data_3B57 # _entry.id 3B57 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.289 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3B57 RCSB RCSB045093 WWPDB D_1000045093 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type TargetDB LkR65 . unspecified PDB 2QGS 'Crystal structure of SE1688 protein from Staphylococcus epidermidis' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3B57 _pdbx_database_status.recvd_initial_deposition_date 2007-10-25 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kuzin, A.P.' 1 'Abashidze, M.' 2 'Seetharaman, J.' 3 'Benach, J.' 4 'Forouhar, F.' 5 'Vorobiev, S.M.' 6 'Wang, H.' 7 'Janjua, H.' 8 'Cunningham, K.' 9 'Ma, L.-C.' 10 'Xiao, R.' 11 'Liu, J.' 12 'Baran, M.C.' 13 'Acton, T.B.' 14 'Rost, B.' 15 'Montelione, G.T.' 16 'Tong, L.' 17 'Hunt, J.F.' 18 'Northeast Structural Genomics Consortium (NESG)' 19 # _citation.id primary _citation.title 'Crystal structure of the Lin1889 protein (Q92AN1) from Listeria innocua.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kuzin, A.P.' 1 primary 'Abashidze, M.' 2 primary 'Seetharaman, J.' 3 primary 'Benach, J.' 4 primary 'Forouhar, F.' 5 primary 'Vorobiev, S.M.' 6 primary 'Wang, H.' 7 primary 'Janjua, H.' 8 primary 'Cunningham, K.' 9 primary 'Ma, L.-C.' 10 primary 'Xiao, R.' 11 primary 'Liu, J.' 12 primary 'Baran, M.C.' 13 primary 'Acton, T.B.' 14 primary 'Rost, B.' 15 primary 'Montelione, G.T.' 16 primary 'Tong, L.' 17 primary 'Hunt, J.F.' 18 # _cell.entry_id 3B57 _cell.length_a 126.487 _cell.length_b 126.487 _cell.length_c 126.487 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3B57 _symmetry.space_group_name_H-M 'P 41 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 213 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Lin1889 protein' 24522.377 1 ? ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)NKEEIILSAKNW(MSE)HSHFENETTGHDWSHIKRVWKLSKEIQSKEGGDLFTIELAALFHDYSDIKLTTDEQEA TKTLINW(MSE)ETKEIPSELIKKIIRIIQSVSFKKGKNTFKALTIEEKIVQDADRLDAIGAIGIARTFTYGGAHNREIA NQNNPKNTTLQHFYDKLLLIKDQLNTETAKTIAKEKQKI(MSE)QDFIQALEKELKVLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MNKEEIILSAKNWMHSHFENETTGHDWSHIKRVWKLSKEIQSKEGGDLFTIELAALFHDYSDIKLTTDEQEATKTLINWM ETKEIPSELIKKIIRIIQSVSFKKGKNTFKALTIEEKIVQDADRLDAIGAIGIARTFTYGGAHNREIANQNNPKNTTLQH FYDKLLLIKDQLNTETAKTIAKEKQKIMQDFIQALEKELKVLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier LkR65 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ASN n 1 3 LYS n 1 4 GLU n 1 5 GLU n 1 6 ILE n 1 7 ILE n 1 8 LEU n 1 9 SER n 1 10 ALA n 1 11 LYS n 1 12 ASN n 1 13 TRP n 1 14 MSE n 1 15 HIS n 1 16 SER n 1 17 HIS n 1 18 PHE n 1 19 GLU n 1 20 ASN n 1 21 GLU n 1 22 THR n 1 23 THR n 1 24 GLY n 1 25 HIS n 1 26 ASP n 1 27 TRP n 1 28 SER n 1 29 HIS n 1 30 ILE n 1 31 LYS n 1 32 ARG n 1 33 VAL n 1 34 TRP n 1 35 LYS n 1 36 LEU n 1 37 SER n 1 38 LYS n 1 39 GLU n 1 40 ILE n 1 41 GLN n 1 42 SER n 1 43 LYS n 1 44 GLU n 1 45 GLY n 1 46 GLY n 1 47 ASP n 1 48 LEU n 1 49 PHE n 1 50 THR n 1 51 ILE n 1 52 GLU n 1 53 LEU n 1 54 ALA n 1 55 ALA n 1 56 LEU n 1 57 PHE n 1 58 HIS n 1 59 ASP n 1 60 TYR n 1 61 SER n 1 62 ASP n 1 63 ILE n 1 64 LYS n 1 65 LEU n 1 66 THR n 1 67 THR n 1 68 ASP n 1 69 GLU n 1 70 GLN n 1 71 GLU n 1 72 ALA n 1 73 THR n 1 74 LYS n 1 75 THR n 1 76 LEU n 1 77 ILE n 1 78 ASN n 1 79 TRP n 1 80 MSE n 1 81 GLU n 1 82 THR n 1 83 LYS n 1 84 GLU n 1 85 ILE n 1 86 PRO n 1 87 SER n 1 88 GLU n 1 89 LEU n 1 90 ILE n 1 91 LYS n 1 92 LYS n 1 93 ILE n 1 94 ILE n 1 95 ARG n 1 96 ILE n 1 97 ILE n 1 98 GLN n 1 99 SER n 1 100 VAL n 1 101 SER n 1 102 PHE n 1 103 LYS n 1 104 LYS n 1 105 GLY n 1 106 LYS n 1 107 ASN n 1 108 THR n 1 109 PHE n 1 110 LYS n 1 111 ALA n 1 112 LEU n 1 113 THR n 1 114 ILE n 1 115 GLU n 1 116 GLU n 1 117 LYS n 1 118 ILE n 1 119 VAL n 1 120 GLN n 1 121 ASP n 1 122 ALA n 1 123 ASP n 1 124 ARG n 1 125 LEU n 1 126 ASP n 1 127 ALA n 1 128 ILE n 1 129 GLY n 1 130 ALA n 1 131 ILE n 1 132 GLY n 1 133 ILE n 1 134 ALA n 1 135 ARG n 1 136 THR n 1 137 PHE n 1 138 THR n 1 139 TYR n 1 140 GLY n 1 141 GLY n 1 142 ALA n 1 143 HIS n 1 144 ASN n 1 145 ARG n 1 146 GLU n 1 147 ILE n 1 148 ALA n 1 149 ASN n 1 150 GLN n 1 151 ASN n 1 152 ASN n 1 153 PRO n 1 154 LYS n 1 155 ASN n 1 156 THR n 1 157 THR n 1 158 LEU n 1 159 GLN n 1 160 HIS n 1 161 PHE n 1 162 TYR n 1 163 ASP n 1 164 LYS n 1 165 LEU n 1 166 LEU n 1 167 LEU n 1 168 ILE n 1 169 LYS n 1 170 ASP n 1 171 GLN n 1 172 LEU n 1 173 ASN n 1 174 THR n 1 175 GLU n 1 176 THR n 1 177 ALA n 1 178 LYS n 1 179 THR n 1 180 ILE n 1 181 ALA n 1 182 LYS n 1 183 GLU n 1 184 LYS n 1 185 GLN n 1 186 LYS n 1 187 ILE n 1 188 MSE n 1 189 GLN n 1 190 ASP n 1 191 PHE n 1 192 ILE n 1 193 GLN n 1 194 ALA n 1 195 LEU n 1 196 GLU n 1 197 LYS n 1 198 GLU n 1 199 LEU n 1 200 LYS n 1 201 VAL n 1 202 LEU n 1 203 GLU n 1 204 HIS n 1 205 HIS n 1 206 HIS n 1 207 HIS n 1 208 HIS n 1 209 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Listeria _entity_src_gen.pdbx_gene_src_gene lin1889 _entity_src_gen.gene_src_species 'Listeria innocua' _entity_src_gen.gene_src_strain 'Clip11262 / Serovar 6a' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Listeria innocua Clip11262' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 272626 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q92AN1_LISIN _struct_ref.pdbx_db_accession Q92AN1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNKEEIILSAKNWMHSHFENETTGHDWSHIKRVWKLSKEIQSKEGGDLFTIELAALFHDYSDIKLTTDEQEATKTLINWM ETKEIPSELIKKIIRIIQSVSFKKGKNTFKALTIEEKIVQDADRLDAIGAIGIARTFTYGGAHNREIANQNNPKNTTLQH FYDKLLLIKDQLNTETAKTIAKEKQKIMQDFIQALEKELKV ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3B57 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 201 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q92AN1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 201 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 201 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3B57 LEU A 202 ? UNP Q92AN1 ? ? 'EXPRESSION TAG' 202 1 1 3B57 GLU A 203 ? UNP Q92AN1 ? ? 'EXPRESSION TAG' 203 2 1 3B57 HIS A 204 ? UNP Q92AN1 ? ? 'EXPRESSION TAG' 204 3 1 3B57 HIS A 205 ? UNP Q92AN1 ? ? 'EXPRESSION TAG' 205 4 1 3B57 HIS A 206 ? UNP Q92AN1 ? ? 'EXPRESSION TAG' 206 5 1 3B57 HIS A 207 ? UNP Q92AN1 ? ? 'EXPRESSION TAG' 207 6 1 3B57 HIS A 208 ? UNP Q92AN1 ? ? 'EXPRESSION TAG' 208 7 1 3B57 HIS A 209 ? UNP Q92AN1 ? ? 'EXPRESSION TAG' 209 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3B57 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.44 _exptl_crystal.density_percent_sol 64.23 _exptl_crystal.description 'The structure factor file contains Friedel pairs' _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details '2M (NH4)2HPO4, 100 mM MOPS, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97900 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97900 # _reflns.entry_id 3B57 _reflns.observed_criterion_sigma_I -3.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 44.72 _reflns.d_resolution_high 3.0 _reflns.number_obs 13151 _reflns.number_all ? _reflns.percent_possible_obs 98.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 3.00 _reflns_shell.d_res_low 3.05 _reflns_shell.percent_possible_all 92.1 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3B57 _refine.ls_number_reflns_obs 12200 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 69895.96 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 44.72 _refine.ls_d_res_high 3.00 _refine.ls_percent_reflns_obs 93.1 _refine.ls_R_factor_obs 0.216 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2138 _refine.ls_R_factor_R_free 0.2497 _refine.ls_R_factor_R_free_error 0.010 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 624 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 48.6 _refine.aniso_B[1][1] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[3][3] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BULK SOLVENT MODEL USED' _refine.solvent_model_param_ksol 0.35 _refine.solvent_model_param_bsol 22.075 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'The Friedel pairs were used in phasing' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3B57 _refine_analyze.Luzzati_coordinate_error_obs 0.34 _refine_analyze.Luzzati_sigma_a_obs 0.44 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.44 _refine_analyze.Luzzati_sigma_a_free 0.59 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1469 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1470 _refine_hist.d_res_high 3.00 _refine_hist.d_res_low 44.72 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.007488 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.04752 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 19.9 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.71 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.517 1.5 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.703 2.0 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 1.924 2.0 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 3.123 2.5 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 3.00 _refine_ls_shell.d_res_low 3.19 _refine_ls_shell.number_reflns_R_work 1721 _refine_ls_shell.R_factor_R_work 0.285 _refine_ls_shell.percent_reflns_obs 84.7 _refine_ls_shell.R_factor_R_free 0.332 _refine_ls_shell.R_factor_R_free_error 0.033 _refine_ls_shell.percent_reflns_R_free 5.4 _refine_ls_shell.number_reflns_R_free 99 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 ion.param ion.top 'X-RAY DIFFRACTION' # _struct.entry_id 3B57 _struct.title 'Crystal structure of the Lin1889 protein (Q92AN1) from Listeria innocua. Northeast Structural Consortium target LkR65' _struct.pdbx_descriptor 'Lin1889 protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3B57 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;Lin1889, Q92AN1, NESG, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 2 ? SER A 16 ? ASN A 2 SER A 16 1 ? 15 HELX_P HELX_P2 2 ASP A 26 ? GLY A 45 ? ASP A 26 GLY A 45 1 ? 20 HELX_P HELX_P3 3 ASP A 47 ? HIS A 58 ? ASP A 47 HIS A 58 1 ? 12 HELX_P HELX_P4 4 GLN A 70 ? LYS A 83 ? GLN A 70 LYS A 83 1 ? 14 HELX_P HELX_P5 5 PRO A 86 ? SER A 101 ? PRO A 86 SER A 101 1 ? 16 HELX_P HELX_P6 6 THR A 113 ? ASP A 126 ? THR A 113 ASP A 126 1 ? 14 HELX_P HELX_P7 7 ILE A 128 ? GLY A 141 ? ILE A 128 GLY A 141 1 ? 14 HELX_P HELX_P8 8 THR A 156 ? LYS A 164 ? THR A 156 LYS A 164 1 ? 9 HELX_P HELX_P9 9 LYS A 164 ? LEU A 172 ? LYS A 164 LEU A 172 1 ? 9 HELX_P HELX_P10 10 THR A 174 ? ILE A 180 ? THR A 174 ILE A 180 1 ? 7 HELX_P HELX_P11 11 ALA A 181 ? LEU A 199 ? ALA A 181 LEU A 199 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A MSE 1 C ? ? ? 1_555 A ASN 2 N ? ? A MSE 1 A ASN 2 1_555 ? ? ? ? ? ? ? 1.333 ? covale2 covale ? ? A TRP 13 C ? ? ? 1_555 A MSE 14 N ? ? A TRP 13 A MSE 14 1_555 ? ? ? ? ? ? ? 1.329 ? covale3 covale ? ? A MSE 14 C ? ? ? 1_555 A HIS 15 N ? ? A MSE 14 A HIS 15 1_555 ? ? ? ? ? ? ? 1.329 ? covale4 covale ? ? A TRP 79 C ? ? ? 1_555 A MSE 80 N ? ? A TRP 79 A MSE 80 1_555 ? ? ? ? ? ? ? 1.329 ? covale5 covale ? ? A MSE 80 C ? ? ? 1_555 A GLU 81 N ? ? A MSE 80 A GLU 81 1_555 ? ? ? ? ? ? ? 1.329 ? covale6 covale ? ? A ILE 187 C ? ? ? 1_555 A MSE 188 N ? ? A ILE 187 A MSE 188 1_555 ? ? ? ? ? ? ? 1.322 ? covale7 covale ? ? A MSE 188 C ? ? ? 1_555 A GLN 189 N ? ? A MSE 188 A GLN 189 1_555 ? ? ? ? ? ? ? 1.328 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE MG A 210' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 29 ? HIS A 29 . ? 1_555 ? 2 AC1 4 HIS A 58 ? HIS A 58 . ? 1_555 ? 3 AC1 4 ASP A 59 ? ASP A 59 . ? 1_555 ? 4 AC1 4 ASP A 123 ? ASP A 123 . ? 1_555 ? # _database_PDB_matrix.entry_id 3B57 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3B57 _atom_sites.fract_transf_matrix[1][1] 0.007906 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007906 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007906 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 TRP 13 13 13 TRP TRP A . n A 1 14 MSE 14 14 14 MSE MSE A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 GLU 19 19 ? ? ? A . n A 1 20 ASN 20 20 ? ? ? A . n A 1 21 GLU 21 21 ? ? ? A . n A 1 22 THR 22 22 ? ? ? A . n A 1 23 THR 23 23 ? ? ? A . n A 1 24 GLY 24 24 ? ? ? A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 TRP 34 34 34 TRP TRP A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 ILE 63 63 ? ? ? A . n A 1 64 LYS 64 64 ? ? ? A . n A 1 65 LEU 65 65 ? ? ? A . n A 1 66 THR 66 66 ? ? ? A . n A 1 67 THR 67 67 ? ? ? A . n A 1 68 ASP 68 68 ? ? ? A . n A 1 69 GLU 69 69 ? ? ? A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 TRP 79 79 79 TRP TRP A . n A 1 80 MSE 80 80 80 MSE MSE A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 PHE 102 102 ? ? ? A . n A 1 103 LYS 103 103 ? ? ? A . n A 1 104 LYS 104 104 ? ? ? A . n A 1 105 GLY 105 105 ? ? ? A . n A 1 106 LYS 106 106 ? ? ? A . n A 1 107 ASN 107 107 ? ? ? A . n A 1 108 THR 108 108 ? ? ? A . n A 1 109 PHE 109 109 ? ? ? A . n A 1 110 LYS 110 110 ? ? ? A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 HIS 143 143 143 HIS HIS A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 ASN 151 151 151 ASN ASN A . n A 1 152 ASN 152 152 ? ? ? A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 ASN 155 155 155 ASN ASN A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 HIS 160 160 160 HIS HIS A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 TYR 162 162 162 TYR TYR A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 LYS 164 164 164 LYS LYS A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 LYS 169 169 169 LYS LYS A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 GLN 171 171 171 GLN GLN A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 THR 174 174 174 THR THR A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 THR 176 176 176 THR THR A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 GLN 185 185 185 GLN GLN A . n A 1 186 LYS 186 186 186 LYS LYS A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 MSE 188 188 188 MSE MSE A . n A 1 189 GLN 189 189 189 GLN GLN A . n A 1 190 ASP 190 190 190 ASP ASP A . n A 1 191 PHE 191 191 191 PHE PHE A . n A 1 192 ILE 192 192 192 ILE ILE A . n A 1 193 GLN 193 193 193 GLN GLN A . n A 1 194 ALA 194 194 194 ALA ALA A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 GLU 196 196 196 GLU GLU A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 GLU 198 198 198 GLU GLU A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 LYS 200 200 200 LYS LYS A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 HIS 204 204 ? ? ? A . n A 1 205 HIS 205 205 ? ? ? A . n A 1 206 HIS 206 206 ? ? ? A . n A 1 207 HIS 207 207 ? ? ? A . n A 1 208 HIS 208 208 ? ? ? A . n A 1 209 HIS 209 209 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id MG _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 210 _pdbx_nonpoly_scheme.auth_seq_num 210 _pdbx_nonpoly_scheme.pdb_mon_id MG _pdbx_nonpoly_scheme.auth_mon_id MG _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 14 A MSE 14 ? MET SELENOMETHIONINE 3 A MSE 80 A MSE 80 ? MET SELENOMETHIONINE 4 A MSE 188 A MSE 188 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_prop.biol_id 1 _pdbx_struct_assembly_prop.type 'ABSA (A^2)' _pdbx_struct_assembly_prop.value 2820 _pdbx_struct_assembly_prop.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 22_564 z+1/4,-y+5/4,x-1/4 0.0000000000 0.0000000000 1.0000000000 31.6217500000 0.0000000000 -1.0000000000 0.0000000000 158.1087500000 1.0000000000 0.0000000000 0.0000000000 -31.6217500000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-11-06 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2018-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' audit_author 2 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_audit_author.name' 2 3 'Structure model' '_citation_author.name' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.2 ? 1 ADSC 'data collection' Quantum ? 2 HKL-2000 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 SnB phasing . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 16 ? ? -83.53 39.04 2 1 ASP A 26 ? ? -77.38 -166.44 3 1 SER A 42 ? ? -57.75 -5.91 4 1 VAL A 100 ? ? -91.06 -78.95 5 1 HIS A 143 ? ? -144.55 19.52 6 1 ASN A 149 ? ? -176.80 90.77 7 1 LYS A 164 ? ? -114.92 -84.06 8 1 LEU A 165 ? ? -21.93 -68.96 9 1 LYS A 169 ? ? -39.51 -31.81 10 1 ASN A 173 ? ? -109.65 49.98 11 1 VAL A 201 ? ? 58.87 84.79 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 19 ? A GLU 19 2 1 Y 1 A ASN 20 ? A ASN 20 3 1 Y 1 A GLU 21 ? A GLU 21 4 1 Y 1 A THR 22 ? A THR 22 5 1 Y 1 A THR 23 ? A THR 23 6 1 Y 1 A GLY 24 ? A GLY 24 7 1 Y 1 A ILE 63 ? A ILE 63 8 1 Y 1 A LYS 64 ? A LYS 64 9 1 Y 1 A LEU 65 ? A LEU 65 10 1 Y 1 A THR 66 ? A THR 66 11 1 Y 1 A THR 67 ? A THR 67 12 1 Y 1 A ASP 68 ? A ASP 68 13 1 Y 1 A GLU 69 ? A GLU 69 14 1 Y 1 A PHE 102 ? A PHE 102 15 1 Y 1 A LYS 103 ? A LYS 103 16 1 Y 1 A LYS 104 ? A LYS 104 17 1 Y 1 A GLY 105 ? A GLY 105 18 1 Y 1 A LYS 106 ? A LYS 106 19 1 Y 1 A ASN 107 ? A ASN 107 20 1 Y 1 A THR 108 ? A THR 108 21 1 Y 1 A PHE 109 ? A PHE 109 22 1 Y 1 A LYS 110 ? A LYS 110 23 1 Y 1 A ASN 152 ? A ASN 152 24 1 Y 1 A HIS 204 ? A HIS 204 25 1 Y 1 A HIS 205 ? A HIS 205 26 1 Y 1 A HIS 206 ? A HIS 206 27 1 Y 1 A HIS 207 ? A HIS 207 28 1 Y 1 A HIS 208 ? A HIS 208 29 1 Y 1 A HIS 209 ? A HIS 209 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'MAGNESIUM ION' _pdbx_entity_nonpoly.comp_id MG #