1 139 VAL n 1 140 HIS n 1 141 ASN n 1 142 SER n 1 143 PHE n 1 144 ALA n 1 145 ARG n 1 146 GLN n 1 147 GLN n 1 148 MET n 1 149 PHE n 1 150 GLU n 1 151 PHE n 1 152 ASP n 1 153 THR n 1 154 LYS n 1 155 THR n 1 156 SER n 1 157 ALA n 1 158 LYS n 1 159 GLU n 1 160 GLU n 1 161 ASP n 1 162 ALA n 1 163 PHE n 1 164 HIS n 1 165 PHE n 1 166 VAL n 1 167 SER n 1 168 TYR n 1 169 VAL n 1 170 PRO n 1 171 VAL n 1 172 ASN n 1 173 GLY n 1 174 ARG n 1 175 LEU n 1 176 TYR n 1 177 GLU n 1 178 LEU n 1 179 ASP n 1 180 GLY n 1 181 LEU n 1 182 ARG n 1 183 GLU n 1 184 GLY n 1 185 PRO n 1 186 ILE n 1 187 ASP n 1 188 LEU n 1 189 GLY n 1 190 ALA n 1 191 CYS n 1 192 ASN n 1 193 GLN n 1 194 ASP n 1 195 ASP n 1 196 TRP n 1 197 ILE n 1 198 SER n 1 199 ALA n 1 200 VAL n 1 201 ARG n 1 202 PRO n 1 203 VAL n 1 204 ILE n 1 205 GLU n 1 206 LYS n 1 207 ARG n 1 208 ILE n 1 209 GLN n 1 210 LYS n 1 211 TYR n 1 212 SER n 1 213 GLU n 1 214 GLY n 1 215 GLU n 1 216 ILE n 1 217 ARG n 1 218 PHE n 1 219 ASN n 1 220 LEU n 1 221 MET n 1 222 ALA n 1 223 ILE n 1 224 VAL n 1 225 SER n 1 226 ASP n 1 227 ARG n 1 228 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene UCH37 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-6P _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UCHL5_HUMAN _struct_ref.pdbx_db_accession Q9Y5K5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFA KQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEE DAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3A7S _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 228 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y5K5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 228 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 228 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 3A7S _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 88 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9Y5K5 _struct_ref_seq_dif.db_mon_id CYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 88 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 88 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3A7S _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # loop_ _exptl_crystal.id _exptl_crystal.density_meas _exptl_crystal.density_Matthews _exptl_crystal.density_percent_sol _exptl_crystal.description _exptl_crystal.F_000 _exptl_crystal.preparation 1 ? ? ? ? ? ? 2 ? ? ? ? ? ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pdbx_details '22% PEG 4000, 0.2M Magnesium chloride, 0.1M Tris-HCl, 3.5% Xylitol, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range ? # loop_ _diffrn.id _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.crystal_id 1 100 ? 2 2 100 ? 1 # loop_ _diffrn_detector.diffrn_id _diffrn_detector.detector _diffrn_detector.type _diffrn_detector.pdbx_collection_date _diffrn_detector.details 1 CCD 'Bruker DIP-6040' 2008-05-22 mirrors 2 CCD 'Bruker DIP-6040' 2009-02-17 ? # loop_ _diffrn_radiation.diffrn_id _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.monochromator _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_scattering_type 1 1 M double-crystal 'SINGLE WAVELENGTH' x-ray 2 2 M ? MAD x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9 1.0 2 0.97914 1.0 3 0.97946 1.0 4 0.96422 1.0 # loop_ _diffrn_source.diffrn_id _diffrn_source.source _diffrn_source.type _diffrn_source.pdbx_synchrotron_site _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_wavelength_list 1 SYNCHROTRON 'SPRING-8 BEAMLINE BL44XU' SPring-8 BL44XU ? 0.9 2 SYNCHROTRON 'SPRING-8 BEAMLINE BL44XU' SPring-8 BL44XU ? '0.97914, 0.97946, 0.96422' # _reflns.entry_id 3A7S _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 2.20 _reflns.number_obs 9161 _reflns.number_all 9366 _reflns.percent_possible_obs 97.8 _reflns.pdbx_Rmerge_I_obs 0.11 _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate 38.9 _reflns.pdbx_redundancy 3.4 _reflns.pdbx_netI_over_sigmaI 18.36 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1,2 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.20 _reflns_shell.d_res_low 2.28 _reflns_shell.percent_possible_all 95.9 _reflns_shell.Rmerge_I_obs 0.409 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 2.8 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 880 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3A7S _refine.ls_number_reflns_obs 9089 _refine.ls_number_reflns_all 9308 _refine.pdbx_ls_sigma_I 0 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 1328807.93 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.93 _refine.ls_d_res_high 2.20 _refine.ls_percent_reflns_obs 97.6 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.205 _refine.ls_R_factor_R_free 0.255 _refine.ls_R_factor_R_free_error 0.012 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.2 _refine.ls_number_reflns_R_free 471 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 57.2 _refine.aniso_B[1][1] -13.02 _refine.aniso_B[2][2] 0.55 _refine.aniso_B[3][3] 12.47 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -1.11 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.4 _refine.solvent_model_param_bsol 67.8346 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'BULK SOLVENT MODEL USED' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3A7S _refine_analyze.Luzzati_coordinate_error_obs 0.28 _refine_analyze.Luzzati_sigma_a_obs 0.25 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.36 _refine_analyze.Luzzati_sigma_a_free 0.32 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1615 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 1626 _refine_hist.d_res_high 2.20 _refine_hist.d_res_low 19.93 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.4 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 23.7 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.94 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.20 _refine_ls_shell.d_res_low 2.34 _refine_ls_shell.number_reflns_R_work 1387 _refine_ls_shell.R_factor_R_work 0.270 _refine_ls_shell.percent_reflns_obs 95.1 _refine_ls_shell.R_factor_R_free 0.327 _refine_ls_shell.R_factor_R_free_error 0.038 _refine_ls_shell.percent_reflns_R_free 5.1 _refine_ls_shell.number_reflns_R_free 74 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 1461 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.pdbx_refine_id _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file 'X-RAY DIFFRACTION' 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 water_rep.param water.top 'X-RAY DIFFRACTION' 3 ion.param ion.top # _struct.entry_id 3A7S _struct.title 'Catalytic domain of UCH37' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3A7S _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;ubiquitin-proteasome pathway, Alternative splicing, Hydrolase, Polymorphism, Protease, Proteasome, Thiol protease, Ubl conjugation pathway ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 14 ? PHE A 25 ? ASP A 14 PHE A 25 1 ? 12 HELX_P HELX_P2 2 GLU A 39 ? LYS A 45 ? GLU A 39 LYS A 45 1 ? 7 HELX_P HELX_P3 3 ILE A 84 ? ASN A 86 ? ILE A 84 ASN A 86 5 ? 3 HELX_P HELX_P4 4 ALA A 87 ? LEU A 98 ? ALA A 87 LEU A 98 1 ? 12 HELX_P HELX_P5 5 GLY A 108 ? GLN A 119 ? GLY A 108 GLN A 119 1 ? 12 HELX_P HELX_P6 6 ASP A 122 ? ASN A 132 ? ASP A 122 ASN A 132 1 ? 11 HELX_P HELX_P7 7 SER A 133 ? ALA A 144 ? SER A 133 ALA A 144 1 ? 12 HELX_P HELX_P8 8 ASN A 192 ? ASP A 195 ? ASN A 192 ASP A 195 5 ? 4 HELX_P HELX_P9 9 TRP A 196 ? GLY A 214 ? TRP A 196 GLY A 214 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 47 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 47 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 48 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 48 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.05 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 31 ? ILE A 35 ? GLN A 31 ILE A 35 A 2 PHE A 218 ? VAL A 224 ? PHE A 218 VAL A 224 A 3 VAL A 49 ? PHE A 56 ? VAL A 49 PHE A 56 A 4 HIS A 164 ? VAL A 171 ? HIS A 164 VAL A 171 A 5 ARG A 174 ? LEU A 178 ? ARG A 174 LEU A 178 A 6 ILE A 186 ? ALA A 190 ? ILE A 186 ALA A 190 A 7 SER A 67 ? VAL A 68 ? SER A 67 VAL A 68 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 35 ? N ILE A 35 O LEU A 220 ? O LEU A 220 A 2 3 O MET A 221 ? O MET A 221 N ILE A 53 ? N ILE A 53 A 3 4 N PHE A 54 ? N PHE A 54 O VAL A 166 ? O VAL A 166 A 4 5 N VAL A 171 ? N VAL A 171 O ARG A 174 ? O ARG A 174 A 5 6 N LEU A 175 ? N LEU A 175 O LEU A 188 ? O LEU A 188 A 6 7 O ASP A 187 ? O ASP A 187 N SER A 67 ? N SER A 67 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CL _struct_site.pdbx_auth_seq_id 300 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE CL A 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 LYS A 23 ? LYS A 23 . ? 4_556 ? 2 AC1 2 ASN A 85 ? ASN A 85 . ? 1_555 ? # _database_PDB_matrix.entry_id 3A7S _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3A7S _atom_sites.fract_transf_matrix[1][1] 0.014797 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002851 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017524 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020896 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 ASN 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 GLY 6 6 ? ? ? A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 TRP 8 8 8 TRP TRP A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 TRP 58 58 58 TRP TRP A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 CYS 100 100 100 CYS CYS A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 MET 125 125 125 MET MET A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 HIS 140 140 140 HIS HIS A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 GLN 146 146 ? ? ? A . n A 1 147 GLN 147 147 ? ? ? A . n A 1 148 MET 148 148 ? ? ? A . n A 1 149 PHE 149 149 ? ? ? A . n A 1 150 GLU 150 150 ? ? ? A . n A 1 151 PHE 151 151 ? ? ? A . n A 1 152 ASP 152 152 ? ? ? A . n A 1 153 THR 153 153 ? ? ? A . n A 1 154 LYS 154 154 ? ? ? A . n A 1 155 THR 155 155 ? ? ? A . n A 1 156 SER 156 156 ? ? ? A . n A 1 157 ALA 157 157 ? ? ? A . n A 1 158 LYS 158 158 ? ? ? A . n A 1 159 GLU 159 159 ? ? ? A . n A 1 160 GLU 160 160 ? ? ? A . n A 1 161 ASP 161 161 ? ? ? A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 PHE 163 163 163 PHE PHE A . n A 1 164 HIS 164 164 164 HIS HIS A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 SER 167 167 167 SER SER A . n A 1 168 TYR 168 168 168 TYR TYR A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 PRO 170 170 170 PRO PRO A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 ASN 172 172 172 ASN ASN A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 ARG 174 174 174 ARG ARG A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 TYR 176 176 176 TYR TYR A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 ARG 182 182 182 ARG ARG A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 ASP 187 187 187 ASP ASP A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 CYS 191 191 191 CYS CYS A . n A 1 192 ASN 192 192 192 ASN ASN A . n A 1 193 GLN 193 193 193 GLN GLN A . n A 1 194 ASP 194 194 194 ASP ASP A . n A 1 195 ASP 195 195 195 ASP ASP A . n A 1 196 TRP 196 196 196 TRP TRP A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 SER 198 198 198 SER SER A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 ARG 201 201 201 ARG ARG A . n A 1 202 PRO 202 202 202 PRO PRO A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 ILE 204 204 204 ILE ILE A . n A 1 205 GLU 205 205 205 GLU GLU A . n A 1 206 LYS 206 206 206 LYS LYS A . n A 1 207 ARG 207 207 207 ARG ARG A . n A 1 208 ILE 208 208 208 ILE ILE A . n A 1 209 GLN 209 209 209 GLN GLN A . n A 1 210 LYS 210 210 210 LYS LYS A . n A 1 211 TYR 211 211 211 TYR TYR A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 GLU 213 213 213 GLU GLU A . n A 1 214 GLY 214 214 214 GLY GLY A . n A 1 215 GLU 215 215 215 GLU GLU A . n A 1 216 ILE 216 216 216 ILE ILE A . n A 1 217 ARG 217 217 217 ARG ARG A . n A 1 218 PHE 218 218 218 PHE PHE A . n A 1 219 ASN 219 219 219 ASN ASN A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 MET 221 221 221 MET MET A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 ILE 223 223 223 ILE ILE A . n A 1 224 VAL 224 224 224 VAL VAL A . n A 1 225 SER 225 225 225 SER SER A . n A 1 226 ASP 226 226 226 ASP ASP A . n A 1 227 ARG 227 227 ? ? ? A . n A 1 228 LYS 228 228 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 300 300 CL CL A . C 3 HOH 1 301 301 HOH WAT A . C 3 HOH 2 302 302 HOH WAT A . C 3 HOH 3 303 303 HOH WAT A . C 3 HOH 4 304 304 HOH WAT A . C 3 HOH 5 305 305 HOH WAT A . C 3 HOH 6 306 306 HOH WAT A . C 3 HOH 7 307 307 HOH WAT A . C 3 HOH 8 308 308 HOH WAT A . C 3 HOH 9 309 309 HOH WAT A . C 3 HOH 10 310 310 HOH WAT A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C 2 1,2 A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 1350 ? 2 MORE -11 ? 2 'SSA (A^2)' 18380 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 -9.2241079459 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 47.8551306403 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-11-03 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' struct_ref_seq_dif 3 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_ref_seq_dif.details' 4 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 PHENIX 'model building' 2.13 ? 2 CNS refinement 1.2 ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 PHENIX phasing 2.13 ? 6 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 69 ? ? -58.82 81.45 2 1 GLN A 70 ? ? -55.99 -88.55 3 1 SER A 72 ? ? -167.21 -114.15 4 1 ARG A 73 ? ? -83.84 39.64 5 1 VAL A 83 ? ? -126.78 -64.90 6 1 ALA A 144 ? ? -96.15 56.92 7 1 GLN A 193 ? ? -34.24 -77.08 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A ASN 4 ? A ASN 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A GLY 6 ? A GLY 6 7 1 Y 1 A GLN 146 ? A GLN 146 8 1 Y 1 A GLN 147 ? A GLN 147 9 1 Y 1 A MET 148 ? A MET 148 10 1 Y 1 A PHE 149 ? A PHE 149 11 1 Y 1 A GLU 150 ? A GLU 150 12 1 Y 1 A PHE 151 ? A PHE 151 13 1 Y 1 A ASP 152 ? A ASP 152 14 1 Y 1 A THR 153 ? A THR 153 15 1 Y 1 A LYS 154 ? A LYS 154 16 1 Y 1 A THR 155 ? A THR 155 17 1 Y 1 A SER 156 ? A SER 156 18 1 Y 1 A ALA 157 ? A ALA 157 19 1 Y 1 A LYS 158 ? A LYS 158 20 1 Y 1 A GLU 159 ? A GLU 159 21 1 Y 1 A GLU 160 ? A GLU 160 22 1 Y 1 A ASP 161 ? A ASP 161 23 1 Y 1 A ARG 227 ? A ARG 227 24 1 Y 1 A LYS 228 ? A LYS 228 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH #