data_3AC3 # _entry.id 3AC3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3AC3 RCSB RCSB029069 WWPDB D_1000029069 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3LCK ;STRUCTURAL BASIS FOR ACTIVATION OF HUMAN LYMPHOCYTE KINASE LCK UPON TYROSINE PHOSPHORYLATION NATURE VOL. 384, 484, 1996 ; unspecified PDB 3AC1 . unspecified PDB 3AC2 . unspecified PDB 3AC4 . unspecified PDB 3AC5 . unspecified PDB 3AC8 . unspecified PDB 3ACJ . unspecified PDB 3ACK . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3AC3 _pdbx_database_status.recvd_initial_deposition_date 2009-12-28 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # _audit_author.name 'Tsuji, E.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Ab initio fragment molecular orbital study of ligand binding to leukocyte-specific protein tyrosine (LCK) kinase' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ozawa, M.' 1 primary 'Ozawa, T.' 2 primary 'Tsuji, E.' 3 primary 'Okazaki, K.' 4 primary 'Takeda, K.' 5 # _cell.entry_id 3AC3 _cell.length_a 42.213 _cell.length_b 73.730 _cell.length_c 92.674 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3AC3 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Proto-oncogene tyrosine-protein kinase LCK' 33065.602 1 2.7.10.2 ? 'UNP RESIDUES 225-509' ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 non-polymer syn '2-[(3,5-dimethoxyphenyl)amino]-5-ethyl-7-[(2R)-2-(hydroxymethyl)pyrrolidin-1-yl]pyrazolo[1,5-a]pyrimidine-3-carboxamide' 440.496 1 ? ? ? ? 4 water nat water 18.015 135 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'LYMPHOCYTE KINASE, LCK, Lymphocyte cell-specific protein-tyrosine kinase, p56-LCK, LSK, T cell-specific protein-tyrosine kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;QTQKPQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLY AVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFG LARLIEDNE(PTR)TAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMV RPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQPQP ; _entity_poly.pdbx_seq_one_letter_code_can ;QTQKPQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLY AVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFG LARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDN CPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQPQP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 THR n 1 3 GLN n 1 4 LYS n 1 5 PRO n 1 6 GLN n 1 7 LYS n 1 8 PRO n 1 9 TRP n 1 10 TRP n 1 11 GLU n 1 12 ASP n 1 13 GLU n 1 14 TRP n 1 15 GLU n 1 16 VAL n 1 17 PRO n 1 18 ARG n 1 19 GLU n 1 20 THR n 1 21 LEU n 1 22 LYS n 1 23 LEU n 1 24 VAL n 1 25 GLU n 1 26 ARG n 1 27 LEU n 1 28 GLY n 1 29 ALA n 1 30 GLY n 1 31 GLN n 1 32 PHE n 1 33 GLY n 1 34 GLU n 1 35 VAL n 1 36 TRP n 1 37 MET n 1 38 GLY n 1 39 TYR n 1 40 TYR n 1 41 ASN n 1 42 GLY n 1 43 HIS n 1 44 THR n 1 45 LYS n 1 46 VAL n 1 47 ALA n 1 48 VAL n 1 49 LYS n 1 50 SER n 1 51 LEU n 1 52 LYS n 1 53 GLN n 1 54 GLY n 1 55 SER n 1 56 MET n 1 57 SER n 1 58 PRO n 1 59 ASP n 1 60 ALA n 1 61 PHE n 1 62 LEU n 1 63 ALA n 1 64 GLU n 1 65 ALA n 1 66 ASN n 1 67 LEU n 1 68 MET n 1 69 LYS n 1 70 GLN n 1 71 LEU n 1 72 GLN n 1 73 HIS n 1 74 GLN n 1 75 ARG n 1 76 LEU n 1 77 VAL n 1 78 ARG n 1 79 LEU n 1 80 TYR n 1 81 ALA n 1 82 VAL n 1 83 VAL n 1 84 THR n 1 85 GLN n 1 86 GLU n 1 87 PRO n 1 88 ILE n 1 89 TYR n 1 90 ILE n 1 91 ILE n 1 92 THR n 1 93 GLU n 1 94 TYR n 1 95 MET n 1 96 GLU n 1 97 ASN n 1 98 GLY n 1 99 SER n 1 100 LEU n 1 101 VAL n 1 102 ASP n 1 103 PHE n 1 104 LEU n 1 105 LYS n 1 106 THR n 1 107 PRO n 1 108 SER n 1 109 GLY n 1 110 ILE n 1 111 LYS n 1 112 LEU n 1 113 THR n 1 114 ILE n 1 115 ASN n 1 116 LYS n 1 117 LEU n 1 118 LEU n 1 119 ASP n 1 120 MET n 1 121 ALA n 1 122 ALA n 1 123 GLN n 1 124 ILE n 1 125 ALA n 1 126 GLU n 1 127 GLY n 1 128 MET n 1 129 ALA n 1 130 PHE n 1 131 ILE n 1 132 GLU n 1 133 GLU n 1 134 ARG n 1 135 ASN n 1 136 TYR n 1 137 ILE n 1 138 HIS n 1 139 ARG n 1 140 ASP n 1 141 LEU n 1 142 ARG n 1 143 ALA n 1 144 ALA n 1 145 ASN n 1 146 ILE n 1 147 LEU n 1 148 VAL n 1 149 SER n 1 150 ASP n 1 151 THR n 1 152 LEU n 1 153 SER n 1 154 CYS n 1 155 LYS n 1 156 ILE n 1 157 ALA n 1 158 ASP n 1 159 PHE n 1 160 GLY n 1 161 LEU n 1 162 ALA n 1 163 ARG n 1 164 LEU n 1 165 ILE n 1 166 GLU n 1 167 ASP n 1 168 ASN n 1 169 GLU n 1 170 PTR n 1 171 THR n 1 172 ALA n 1 173 ARG n 1 174 GLU n 1 175 GLY n 1 176 ALA n 1 177 LYS n 1 178 PHE n 1 179 PRO n 1 180 ILE n 1 181 LYS n 1 182 TRP n 1 183 THR n 1 184 ALA n 1 185 PRO n 1 186 GLU n 1 187 ALA n 1 188 ILE n 1 189 ASN n 1 190 TYR n 1 191 GLY n 1 192 THR n 1 193 PHE n 1 194 THR n 1 195 ILE n 1 196 LYS n 1 197 SER n 1 198 ASP n 1 199 VAL n 1 200 TRP n 1 201 SER n 1 202 PHE n 1 203 GLY n 1 204 ILE n 1 205 LEU n 1 206 LEU n 1 207 THR n 1 208 GLU n 1 209 ILE n 1 210 VAL n 1 211 THR n 1 212 HIS n 1 213 GLY n 1 214 ARG n 1 215 ILE n 1 216 PRO n 1 217 TYR n 1 218 PRO n 1 219 GLY n 1 220 MET n 1 221 THR n 1 222 ASN n 1 223 PRO n 1 224 GLU n 1 225 VAL n 1 226 ILE n 1 227 GLN n 1 228 ASN n 1 229 LEU n 1 230 GLU n 1 231 ARG n 1 232 GLY n 1 233 TYR n 1 234 ARG n 1 235 MET n 1 236 VAL n 1 237 ARG n 1 238 PRO n 1 239 ASP n 1 240 ASN n 1 241 CYS n 1 242 PRO n 1 243 GLU n 1 244 GLU n 1 245 LEU n 1 246 TYR n 1 247 GLN n 1 248 LEU n 1 249 MET n 1 250 ARG n 1 251 LEU n 1 252 CYS n 1 253 TRP n 1 254 LYS n 1 255 GLU n 1 256 ARG n 1 257 PRO n 1 258 GLU n 1 259 ASP n 1 260 ARG n 1 261 PRO n 1 262 THR n 1 263 PHE n 1 264 ASP n 1 265 TYR n 1 266 LEU n 1 267 ARG n 1 268 SER n 1 269 VAL n 1 270 LEU n 1 271 GLU n 1 272 ASP n 1 273 PHE n 1 274 PHE n 1 275 THR n 1 276 ALA n 1 277 THR n 1 278 GLU n 1 279 GLY n 1 280 GLN n 1 281 TYR n 1 282 GLN n 1 283 PRO n 1 284 GLN n 1 285 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene LCK _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain SF9 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type BACULOVIRUS _entity_src_gen.pdbx_host_org_vector PET-19B _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LCK_HUMAN _struct_ref.pdbx_db_accession P06239 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QTQKPQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLY AVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFG LARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDN CPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQPQP ; _struct_ref.pdbx_align_begin 225 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3AC3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 285 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P06239 _struct_ref_seq.db_align_beg 225 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 509 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 225 _struct_ref_seq.pdbx_auth_seq_align_end 509 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 KSH non-polymer . '2-[(3,5-dimethoxyphenyl)amino]-5-ethyl-7-[(2R)-2-(hydroxymethyl)pyrrolidin-1-yl]pyrazolo[1,5-a]pyrimidine-3-carboxamide' ? 'C22 H28 N6 O4' 440.496 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3AC3 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.18 _exptl_crystal.density_percent_sol 43.60 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details '0.2M (NH4)2SO4, 0.1M SODIUM CACODYLATE, 30% PEG 8000, 5.2% MPD, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'RIGAKU JUPITER 210' _diffrn_detector.pdbx_collection_date 2002-12-05 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL32B2' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL32B2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 3AC3 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 28.74 _reflns.d_resolution_high 2.55 _reflns.number_obs 9733 _reflns.number_all 9707 _reflns.percent_possible_obs 98.2 _reflns.pdbx_Rmerge_I_obs 0.165 _reflns.pdbx_Rsym_value 0.198 _reflns.B_iso_Wilson_estimate 27.9 _reflns.pdbx_redundancy 3.3 _reflns.pdbx_netI_over_sigmaI 8.0 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.55 _reflns_shell.d_res_low 2.69 _reflns_shell.percent_possible_all 99.9 _reflns_shell.Rmerge_I_obs 0.302 _reflns_shell.pdbx_Rsym_value 0.357 _reflns_shell.meanI_over_sigI_obs 3.5 _reflns_shell.pdbx_redundancy 3.5 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1414 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3AC3 _refine.ls_number_reflns_obs 8589 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10.00 _refine.ls_d_res_high 2.55 _refine.ls_percent_reflns_obs 98.23 _refine.ls_R_factor_obs 0.20854 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.20103 _refine.ls_R_factor_R_free 0.27430 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.1 _refine.ls_number_reflns_R_free 962 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.907 _refine.correlation_coeff_Fo_to_Fc_free 0.823 _refine.B_iso_mean 8.428 _refine.aniso_B[1][1] -0.60 _refine.aniso_B[2][2] 0.65 _refine.aniso_B[3][3] -0.05 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 3LCK' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.384 _refine.overall_SU_ML 0.256 _refine.overall_SU_B 11.516 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2210 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 42 _refine_hist.number_atoms_solvent 135 _refine_hist.number_atoms_total 2387 _refine_hist.d_res_high 2.55 _refine_hist.d_res_low 10.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.004 0.022 ? 2307 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.008 1.985 ? 3135 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 4.744 5.000 ? 270 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 32.482 23.761 ? 109 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 12.705 15.000 ? 395 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 15.188 15.000 ? 17 'X-RAY DIFFRACTION' ? r_chiral_restr 0.072 0.200 ? 333 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.004 0.021 ? 1754 'X-RAY DIFFRACTION' ? r_mcbond_it 0.696 1.500 ? 1353 'X-RAY DIFFRACTION' ? r_mcangle_it 1.331 2.000 ? 2192 'X-RAY DIFFRACTION' ? r_scbond_it 2.121 3.000 ? 954 'X-RAY DIFFRACTION' ? r_scangle_it 3.487 4.500 ? 943 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.550 _refine_ls_shell.d_res_low 2.612 _refine_ls_shell.number_reflns_R_work 609 _refine_ls_shell.R_factor_R_work 0.283 _refine_ls_shell.percent_reflns_obs 99.70 _refine_ls_shell.R_factor_R_free 0.403 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 63 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3AC3 _struct.title 'Crystal structure of pyrazolo pyrimidine derivative bound to the kinase domain of human LCK, (auto-phosphorylated on TYR394)' _struct.pdbx_descriptor 'Proto-oncogene tyrosine-protein kinase LCK (E.C.2.7.10.2)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3AC3 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;TYROSINE-PROTEIN KINASE, ATP-BINDING, PHOSPHORYLATION, SIGNAL TRANSDUCTION, ALTERNATIVE SPLICING, KINASE, SH2 DOMAIN, SH3 DOMAIN, TRANSFERASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 17 ? GLU A 19 ? PRO A 241 GLU A 243 5 ? 3 HELX_P HELX_P2 2 SER A 57 ? LYS A 69 ? SER A 281 LYS A 293 1 ? 13 HELX_P HELX_P3 3 LEU A 100 ? LEU A 104 ? LEU A 324 LEU A 328 1 ? 5 HELX_P HELX_P4 4 THR A 106 ? LYS A 111 ? THR A 330 LYS A 335 1 ? 6 HELX_P HELX_P5 5 THR A 113 ? ARG A 134 ? THR A 337 ARG A 358 1 ? 22 HELX_P HELX_P6 6 ARG A 142 ? ALA A 144 ? ARG A 366 ALA A 368 5 ? 3 HELX_P HELX_P7 7 ALA A 184 ? GLY A 191 ? ALA A 408 GLY A 415 1 ? 8 HELX_P HELX_P8 8 THR A 194 ? THR A 211 ? THR A 418 THR A 435 1 ? 18 HELX_P HELX_P9 9 THR A 221 ? ARG A 231 ? THR A 445 ARG A 455 1 ? 11 HELX_P HELX_P10 10 PRO A 242 ? TRP A 253 ? PRO A 466 TRP A 477 1 ? 12 HELX_P HELX_P11 11 ARG A 256 ? ARG A 260 ? ARG A 480 ARG A 484 5 ? 5 HELX_P HELX_P12 12 THR A 262 ? THR A 277 ? THR A 486 THR A 501 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A GLU 169 C ? ? ? 1_555 A PTR 170 N ? ? A GLU 393 A PTR 394 1_555 ? ? ? ? ? ? ? 1.334 ? covale2 covale ? ? A PTR 170 C ? ? ? 1_555 A THR 171 N ? ? A PTR 394 A THR 395 1_555 ? ? ? ? ? ? ? 1.331 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 86 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 310 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 87 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 311 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.64 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 3 ? C ? 2 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 21 ? GLY A 30 ? LEU A 245 GLY A 254 A 2 GLY A 33 ? TYR A 40 ? GLY A 257 TYR A 264 A 3 THR A 44 ? LEU A 51 ? THR A 268 LEU A 275 A 4 TYR A 89 ? GLU A 93 ? TYR A 313 GLU A 317 A 5 LEU A 79 ? VAL A 83 ? LEU A 303 VAL A 307 B 1 GLY A 98 ? SER A 99 ? GLY A 322 SER A 323 B 2 ILE A 146 ? VAL A 148 ? ILE A 370 VAL A 372 B 3 CYS A 154 ? ILE A 156 ? CYS A 378 ILE A 380 C 1 TYR A 136 ? ILE A 137 ? TYR A 360 ILE A 361 C 2 ARG A 163 ? LEU A 164 ? ARG A 387 LEU A 388 D 1 PTR A 170 ? THR A 171 ? PTR A 394 THR A 395 D 2 THR A 192 ? PHE A 193 ? THR A 416 PHE A 417 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 27 ? N LEU A 251 O VAL A 35 ? O VAL A 259 A 2 3 N TRP A 36 ? N TRP A 260 O VAL A 48 ? O VAL A 272 A 3 4 N LYS A 49 ? N LYS A 273 O ILE A 90 ? O ILE A 314 A 4 5 O ILE A 91 ? O ILE A 315 N TYR A 80 ? N TYR A 304 B 1 2 N GLY A 98 ? N GLY A 322 O VAL A 148 ? O VAL A 372 B 2 3 N LEU A 147 ? N LEU A 371 O LYS A 155 ? O LYS A 379 C 1 2 N ILE A 137 ? N ILE A 361 O ARG A 163 ? O ARG A 387 D 1 2 N PTR A 170 ? N PTR A 394 O PHE A 193 ? O PHE A 417 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 A 1' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 510' AC3 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE KSH A 511' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 HOH E . ? HOH A 11 . ? 1_555 ? 2 AC1 7 GLN A 74 ? GLN A 298 . ? 1_555 ? 3 AC1 7 ARG A 75 ? ARG A 299 . ? 1_555 ? 4 AC1 7 SER A 153 ? SER A 377 . ? 1_555 ? 5 AC1 7 LYS A 155 ? LYS A 379 . ? 1_555 ? 6 AC1 7 ARG A 234 ? ARG A 458 . ? 3_544 ? 7 AC1 7 ARG A 250 ? ARG A 474 . ? 3_544 ? 8 AC2 4 TYR A 39 ? TYR A 263 . ? 3_554 ? 9 AC2 4 GLY A 42 ? GLY A 266 . ? 3_554 ? 10 AC2 4 HIS A 43 ? HIS A 267 . ? 3_554 ? 11 AC2 4 TYR A 265 ? TYR A 489 . ? 1_555 ? 12 AC3 9 LEU A 27 ? LEU A 251 . ? 1_555 ? 13 AC3 9 GLU A 93 ? GLU A 317 . ? 1_555 ? 14 AC3 9 TYR A 94 ? TYR A 318 . ? 1_555 ? 15 AC3 9 MET A 95 ? MET A 319 . ? 1_555 ? 16 AC3 9 GLU A 96 ? GLU A 320 . ? 1_555 ? 17 AC3 9 GLY A 98 ? GLY A 322 . ? 1_555 ? 18 AC3 9 SER A 99 ? SER A 323 . ? 1_555 ? 19 AC3 9 ASP A 102 ? ASP A 326 . ? 1_555 ? 20 AC3 9 LEU A 147 ? LEU A 371 . ? 1_555 ? # _database_PDB_matrix.entry_id 3AC3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3AC3 _atom_sites.fract_transf_matrix[1][1] 0.023690 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013563 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010791 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 225 ? ? ? A . n A 1 2 THR 2 226 ? ? ? A . n A 1 3 GLN 3 227 ? ? ? A . n A 1 4 LYS 4 228 ? ? ? A . n A 1 5 PRO 5 229 ? ? ? A . n A 1 6 GLN 6 230 ? ? ? A . n A 1 7 LYS 7 231 231 LYS LYS A . n A 1 8 PRO 8 232 232 PRO PRO A . n A 1 9 TRP 9 233 233 TRP TRP A . n A 1 10 TRP 10 234 234 TRP TRP A . n A 1 11 GLU 11 235 235 GLU GLU A . n A 1 12 ASP 12 236 236 ASP ASP A . n A 1 13 GLU 13 237 237 GLU GLU A . n A 1 14 TRP 14 238 238 TRP TRP A . n A 1 15 GLU 15 239 239 GLU GLU A . n A 1 16 VAL 16 240 240 VAL VAL A . n A 1 17 PRO 17 241 241 PRO PRO A . n A 1 18 ARG 18 242 242 ARG ARG A . n A 1 19 GLU 19 243 243 GLU GLU A . n A 1 20 THR 20 244 244 THR THR A . n A 1 21 LEU 21 245 245 LEU LEU A . n A 1 22 LYS 22 246 246 LYS LYS A . n A 1 23 LEU 23 247 247 LEU LEU A . n A 1 24 VAL 24 248 248 VAL VAL A . n A 1 25 GLU 25 249 249 GLU GLU A . n A 1 26 ARG 26 250 250 ARG ARG A . n A 1 27 LEU 27 251 251 LEU LEU A . n A 1 28 GLY 28 252 252 GLY GLY A . n A 1 29 ALA 29 253 253 ALA ALA A . n A 1 30 GLY 30 254 254 GLY GLY A . n A 1 31 GLN 31 255 255 GLN GLN A . n A 1 32 PHE 32 256 256 PHE PHE A . n A 1 33 GLY 33 257 257 GLY GLY A . n A 1 34 GLU 34 258 258 GLU GLU A . n A 1 35 VAL 35 259 259 VAL VAL A . n A 1 36 TRP 36 260 260 TRP TRP A . n A 1 37 MET 37 261 261 MET MET A . n A 1 38 GLY 38 262 262 GLY GLY A . n A 1 39 TYR 39 263 263 TYR TYR A . n A 1 40 TYR 40 264 264 TYR TYR A . n A 1 41 ASN 41 265 265 ASN ASN A . n A 1 42 GLY 42 266 266 GLY GLY A . n A 1 43 HIS 43 267 267 HIS HIS A . n A 1 44 THR 44 268 268 THR THR A . n A 1 45 LYS 45 269 269 LYS LYS A . n A 1 46 VAL 46 270 270 VAL VAL A . n A 1 47 ALA 47 271 271 ALA ALA A . n A 1 48 VAL 48 272 272 VAL VAL A . n A 1 49 LYS 49 273 273 LYS LYS A . n A 1 50 SER 50 274 274 SER SER A . n A 1 51 LEU 51 275 275 LEU LEU A . n A 1 52 LYS 52 276 276 LYS LYS A . n A 1 53 GLN 53 277 277 GLN GLN A . n A 1 54 GLY 54 278 278 GLY GLY A . n A 1 55 SER 55 279 279 SER SER A . n A 1 56 MET 56 280 280 MET MET A . n A 1 57 SER 57 281 281 SER SER A . n A 1 58 PRO 58 282 282 PRO PRO A . n A 1 59 ASP 59 283 283 ASP ASP A . n A 1 60 ALA 60 284 284 ALA ALA A . n A 1 61 PHE 61 285 285 PHE PHE A . n A 1 62 LEU 62 286 286 LEU LEU A . n A 1 63 ALA 63 287 287 ALA ALA A . n A 1 64 GLU 64 288 288 GLU GLU A . n A 1 65 ALA 65 289 289 ALA ALA A . n A 1 66 ASN 66 290 290 ASN ASN A . n A 1 67 LEU 67 291 291 LEU LEU A . n A 1 68 MET 68 292 292 MET MET A . n A 1 69 LYS 69 293 293 LYS LYS A . n A 1 70 GLN 70 294 294 GLN GLN A . n A 1 71 LEU 71 295 295 LEU LEU A . n A 1 72 GLN 72 296 296 GLN GLN A . n A 1 73 HIS 73 297 297 HIS HIS A . n A 1 74 GLN 74 298 298 GLN GLN A . n A 1 75 ARG 75 299 299 ARG ARG A . n A 1 76 LEU 76 300 300 LEU LEU A . n A 1 77 VAL 77 301 301 VAL VAL A . n A 1 78 ARG 78 302 302 ARG ARG A . n A 1 79 LEU 79 303 303 LEU LEU A . n A 1 80 TYR 80 304 304 TYR TYR A . n A 1 81 ALA 81 305 305 ALA ALA A . n A 1 82 VAL 82 306 306 VAL VAL A . n A 1 83 VAL 83 307 307 VAL VAL A . n A 1 84 THR 84 308 308 THR THR A . n A 1 85 GLN 85 309 309 GLN GLN A . n A 1 86 GLU 86 310 310 GLU GLU A . n A 1 87 PRO 87 311 311 PRO PRO A . n A 1 88 ILE 88 312 312 ILE ILE A . n A 1 89 TYR 89 313 313 TYR TYR A . n A 1 90 ILE 90 314 314 ILE ILE A . n A 1 91 ILE 91 315 315 ILE ILE A . n A 1 92 THR 92 316 316 THR THR A . n A 1 93 GLU 93 317 317 GLU GLU A . n A 1 94 TYR 94 318 318 TYR TYR A . n A 1 95 MET 95 319 319 MET MET A . n A 1 96 GLU 96 320 320 GLU GLU A . n A 1 97 ASN 97 321 321 ASN ASN A . n A 1 98 GLY 98 322 322 GLY GLY A . n A 1 99 SER 99 323 323 SER SER A . n A 1 100 LEU 100 324 324 LEU LEU A . n A 1 101 VAL 101 325 325 VAL VAL A . n A 1 102 ASP 102 326 326 ASP ASP A . n A 1 103 PHE 103 327 327 PHE PHE A . n A 1 104 LEU 104 328 328 LEU LEU A . n A 1 105 LYS 105 329 329 LYS LYS A . n A 1 106 THR 106 330 330 THR THR A . n A 1 107 PRO 107 331 331 PRO PRO A . n A 1 108 SER 108 332 332 SER SER A . n A 1 109 GLY 109 333 333 GLY GLY A . n A 1 110 ILE 110 334 334 ILE ILE A . n A 1 111 LYS 111 335 335 LYS LYS A . n A 1 112 LEU 112 336 336 LEU LEU A . n A 1 113 THR 113 337 337 THR THR A . n A 1 114 ILE 114 338 338 ILE ILE A . n A 1 115 ASN 115 339 339 ASN ASN A . n A 1 116 LYS 116 340 340 LYS LYS A . n A 1 117 LEU 117 341 341 LEU LEU A . n A 1 118 LEU 118 342 342 LEU LEU A . n A 1 119 ASP 119 343 343 ASP ASP A . n A 1 120 MET 120 344 344 MET MET A . n A 1 121 ALA 121 345 345 ALA ALA A . n A 1 122 ALA 122 346 346 ALA ALA A . n A 1 123 GLN 123 347 347 GLN GLN A . n A 1 124 ILE 124 348 348 ILE ILE A . n A 1 125 ALA 125 349 349 ALA ALA A . n A 1 126 GLU 126 350 350 GLU GLU A . n A 1 127 GLY 127 351 351 GLY GLY A . n A 1 128 MET 128 352 352 MET MET A . n A 1 129 ALA 129 353 353 ALA ALA A . n A 1 130 PHE 130 354 354 PHE PHE A . n A 1 131 ILE 131 355 355 ILE ILE A . n A 1 132 GLU 132 356 356 GLU GLU A . n A 1 133 GLU 133 357 357 GLU GLU A . n A 1 134 ARG 134 358 358 ARG ARG A . n A 1 135 ASN 135 359 359 ASN ASN A . n A 1 136 TYR 136 360 360 TYR TYR A . n A 1 137 ILE 137 361 361 ILE ILE A . n A 1 138 HIS 138 362 362 HIS HIS A . n A 1 139 ARG 139 363 363 ARG ARG A . n A 1 140 ASP 140 364 364 ASP ASP A . n A 1 141 LEU 141 365 365 LEU LEU A . n A 1 142 ARG 142 366 366 ARG ARG A . n A 1 143 ALA 143 367 367 ALA ALA A . n A 1 144 ALA 144 368 368 ALA ALA A . n A 1 145 ASN 145 369 369 ASN ASN A . n A 1 146 ILE 146 370 370 ILE ILE A . n A 1 147 LEU 147 371 371 LEU LEU A . n A 1 148 VAL 148 372 372 VAL VAL A . n A 1 149 SER 149 373 373 SER SER A . n A 1 150 ASP 150 374 374 ASP ASP A . n A 1 151 THR 151 375 375 THR THR A . n A 1 152 LEU 152 376 376 LEU LEU A . n A 1 153 SER 153 377 377 SER SER A . n A 1 154 CYS 154 378 378 CYS CYS A . n A 1 155 LYS 155 379 379 LYS LYS A . n A 1 156 ILE 156 380 380 ILE ILE A . n A 1 157 ALA 157 381 381 ALA ALA A . n A 1 158 ASP 158 382 382 ASP ASP A . n A 1 159 PHE 159 383 383 PHE PHE A . n A 1 160 GLY 160 384 384 GLY GLY A . n A 1 161 LEU 161 385 385 LEU LEU A . n A 1 162 ALA 162 386 386 ALA ALA A . n A 1 163 ARG 163 387 387 ARG ARG A . n A 1 164 LEU 164 388 388 LEU LEU A . n A 1 165 ILE 165 389 389 ILE ILE A . n A 1 166 GLU 166 390 390 GLU GLU A . n A 1 167 ASP 167 391 391 ASP ASP A . n A 1 168 ASN 168 392 392 ASN ASN A . n A 1 169 GLU 169 393 393 GLU GLU A . n A 1 170 PTR 170 394 394 PTR PTR A . n A 1 171 THR 171 395 395 THR THR A . n A 1 172 ALA 172 396 396 ALA ALA A . n A 1 173 ARG 173 397 397 ARG ARG A . n A 1 174 GLU 174 398 398 GLU GLU A . n A 1 175 GLY 175 399 399 GLY GLY A . n A 1 176 ALA 176 400 400 ALA ALA A . n A 1 177 LYS 177 401 401 LYS LYS A . n A 1 178 PHE 178 402 402 PHE PHE A . n A 1 179 PRO 179 403 403 PRO PRO A . n A 1 180 ILE 180 404 404 ILE ILE A . n A 1 181 LYS 181 405 405 LYS LYS A . n A 1 182 TRP 182 406 406 TRP TRP A . n A 1 183 THR 183 407 407 THR THR A . n A 1 184 ALA 184 408 408 ALA ALA A . n A 1 185 PRO 185 409 409 PRO PRO A . n A 1 186 GLU 186 410 410 GLU GLU A . n A 1 187 ALA 187 411 411 ALA ALA A . n A 1 188 ILE 188 412 412 ILE ILE A . n A 1 189 ASN 189 413 413 ASN ASN A . n A 1 190 TYR 190 414 414 TYR TYR A . n A 1 191 GLY 191 415 415 GLY GLY A . n A 1 192 THR 192 416 416 THR THR A . n A 1 193 PHE 193 417 417 PHE PHE A . n A 1 194 THR 194 418 418 THR THR A . n A 1 195 ILE 195 419 419 ILE ILE A . n A 1 196 LYS 196 420 420 LYS LYS A . n A 1 197 SER 197 421 421 SER SER A . n A 1 198 ASP 198 422 422 ASP ASP A . n A 1 199 VAL 199 423 423 VAL VAL A . n A 1 200 TRP 200 424 424 TRP TRP A . n A 1 201 SER 201 425 425 SER SER A . n A 1 202 PHE 202 426 426 PHE PHE A . n A 1 203 GLY 203 427 427 GLY GLY A . n A 1 204 ILE 204 428 428 ILE ILE A . n A 1 205 LEU 205 429 429 LEU LEU A . n A 1 206 LEU 206 430 430 LEU LEU A . n A 1 207 THR 207 431 431 THR THR A . n A 1 208 GLU 208 432 432 GLU GLU A . n A 1 209 ILE 209 433 433 ILE ILE A . n A 1 210 VAL 210 434 434 VAL VAL A . n A 1 211 THR 211 435 435 THR THR A . n A 1 212 HIS 212 436 436 HIS HIS A . n A 1 213 GLY 213 437 437 GLY GLY A . n A 1 214 ARG 214 438 438 ARG ARG A . n A 1 215 ILE 215 439 439 ILE ILE A . n A 1 216 PRO 216 440 440 PRO PRO A . n A 1 217 TYR 217 441 441 TYR TYR A . n A 1 218 PRO 218 442 442 PRO PRO A . n A 1 219 GLY 219 443 443 GLY GLY A . n A 1 220 MET 220 444 444 MET MET A . n A 1 221 THR 221 445 445 THR THR A . n A 1 222 ASN 222 446 446 ASN ASN A . n A 1 223 PRO 223 447 447 PRO PRO A . n A 1 224 GLU 224 448 448 GLU GLU A . n A 1 225 VAL 225 449 449 VAL VAL A . n A 1 226 ILE 226 450 450 ILE ILE A . n A 1 227 GLN 227 451 451 GLN GLN A . n A 1 228 ASN 228 452 452 ASN ASN A . n A 1 229 LEU 229 453 453 LEU LEU A . n A 1 230 GLU 230 454 454 GLU GLU A . n A 1 231 ARG 231 455 455 ARG ARG A . n A 1 232 GLY 232 456 456 GLY GLY A . n A 1 233 TYR 233 457 457 TYR TYR A . n A 1 234 ARG 234 458 458 ARG ARG A . n A 1 235 MET 235 459 459 MET MET A . n A 1 236 VAL 236 460 460 VAL VAL A . n A 1 237 ARG 237 461 461 ARG ARG A . n A 1 238 PRO 238 462 462 PRO PRO A . n A 1 239 ASP 239 463 463 ASP ASP A . n A 1 240 ASN 240 464 464 ASN ASN A . n A 1 241 CYS 241 465 465 CYS CYS A . n A 1 242 PRO 242 466 466 PRO PRO A . n A 1 243 GLU 243 467 467 GLU GLU A . n A 1 244 GLU 244 468 468 GLU GLU A . n A 1 245 LEU 245 469 469 LEU LEU A . n A 1 246 TYR 246 470 470 TYR TYR A . n A 1 247 GLN 247 471 471 GLN GLN A . n A 1 248 LEU 248 472 472 LEU LEU A . n A 1 249 MET 249 473 473 MET MET A . n A 1 250 ARG 250 474 474 ARG ARG A . n A 1 251 LEU 251 475 475 LEU LEU A . n A 1 252 CYS 252 476 476 CYS CYS A . n A 1 253 TRP 253 477 477 TRP TRP A . n A 1 254 LYS 254 478 478 LYS LYS A . n A 1 255 GLU 255 479 479 GLU GLU A . n A 1 256 ARG 256 480 480 ARG ARG A . n A 1 257 PRO 257 481 481 PRO PRO A . n A 1 258 GLU 258 482 482 GLU GLU A . n A 1 259 ASP 259 483 483 ASP ASP A . n A 1 260 ARG 260 484 484 ARG ARG A . n A 1 261 PRO 261 485 485 PRO PRO A . n A 1 262 THR 262 486 486 THR THR A . n A 1 263 PHE 263 487 487 PHE PHE A . n A 1 264 ASP 264 488 488 ASP ASP A . n A 1 265 TYR 265 489 489 TYR TYR A . n A 1 266 LEU 266 490 490 LEU LEU A . n A 1 267 ARG 267 491 491 ARG ARG A . n A 1 268 SER 268 492 492 SER SER A . n A 1 269 VAL 269 493 493 VAL VAL A . n A 1 270 LEU 270 494 494 LEU LEU A . n A 1 271 GLU 271 495 495 GLU GLU A . n A 1 272 ASP 272 496 496 ASP ASP A . n A 1 273 PHE 273 497 497 PHE PHE A . n A 1 274 PHE 274 498 498 PHE PHE A . n A 1 275 THR 275 499 499 THR THR A . n A 1 276 ALA 276 500 500 ALA ALA A . n A 1 277 THR 277 501 501 THR THR A . n A 1 278 GLU 278 502 502 GLU GLU A . n A 1 279 GLY 279 503 ? ? ? A . n A 1 280 GLN 280 504 ? ? ? A . n A 1 281 TYR 281 505 ? ? ? A . n A 1 282 GLN 282 506 ? ? ? A . n A 1 283 PRO 283 507 ? ? ? A . n A 1 284 GLN 284 508 ? ? ? A . n A 1 285 PRO 285 509 ? ? ? A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PTR _pdbx_struct_mod_residue.label_seq_id 170 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PTR _pdbx_struct_mod_residue.auth_seq_id 394 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TYR _pdbx_struct_mod_residue.details O-PHOSPHOTYROSINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-06-30 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal BSS 'data collection' 'AT BL32B2' ? 1 AMoRE phasing . ? 2 REFMAC refinement 5.5.0072 ? 3 MOSFLM 'data reduction' . ? 4 SCALA 'data scaling' . ? 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 CB A SER 274 ? ? O A HOH 31 ? ? 1.97 2 1 NE A ARG 474 ? ? O A HOH 66 ? ? 2.06 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 295 ? ? -117.98 73.28 2 1 ALA A 305 ? ? 172.97 169.21 3 1 ARG A 363 ? ? 77.05 -14.83 4 1 ASP A 382 ? ? 54.99 89.06 5 1 GLU A 390 ? ? -69.51 -71.90 6 1 ASN A 392 ? ? -48.77 4.36 7 1 THR A 501 ? ? -110.62 -122.22 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 502 ? CA ? A GLU 278 CA 2 1 Y 1 A GLU 502 ? C ? A GLU 278 C 3 1 Y 1 A GLU 502 ? O ? A GLU 278 O 4 1 Y 1 A GLU 502 ? CB ? A GLU 278 CB 5 1 Y 1 A GLU 502 ? CG ? A GLU 278 CG 6 1 Y 1 A GLU 502 ? CD ? A GLU 278 CD 7 1 Y 1 A GLU 502 ? OE1 ? A GLU 278 OE1 8 1 Y 1 A GLU 502 ? OE2 ? A GLU 278 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN 225 ? A GLN 1 2 1 Y 1 A THR 226 ? A THR 2 3 1 Y 1 A GLN 227 ? A GLN 3 4 1 Y 1 A LYS 228 ? A LYS 4 5 1 Y 1 A PRO 229 ? A PRO 5 6 1 Y 1 A GLN 230 ? A GLN 6 7 1 Y 1 A GLY 503 ? A GLY 279 8 1 Y 1 A GLN 504 ? A GLN 280 9 1 Y 1 A TYR 505 ? A TYR 281 10 1 Y 1 A GLN 506 ? A GLN 282 11 1 Y 1 A PRO 507 ? A PRO 283 12 1 Y 1 A GLN 508 ? A GLN 284 13 1 Y 1 A PRO 509 ? A PRO 285 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 '2-[(3,5-dimethoxyphenyl)amino]-5-ethyl-7-[(2R)-2-(hydroxymethyl)pyrrolidin-1-yl]pyrazolo[1,5-a]pyrimidine-3-carboxamide' KSH 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 1 1 SO4 SO4 A . C 2 SO4 1 510 1 SO4 SO4 A . D 3 KSH 1 511 1 KSH KSF A . E 4 HOH 1 2 2 HOH HOH A . E 4 HOH 2 3 3 HOH HOH A . E 4 HOH 3 4 4 HOH HOH A . E 4 HOH 4 5 5 HOH HOH A . E 4 HOH 5 6 6 HOH HOH A . E 4 HOH 6 7 7 HOH HOH A . E 4 HOH 7 8 8 HOH HOH A . E 4 HOH 8 9 9 HOH HOH A . E 4 HOH 9 10 10 HOH HOH A . E 4 HOH 10 11 11 HOH HOH A . E 4 HOH 11 12 12 HOH HOH A . E 4 HOH 12 13 13 HOH HOH A . E 4 HOH 13 14 14 HOH HOH A . E 4 HOH 14 15 15 HOH HOH A . E 4 HOH 15 16 16 HOH HOH A . E 4 HOH 16 17 17 HOH HOH A . E 4 HOH 17 18 18 HOH HOH A . E 4 HOH 18 19 19 HOH HOH A . E 4 HOH 19 20 20 HOH HOH A . E 4 HOH 20 21 21 HOH HOH A . E 4 HOH 21 22 22 HOH HOH A . E 4 HOH 22 23 23 HOH HOH A . E 4 HOH 23 24 24 HOH HOH A . E 4 HOH 24 25 25 HOH HOH A . E 4 HOH 25 26 26 HOH HOH A . E 4 HOH 26 27 27 HOH HOH A . E 4 HOH 27 28 28 HOH HOH A . E 4 HOH 28 29 29 HOH HOH A . E 4 HOH 29 30 30 HOH HOH A . E 4 HOH 30 31 31 HOH HOH A . E 4 HOH 31 32 32 HOH HOH A . E 4 HOH 32 33 33 HOH HOH A . E 4 HOH 33 34 34 HOH HOH A . E 4 HOH 34 35 35 HOH HOH A . E 4 HOH 35 36 36 HOH HOH A . E 4 HOH 36 37 37 HOH HOH A . E 4 HOH 37 38 38 HOH HOH A . E 4 HOH 38 39 39 HOH HOH A . E 4 HOH 39 40 40 HOH HOH A . E 4 HOH 40 41 41 HOH HOH A . E 4 HOH 41 42 42 HOH HOH A . E 4 HOH 42 43 43 HOH HOH A . E 4 HOH 43 44 44 HOH HOH A . E 4 HOH 44 45 45 HOH HOH A . E 4 HOH 45 46 46 HOH HOH A . E 4 HOH 46 47 47 HOH HOH A . E 4 HOH 47 48 48 HOH HOH A . E 4 HOH 48 49 49 HOH HOH A . E 4 HOH 49 50 50 HOH HOH A . E 4 HOH 50 51 51 HOH HOH A . E 4 HOH 51 52 52 HOH HOH A . E 4 HOH 52 54 54 HOH HOH A . E 4 HOH 53 55 55 HOH HOH A . E 4 HOH 54 56 56 HOH HOH A . E 4 HOH 55 57 57 HOH HOH A . E 4 HOH 56 58 58 HOH HOH A . E 4 HOH 57 59 59 HOH HOH A . E 4 HOH 58 60 60 HOH HOH A . E 4 HOH 59 61 61 HOH HOH A . E 4 HOH 60 62 62 HOH HOH A . E 4 HOH 61 63 63 HOH HOH A . E 4 HOH 62 64 64 HOH HOH A . E 4 HOH 63 65 65 HOH HOH A . E 4 HOH 64 66 66 HOH HOH A . E 4 HOH 65 67 67 HOH HOH A . E 4 HOH 66 68 68 HOH HOH A . E 4 HOH 67 69 69 HOH HOH A . E 4 HOH 68 70 70 HOH HOH A . E 4 HOH 69 71 71 HOH HOH A . E 4 HOH 70 72 72 HOH HOH A . E 4 HOH 71 73 73 HOH HOH A . E 4 HOH 72 74 74 HOH HOH A . E 4 HOH 73 75 75 HOH HOH A . E 4 HOH 74 76 76 HOH HOH A . E 4 HOH 75 77 77 HOH HOH A . E 4 HOH 76 78 78 HOH HOH A . E 4 HOH 77 79 79 HOH HOH A . E 4 HOH 78 80 80 HOH HOH A . E 4 HOH 79 81 81 HOH HOH A . E 4 HOH 80 82 82 HOH HOH A . E 4 HOH 81 83 83 HOH HOH A . E 4 HOH 82 84 84 HOH HOH A . E 4 HOH 83 85 85 HOH HOH A . E 4 HOH 84 86 86 HOH HOH A . E 4 HOH 85 87 87 HOH HOH A . E 4 HOH 86 88 88 HOH HOH A . E 4 HOH 87 89 89 HOH HOH A . E 4 HOH 88 90 90 HOH HOH A . E 4 HOH 89 91 91 HOH HOH A . E 4 HOH 90 92 92 HOH HOH A . E 4 HOH 91 93 93 HOH HOH A . E 4 HOH 92 94 94 HOH HOH A . E 4 HOH 93 95 95 HOH HOH A . E 4 HOH 94 96 96 HOH HOH A . E 4 HOH 95 97 97 HOH HOH A . E 4 HOH 96 98 98 HOH HOH A . E 4 HOH 97 99 99 HOH HOH A . E 4 HOH 98 100 100 HOH HOH A . E 4 HOH 99 101 101 HOH HOH A . E 4 HOH 100 102 102 HOH HOH A . E 4 HOH 101 103 103 HOH HOH A . E 4 HOH 102 104 104 HOH HOH A . E 4 HOH 103 105 105 HOH HOH A . E 4 HOH 104 106 106 HOH HOH A . E 4 HOH 105 107 107 HOH HOH A . E 4 HOH 106 108 108 HOH HOH A . E 4 HOH 107 109 109 HOH HOH A . E 4 HOH 108 110 110 HOH HOH A . E 4 HOH 109 111 111 HOH HOH A . E 4 HOH 110 112 112 HOH HOH A . E 4 HOH 111 113 113 HOH HOH A . E 4 HOH 112 114 114 HOH HOH A . E 4 HOH 113 115 115 HOH HOH A . E 4 HOH 114 116 116 HOH HOH A . E 4 HOH 115 117 117 HOH HOH A . E 4 HOH 116 118 118 HOH HOH A . E 4 HOH 117 119 119 HOH HOH A . E 4 HOH 118 120 120 HOH HOH A . E 4 HOH 119 121 121 HOH HOH A . E 4 HOH 120 122 122 HOH HOH A . E 4 HOH 121 123 123 HOH HOH A . E 4 HOH 122 124 124 HOH HOH A . E 4 HOH 123 125 125 HOH HOH A . E 4 HOH 124 126 126 HOH HOH A . E 4 HOH 125 127 127 HOH HOH A . E 4 HOH 126 128 128 HOH HOH A . E 4 HOH 127 129 129 HOH HOH A . E 4 HOH 128 130 130 HOH HOH A . E 4 HOH 129 131 131 HOH HOH A . E 4 HOH 130 132 132 HOH HOH A . E 4 HOH 131 133 133 HOH HOH A . E 4 HOH 132 134 134 HOH HOH A . E 4 HOH 133 135 135 HOH HOH A . E 4 HOH 134 136 136 HOH HOH A . E 4 HOH 135 512 1 HOH HOH A . #