data_3AIG # _entry.id 3AIG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3AIG pdb_00003aig 10.2210/pdb3aig/pdb WWPDB D_1000178871 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3AIG _pdbx_database_status.recvd_initial_deposition_date 1997-10-12 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gomis-Rueth, F.X.' 1 'Meyer, E.F.' 2 'Kress, L.F.' 3 'Politi, V.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Structures of adamalysin II with peptidic inhibitors. Implications for the design of tumor necrosis factor alpha convertase inhibitors. ; 'Protein Sci.' 7 283 292 1998 PRCIEI US 0961-8368 0795 ? 9521103 ? 1 ;Refined 2.0 A X-Ray Crystal Structure of the Snake Venom Zinc-Endopeptidase Adamalysin II. Primary and Tertiary Structure Determination, Refinement, Molecular Structure and Comparison with Astacin, Collagenase and Thermolysin ; J.Mol.Biol. 239 513 ? 1994 JMOBAK UK 0022-2836 0070 ? ? ? 2 'First Structure of a Snake Venom Metalloproteinase: A Prototype for Matrix Metalloproteinases/Collagenases' 'Embo J.' 12 4151 ? 1993 EMJODG UK 0261-4189 0897 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gomis-Ruth, F.X.' 1 ? primary 'Meyer, E.F.' 2 ? primary 'Kress, L.F.' 3 ? primary 'Politi, V.' 4 ? 1 'Gomis-Ruth, F.X.' 5 ? 1 'Kress, L.F.' 6 ? 1 'Kellermann, J.' 7 ? 1 'Mayr, I.' 8 ? 1 'Lee, X.' 9 ? 1 'Huber, R.' 10 ? 1 'Bode, W.' 11 ? 2 'Gomis-Ruth, F.X.' 12 ? 2 'Kress, L.F.' 13 ? 2 'Bode, W.' 14 ? # _cell.entry_id 3AIG _cell.length_a 73.550 _cell.length_b 73.550 _cell.length_c 96.670 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3AIG _symmetry.space_group_name_H-M 'P 32 1 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 153 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'ADAMALYSIN II' 23152.488 1 3.4.24.46 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 5 non-polymer syn '(3R)-2-[N-(furan-2-ylcarbonyl)-L-leucyl]-2,3,4,9-tetrahydro-1H-beta-carboline-3-carboxylic acid' 423.462 1 ? ? ? ? 6 water nat water 18.015 129 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(PCA)NLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINEFYRSLNIRVSLTDLEIWSGQDFITIQSSSSNTLN SFGEWRERVLLTRKRHDNAQLLTAINFEGKIIGKAYTSSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKD CLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP ; _entity_poly.pdbx_seq_one_letter_code_can ;QNLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINEFYRSLNIRVSLTDLEIWSGQDFITIQSSSSNTLNSFGE WRERVLLTRKRHDNAQLLTAINFEGKIIGKAYTSSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRG ASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PCA n 1 2 ASN n 1 3 LEU n 1 4 PRO n 1 5 GLN n 1 6 ARG n 1 7 TYR n 1 8 ILE n 1 9 GLU n 1 10 LEU n 1 11 VAL n 1 12 VAL n 1 13 VAL n 1 14 ALA n 1 15 ASP n 1 16 ARG n 1 17 ARG n 1 18 VAL n 1 19 PHE n 1 20 MET n 1 21 LYS n 1 22 TYR n 1 23 ASN n 1 24 SER n 1 25 ASP n 1 26 LEU n 1 27 ASN n 1 28 ILE n 1 29 ILE n 1 30 ARG n 1 31 THR n 1 32 ARG n 1 33 VAL n 1 34 HIS n 1 35 GLU n 1 36 ILE n 1 37 VAL n 1 38 ASN n 1 39 ILE n 1 40 ILE n 1 41 ASN n 1 42 GLU n 1 43 PHE n 1 44 TYR n 1 45 ARG n 1 46 SER n 1 47 LEU n 1 48 ASN n 1 49 ILE n 1 50 ARG n 1 51 VAL n 1 52 SER n 1 53 LEU n 1 54 THR n 1 55 ASP n 1 56 LEU n 1 57 GLU n 1 58 ILE n 1 59 TRP n 1 60 SER n 1 61 GLY n 1 62 GLN n 1 63 ASP n 1 64 PHE n 1 65 ILE n 1 66 THR n 1 67 ILE n 1 68 GLN n 1 69 SER n 1 70 SER n 1 71 SER n 1 72 SER n 1 73 ASN n 1 74 THR n 1 75 LEU n 1 76 ASN n 1 77 SER n 1 78 PHE n 1 79 GLY n 1 80 GLU n 1 81 TRP n 1 82 ARG n 1 83 GLU n 1 84 ARG n 1 85 VAL n 1 86 LEU n 1 87 LEU n 1 88 THR n 1 89 ARG n 1 90 LYS n 1 91 ARG n 1 92 HIS n 1 93 ASP n 1 94 ASN n 1 95 ALA n 1 96 GLN n 1 97 LEU n 1 98 LEU n 1 99 THR n 1 100 ALA n 1 101 ILE n 1 102 ASN n 1 103 PHE n 1 104 GLU n 1 105 GLY n 1 106 LYS n 1 107 ILE n 1 108 ILE n 1 109 GLY n 1 110 LYS n 1 111 ALA n 1 112 TYR n 1 113 THR n 1 114 SER n 1 115 SER n 1 116 MET n 1 117 CYS n 1 118 ASN n 1 119 PRO n 1 120 ARG n 1 121 SER n 1 122 SER n 1 123 VAL n 1 124 GLY n 1 125 ILE n 1 126 VAL n 1 127 LYS n 1 128 ASP n 1 129 HIS n 1 130 SER n 1 131 PRO n 1 132 ILE n 1 133 ASN n 1 134 LEU n 1 135 LEU n 1 136 VAL n 1 137 ALA n 1 138 VAL n 1 139 THR n 1 140 MET n 1 141 ALA n 1 142 HIS n 1 143 GLU n 1 144 LEU n 1 145 GLY n 1 146 HIS n 1 147 ASN n 1 148 LEU n 1 149 GLY n 1 150 MET n 1 151 GLU n 1 152 HIS n 1 153 ASP n 1 154 GLY n 1 155 LYS n 1 156 ASP n 1 157 CYS n 1 158 LEU n 1 159 ARG n 1 160 GLY n 1 161 ALA n 1 162 SER n 1 163 LEU n 1 164 CYS n 1 165 ILE n 1 166 MET n 1 167 ARG n 1 168 PRO n 1 169 GLY n 1 170 LEU n 1 171 THR n 1 172 PRO n 1 173 GLY n 1 174 ARG n 1 175 SER n 1 176 TYR n 1 177 GLU n 1 178 PHE n 1 179 SER n 1 180 ASP n 1 181 ASP n 1 182 SER n 1 183 MET n 1 184 GLY n 1 185 TYR n 1 186 TYR n 1 187 GLN n 1 188 LYS n 1 189 PHE n 1 190 LEU n 1 191 ASN n 1 192 GLN n 1 193 TYR n 1 194 LYS n 1 195 PRO n 1 196 GLN n 1 197 CYS n 1 198 ILE n 1 199 LEU n 1 200 ASN n 1 201 LYS n 1 202 PRO n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'eastern diamondback rattlesnake' _entity_src_nat.pdbx_organism_scientific 'Crotalus adamanteus' _entity_src_nat.pdbx_ncbi_taxonomy_id 8729 _entity_src_nat.genus Crotalus _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion VENOM _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name GB _struct_ref.db_code AAB31038 _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession 547144 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;EQNLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINEFYRSLNIRVSLTDLEIWSGQDFITIQSSSSNTLNSFG EWRERVLLTRKRHDNAQLLTAINFEGKIIGKAYTSSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLR GASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3AIG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 202 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 547144 _struct_ref_seq.db_align_beg 3 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 203 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 202 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 0ZC peptide-like . '(3R)-2-[N-(furan-2-ylcarbonyl)-L-leucyl]-2,3,4,9-tetrahydro-1H-beta-carboline-3-carboxylic acid' 'Furoyl-LeusycloTrp; Po1656' 'C23 H25 N3 O5' 423.462 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PCA 'L-peptide linking' n 'PYROGLUTAMIC ACID' ? 'C5 H7 N O3' 129.114 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 3AIG _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.26 _exptl_crystal.density_percent_sol 62.22 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '1.8 M AMMONIUM SULFATE' # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector DIFFRACTOMETER _diffrn_detector.type 'ENRAF-NONIUS FAST' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator NI-FILTER _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 3AIG _reflns.observed_criterion_sigma_I 2. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20. _reflns.d_resolution_high 2.50 _reflns.number_obs 8311 _reflns.number_all ? _reflns.percent_possible_obs 78.9 _reflns.pdbx_Rmerge_I_obs 0.12 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 4.4 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 2.2 _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.63 _reflns_shell.percent_possible_all 45.7 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? # _refine.entry_id 3AIG _refine.ls_number_reflns_obs 5926 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2. _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 7. _refine.ls_d_res_high 2.8 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.194 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.194 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'NATIVE ADAMALYSIN II (PDB ENTRY 1IAG)' _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_overall_phase_error ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1616 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 38 _refine_hist.number_atoms_solvent 129 _refine_hist.number_atoms_total 1783 _refine_hist.d_res_high 2.8 _refine_hist.d_res_low 7. # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.30 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 3AIG _struct.title 'ADAMALYSIN II WITH PEPTIDOMIMETIC INHIBITOR POL656' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3AIG _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE INHIBITOR' _struct_keywords.text 'SNAKE VENOM METALLOENDOPETIDASE, ZINC PROTEASE, METALLOPROTEASE, HYDROLASE-HYDROLASE INHIBITOR COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 16 ? LYS A 21 ? ARG A 16 LYS A 21 1 ? 6 HELX_P HELX_P2 2 LEU A 26 ? LEU A 47 ? LEU A 26 LEU A 47 1 ? 22 HELX_P HELX_P3 3 SER A 71 ? ARG A 84 ? SER A 71 ARG A 84 1 ? 14 HELX_P HELX_P4 4 ASN A 133 ? ASN A 147 ? ASN A 133 ASN A 147 1 ? 15 HELX_P HELX_P5 5 ASP A 180 ? GLN A 192 ? ASP A 180 GLN A 192 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 117 SG ? ? ? 1_555 A CYS 197 SG ? ? A CYS 117 A CYS 197 1_555 ? ? ? ? ? ? ? 2.025 ? ? disulf2 disulf ? ? A CYS 157 SG ? ? ? 1_555 A CYS 164 SG ? ? A CYS 157 A CYS 164 1_555 ? ? ? ? ? ? ? 2.023 ? ? metalc1 metalc ? ? A GLU 9 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 9 A CA 250 1_555 ? ? ? ? ? ? ? 2.315 ? ? metalc2 metalc ? ? A ASP 93 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 93 A CA 250 1_555 ? ? ? ? ? ? ? 2.145 ? ? metalc3 metalc ? ? A ASP 93 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 93 A CA 250 1_555 ? ? ? ? ? ? ? 2.462 ? ? metalc4 metalc ? ? A HIS 142 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 142 A ZN 999 1_555 ? ? ? ? ? ? ? 1.982 ? ? metalc5 metalc ? ? A HIS 146 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 146 A ZN 999 1_555 ? ? ? ? ? ? ? 1.975 ? ? metalc6 metalc ? ? A HIS 152 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 152 A ZN 999 1_555 ? ? ? ? ? ? ? 1.779 ? ? metalc7 metalc ? ? A CYS 197 O ? ? ? 1_555 C CA . CA ? ? A CYS 197 A CA 250 1_555 ? ? ? ? ? ? ? 2.117 ? ? metalc8 metalc ? ? A ASN 200 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 200 A CA 250 1_555 ? ? ? ? ? ? ? 2.586 ? ? metalc9 metalc ? ? C CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 250 A HOH 307 1_555 ? ? ? ? ? ? ? 2.135 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 109 ? ALA A 111 ? GLY A 109 ALA A 111 A 2 VAL A 123 ? LYS A 127 ? VAL A 123 LYS A 127 A 3 ASN A 94 ? THR A 99 ? ASN A 94 THR A 99 A 4 ARG A 6 ? ALA A 14 ? ARG A 6 ALA A 14 A 5 ILE A 49 ? ILE A 58 ? ILE A 49 ILE A 58 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 110 ? O LYS A 110 N ILE A 125 ? N ILE A 125 A 2 3 O GLY A 124 ? O GLY A 124 N ALA A 95 ? N ALA A 95 A 3 4 O ASN A 94 ? O ASN A 94 N VAL A 11 ? N VAL A 11 A 4 5 O ARG A 6 ? O ARG A 6 N ARG A 50 ? N ARG A 50 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 999 ? 4 'BINDING SITE FOR RESIDUE ZN A 999' AC2 Software A CA 250 ? 6 'BINDING SITE FOR RESIDUE CA A 250' AC3 Software A SO4 260 ? 3 'BINDING SITE FOR RESIDUE SO4 A 260' AC4 Software A 0ZC 1000 ? 15 'BINDING SITE FOR RESIDUE 0ZC A 1000' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 142 ? HIS A 142 . ? 1_555 ? 2 AC1 4 HIS A 146 ? HIS A 146 . ? 1_555 ? 3 AC1 4 HIS A 152 ? HIS A 152 . ? 1_555 ? 4 AC1 4 0ZC E . ? 0ZC A 1000 . ? 1_555 ? 5 AC2 6 GLU A 9 ? GLU A 9 . ? 1_555 ? 6 AC2 6 ASP A 93 ? ASP A 93 . ? 1_555 ? 7 AC2 6 GLN A 196 ? GLN A 196 . ? 5_555 ? 8 AC2 6 CYS A 197 ? CYS A 197 . ? 1_555 ? 9 AC2 6 ASN A 200 ? ASN A 200 . ? 1_555 ? 10 AC2 6 HOH F . ? HOH A 307 . ? 1_555 ? 11 AC3 3 ARG A 6 ? ARG A 6 . ? 1_555 ? 12 AC3 3 HOH F . ? HOH A 354 . ? 5_555 ? 13 AC3 3 HOH F . ? HOH A 359 . ? 1_555 ? 14 AC4 15 GLY A 105 ? GLY A 105 . ? 1_555 ? 15 AC4 15 LYS A 106 ? LYS A 106 . ? 1_555 ? 16 AC4 15 ILE A 107 ? ILE A 107 . ? 1_555 ? 17 AC4 15 ILE A 108 ? ILE A 108 . ? 1_555 ? 18 AC4 15 GLY A 109 ? GLY A 109 . ? 1_555 ? 19 AC4 15 THR A 139 ? THR A 139 . ? 1_555 ? 20 AC4 15 HIS A 142 ? HIS A 142 . ? 1_555 ? 21 AC4 15 GLU A 143 ? GLU A 143 . ? 1_555 ? 22 AC4 15 HIS A 152 ? HIS A 152 . ? 1_555 ? 23 AC4 15 ILE A 165 ? ILE A 165 . ? 1_555 ? 24 AC4 15 ARG A 167 ? ARG A 167 . ? 1_555 ? 25 AC4 15 PRO A 168 ? PRO A 168 . ? 1_555 ? 26 AC4 15 GLY A 169 ? GLY A 169 . ? 1_555 ? 27 AC4 15 LEU A 170 ? LEU A 170 . ? 1_555 ? 28 AC4 15 ZN B . ? ZN A 999 . ? 1_555 ? # _database_PDB_matrix.entry_id 3AIG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3AIG _atom_sites.fract_transf_matrix[1][1] 0.013596 _atom_sites.fract_transf_matrix[1][2] 0.007850 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015700 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010344 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PCA 1 1 ? ? ? A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 TRP 81 81 81 TRP TRP A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 MET 116 116 116 MET MET A . n A 1 117 CYS 117 117 117 CYS CYS A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 HIS 129 129 129 HIS HIS A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 PRO 131 131 131 PRO PRO A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 THR 139 139 139 THR THR A . n A 1 140 MET 140 140 140 MET MET A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 HIS 142 142 142 HIS HIS A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 HIS 146 146 146 HIS HIS A . n A 1 147 ASN 147 147 147 ASN ASN A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 MET 150 150 150 MET MET A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 HIS 152 152 152 HIS HIS A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 CYS 157 157 157 CYS CYS A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 CYS 164 164 164 CYS CYS A . n A 1 165 ILE 165 165 165 ILE ILE A . n A 1 166 MET 166 166 166 MET MET A . n A 1 167 ARG 167 167 167 ARG ARG A . n A 1 168 PRO 168 168 168 PRO PRO A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 PRO 172 172 172 PRO PRO A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 ARG 174 174 174 ARG ARG A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 TYR 176 176 176 TYR TYR A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 PHE 178 178 178 PHE PHE A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 SER 182 182 182 SER SER A . n A 1 183 MET 183 183 183 MET MET A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 TYR 185 185 185 TYR TYR A . n A 1 186 TYR 186 186 186 TYR TYR A . n A 1 187 GLN 187 187 187 GLN GLN A . n A 1 188 LYS 188 188 188 LYS LYS A . n A 1 189 PHE 189 189 189 PHE PHE A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 ASN 191 191 191 ASN ASN A . n A 1 192 GLN 192 192 192 GLN GLN A . n A 1 193 TYR 193 193 193 TYR TYR A . n A 1 194 LYS 194 194 194 LYS LYS A . n A 1 195 PRO 195 195 195 PRO PRO A . n A 1 196 GLN 196 196 196 GLN GLN A . n A 1 197 CYS 197 197 197 CYS CYS A . n A 1 198 ILE 198 198 198 ILE ILE A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 ASN 200 200 200 ASN ASN A . n A 1 201 LYS 201 201 201 LYS LYS A . n A 1 202 PRO 202 202 202 PRO PRO A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 999 999 ZN ZN A . C 3 CA 1 250 250 CA CA A . D 4 SO4 1 260 260 SO4 SO4 A . E 5 0ZC 1 1000 1 0ZC FLE A . F 6 HOH 1 300 300 HOH HOH A . F 6 HOH 2 301 301 HOH HOH A . F 6 HOH 3 302 302 HOH HOH A . F 6 HOH 4 303 303 HOH HOH A . F 6 HOH 5 304 304 HOH HOH A . F 6 HOH 6 305 305 HOH HOH A . F 6 HOH 7 306 306 HOH HOH A . F 6 HOH 8 307 307 HOH HOH A . F 6 HOH 9 308 308 HOH HOH A . F 6 HOH 10 309 309 HOH HOH A . F 6 HOH 11 310 310 HOH HOH A . F 6 HOH 12 311 311 HOH HOH A . F 6 HOH 13 312 312 HOH HOH A . F 6 HOH 14 313 313 HOH HOH A . F 6 HOH 15 314 314 HOH HOH A . F 6 HOH 16 315 315 HOH HOH A . F 6 HOH 17 316 316 HOH HOH A . F 6 HOH 18 317 317 HOH HOH A . F 6 HOH 19 318 318 HOH HOH A . F 6 HOH 20 319 319 HOH HOH A . F 6 HOH 21 320 320 HOH HOH A . F 6 HOH 22 321 321 HOH HOH A . F 6 HOH 23 322 322 HOH HOH A . F 6 HOH 24 323 323 HOH HOH A . F 6 HOH 25 324 324 HOH HOH A . F 6 HOH 26 325 325 HOH HOH A . F 6 HOH 27 326 326 HOH HOH A . F 6 HOH 28 327 327 HOH HOH A . F 6 HOH 29 328 328 HOH HOH A . F 6 HOH 30 329 329 HOH HOH A . F 6 HOH 31 330 330 HOH HOH A . F 6 HOH 32 331 331 HOH HOH A . F 6 HOH 33 332 332 HOH HOH A . F 6 HOH 34 333 333 HOH HOH A . F 6 HOH 35 334 334 HOH HOH A . F 6 HOH 36 335 335 HOH HOH A . F 6 HOH 37 336 336 HOH HOH A . F 6 HOH 38 337 337 HOH HOH A . F 6 HOH 39 338 338 HOH HOH A . F 6 HOH 40 339 339 HOH HOH A . F 6 HOH 41 340 340 HOH HOH A . F 6 HOH 42 341 341 HOH HOH A . F 6 HOH 43 342 342 HOH HOH A . F 6 HOH 44 343 343 HOH HOH A . F 6 HOH 45 344 344 HOH HOH A . F 6 HOH 46 345 345 HOH HOH A . F 6 HOH 47 346 346 HOH HOH A . F 6 HOH 48 347 347 HOH HOH A . F 6 HOH 49 348 348 HOH HOH A . F 6 HOH 50 349 349 HOH HOH A . F 6 HOH 51 350 350 HOH HOH A . F 6 HOH 52 351 351 HOH HOH A . F 6 HOH 53 352 352 HOH HOH A . F 6 HOH 54 353 353 HOH HOH A . F 6 HOH 55 354 354 HOH HOH A . F 6 HOH 56 355 355 HOH HOH A . F 6 HOH 57 356 356 HOH HOH A . F 6 HOH 58 357 357 HOH HOH A . F 6 HOH 59 358 358 HOH HOH A . F 6 HOH 60 359 359 HOH HOH A . F 6 HOH 61 360 360 HOH HOH A . F 6 HOH 62 361 361 HOH HOH A . F 6 HOH 63 362 362 HOH HOH A . F 6 HOH 64 363 363 HOH HOH A . F 6 HOH 65 364 364 HOH HOH A . F 6 HOH 66 365 365 HOH HOH A . F 6 HOH 67 366 366 HOH HOH A . F 6 HOH 68 367 367 HOH HOH A . F 6 HOH 69 368 368 HOH HOH A . F 6 HOH 70 369 369 HOH HOH A . F 6 HOH 71 370 370 HOH HOH A . F 6 HOH 72 371 371 HOH HOH A . F 6 HOH 73 372 372 HOH HOH A . F 6 HOH 74 373 373 HOH HOH A . F 6 HOH 75 374 374 HOH HOH A . F 6 HOH 76 375 375 HOH HOH A . F 6 HOH 77 376 376 HOH HOH A . F 6 HOH 78 377 377 HOH HOH A . F 6 HOH 79 378 378 HOH HOH A . F 6 HOH 80 379 379 HOH HOH A . F 6 HOH 81 380 380 HOH HOH A . F 6 HOH 82 381 381 HOH HOH A . F 6 HOH 83 382 382 HOH HOH A . F 6 HOH 84 383 383 HOH HOH A . F 6 HOH 85 384 384 HOH HOH A . F 6 HOH 86 385 385 HOH HOH A . F 6 HOH 87 386 386 HOH HOH A . F 6 HOH 88 387 387 HOH HOH A . F 6 HOH 89 388 388 HOH HOH A . F 6 HOH 90 389 389 HOH HOH A . F 6 HOH 91 390 390 HOH HOH A . F 6 HOH 92 391 391 HOH HOH A . F 6 HOH 93 392 392 HOH HOH A . F 6 HOH 94 393 393 HOH HOH A . F 6 HOH 95 394 394 HOH HOH A . F 6 HOH 96 395 395 HOH HOH A . F 6 HOH 97 396 396 HOH HOH A . F 6 HOH 98 397 397 HOH HOH A . F 6 HOH 99 398 398 HOH HOH A . F 6 HOH 100 399 399 HOH HOH A . F 6 HOH 101 400 400 HOH HOH A . F 6 HOH 102 401 401 HOH HOH A . F 6 HOH 103 402 402 HOH HOH A . F 6 HOH 104 403 403 HOH HOH A . F 6 HOH 105 404 404 HOH HOH A . F 6 HOH 106 405 405 HOH HOH A . F 6 HOH 107 406 406 HOH HOH A . F 6 HOH 108 407 407 HOH HOH A . F 6 HOH 109 408 408 HOH HOH A . F 6 HOH 110 409 409 HOH HOH A . F 6 HOH 111 410 410 HOH HOH A . F 6 HOH 112 411 411 HOH HOH A . F 6 HOH 113 412 412 HOH HOH A . F 6 HOH 114 413 413 HOH HOH A . F 6 HOH 115 414 414 HOH HOH A . F 6 HOH 116 415 415 HOH HOH A . F 6 HOH 117 416 416 HOH HOH A . F 6 HOH 118 417 417 HOH HOH A . F 6 HOH 119 418 418 HOH HOH A . F 6 HOH 120 419 419 HOH HOH A . F 6 HOH 121 420 420 HOH HOH A . F 6 HOH 122 421 421 HOH HOH A . F 6 HOH 123 422 422 HOH HOH A . F 6 HOH 124 423 423 HOH HOH A . F 6 HOH 125 424 424 HOH HOH A . F 6 HOH 126 425 425 HOH HOH A . F 6 HOH 127 426 426 HOH HOH A . F 6 HOH 128 427 427 HOH HOH A . F 6 HOH 129 428 428 HOH HOH A . # _pdbx_molecule_features.prd_id PRD_000372 _pdbx_molecule_features.name 'Furoyl-LeusycloTrp; Po1656' _pdbx_molecule_features.type Peptide-like _pdbx_molecule_features.class Inhibitor _pdbx_molecule_features.details ? # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_000372 _pdbx_molecule.asym_id E # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_556 x,x-y,-z+1 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 96.6700000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 9 ? A GLU 9 ? 1_555 CA ? C CA . ? A CA 250 ? 1_555 OD1 ? A ASP 93 ? A ASP 93 ? 1_555 99.4 ? 2 OE2 ? A GLU 9 ? A GLU 9 ? 1_555 CA ? C CA . ? A CA 250 ? 1_555 OD2 ? A ASP 93 ? A ASP 93 ? 1_555 102.5 ? 3 OD1 ? A ASP 93 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 250 ? 1_555 OD2 ? A ASP 93 ? A ASP 93 ? 1_555 56.2 ? 4 OE2 ? A GLU 9 ? A GLU 9 ? 1_555 CA ? C CA . ? A CA 250 ? 1_555 O ? A CYS 197 ? A CYS 197 ? 1_555 171.4 ? 5 OD1 ? A ASP 93 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 250 ? 1_555 O ? A CYS 197 ? A CYS 197 ? 1_555 88.4 ? 6 OD2 ? A ASP 93 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 250 ? 1_555 O ? A CYS 197 ? A CYS 197 ? 1_555 78.7 ? 7 OE2 ? A GLU 9 ? A GLU 9 ? 1_555 CA ? C CA . ? A CA 250 ? 1_555 OD1 ? A ASN 200 ? A ASN 200 ? 1_555 92.1 ? 8 OD1 ? A ASP 93 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 250 ? 1_555 OD1 ? A ASN 200 ? A ASN 200 ? 1_555 151.3 ? 9 OD2 ? A ASP 93 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 250 ? 1_555 OD1 ? A ASN 200 ? A ASN 200 ? 1_555 146.0 ? 10 O ? A CYS 197 ? A CYS 197 ? 1_555 CA ? C CA . ? A CA 250 ? 1_555 OD1 ? A ASN 200 ? A ASN 200 ? 1_555 82.5 ? 11 OE2 ? A GLU 9 ? A GLU 9 ? 1_555 CA ? C CA . ? A CA 250 ? 1_555 O ? F HOH . ? A HOH 307 ? 1_555 81.5 ? 12 OD1 ? A ASP 93 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 250 ? 1_555 O ? F HOH . ? A HOH 307 ? 1_555 131.3 ? 13 OD2 ? A ASP 93 ? A ASP 93 ? 1_555 CA ? C CA . ? A CA 250 ? 1_555 O ? F HOH . ? A HOH 307 ? 1_555 75.9 ? 14 O ? A CYS 197 ? A CYS 197 ? 1_555 CA ? C CA . ? A CA 250 ? 1_555 O ? F HOH . ? A HOH 307 ? 1_555 90.6 ? 15 OD1 ? A ASN 200 ? A ASN 200 ? 1_555 CA ? C CA . ? A CA 250 ? 1_555 O ? F HOH . ? A HOH 307 ? 1_555 76.2 ? 16 NE2 ? A HIS 142 ? A HIS 142 ? 1_555 ZN ? B ZN . ? A ZN 999 ? 1_555 NE2 ? A HIS 146 ? A HIS 146 ? 1_555 102.0 ? 17 NE2 ? A HIS 142 ? A HIS 142 ? 1_555 ZN ? B ZN . ? A ZN 999 ? 1_555 NE2 ? A HIS 152 ? A HIS 152 ? 1_555 97.5 ? 18 NE2 ? A HIS 146 ? A HIS 146 ? 1_555 ZN ? B ZN . ? A ZN 999 ? 1_555 NE2 ? A HIS 152 ? A HIS 152 ? 1_555 108.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-04-15 2 'Structure model' 1 1 2008-03-25 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2012-12-12 5 'Structure model' 1 4 2018-04-18 6 'Structure model' 2 0 2023-08-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Non-polymer description' 6 3 'Structure model' 'Structure summary' 7 3 'Structure model' 'Version format compliance' 8 4 'Structure model' Other 9 5 'Structure model' 'Data collection' 10 5 'Structure model' Other 11 6 'Structure model' 'Database references' 12 6 'Structure model' 'Derived calculations' 13 6 'Structure model' 'Polymer sequence' 14 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' diffrn_detector 2 5 'Structure model' pdbx_database_status 3 6 'Structure model' database_2 4 6 'Structure model' entity_poly 5 6 'Structure model' pdbx_initial_refinement_model 6 6 'Structure model' pdbx_struct_conn_angle 7 6 'Structure model' struct_conn 8 6 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_diffrn_detector.detector' 2 5 'Structure model' '_pdbx_database_status.process_site' 3 6 'Structure model' '_database_2.pdbx_DOI' 4 6 'Structure model' '_database_2.pdbx_database_accession' 5 6 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 6 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 6 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 12 6 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 13 6 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 14 6 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 15 6 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 16 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 17 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 18 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 19 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 20 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 21 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 22 6 'Structure model' '_pdbx_struct_conn_angle.value' 23 6 'Structure model' '_struct_conn.pdbx_dist_value' 24 6 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 25 6 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 26 6 'Structure model' '_struct_conn.ptnr1_label_asym_id' 27 6 'Structure model' '_struct_conn.ptnr1_label_atom_id' 28 6 'Structure model' '_struct_conn.ptnr1_label_comp_id' 29 6 'Structure model' '_struct_conn.ptnr1_label_seq_id' 30 6 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 31 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 32 6 'Structure model' '_struct_conn.ptnr2_label_asym_id' 33 6 'Structure model' '_struct_conn.ptnr2_label_atom_id' 34 6 'Structure model' '_struct_conn.ptnr2_label_comp_id' 35 6 'Structure model' '_struct_conn.ptnr2_label_seq_id' 36 6 'Structure model' '_struct_site.pdbx_auth_asym_id' 37 6 'Structure model' '_struct_site.pdbx_auth_comp_id' 38 6 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MADNES 'data collection' . ? 1 ABSCORR/CCP4 'data reduction' . ? 2 X-PLOR 'model building' 3.1 ? 3 X-PLOR refinement 3.1 ? 4 MADNES 'data reduction' . ? 5 ABSCORR 'data scaling' . ? 6 CCP4 'data scaling' . ? 7 X-PLOR phasing 3.1 ? 8 # _pdbx_entry_details.entry_id 3AIG _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ;THE N-TERMINUS WAS BLOCKED AGAINST AMINOPEPTIDASE ACTIVITY BY GLUTAMINE CYCLIZATION TO RENDER PYROGLUTAMATE. THIS RESIDUE WAS NOT MODELLED DUE TO LACK OF DENSITY. ; _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THE SEQUENCE USED IN THIS ENTRY WAS DETERMINED BY A COMBINATION OF CHEMICAL AND X-RAY SEQUENCING. ; _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 22 ? ? -93.26 31.05 2 1 ARG A 89 ? ? -95.92 -147.39 3 1 CYS A 117 ? ? 84.31 -8.42 4 1 MET A 166 ? ? -90.14 33.90 5 1 PRO A 172 ? ? -63.56 81.31 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id PCA _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id PCA _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'CALCIUM ION' CA 4 'SULFATE ION' SO4 5 '(3R)-2-[N-(furan-2-ylcarbonyl)-L-leucyl]-2,3,4,9-tetrahydro-1H-beta-carboline-3-carboxylic acid' 0ZC 6 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1IAG _pdbx_initial_refinement_model.details 'NATIVE ADAMALYSIN II (PDB ENTRY 1IAG)' #