data_3BX6 # _entry.id 3BX6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3BX6 RCSB RCSB046067 WWPDB D_1000046067 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2010-02-09 _pdbx_database_PDB_obs_spr.pdb_id 3KQ0 _pdbx_database_PDB_obs_spr.replace_pdb_id 3BX6 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.entry_id 3BX6 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-01-11 _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Schonfeld, D.L.' 1 'Ravelli, R.B.G.' 2 'Mueller, U.' 3 'Skerra, A.' 4 # _citation.id primary _citation.title ;The 1.8-A crystal structure of alpha1-acid glycoprotein (Orosomucoid) solved by UV RIP reveals the broad drug-binding activity of this human plasma lipocalin. ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 384 _citation.page_first 393 _citation.page_last 405 _citation.year 2008 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18823996 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2008.09.020 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Schonfeld, D.L.' 1 primary 'Ravelli, R.B.' 2 primary 'Mueller, U.' 3 primary 'Skerra, A.' 4 # _cell.entry_id 3BX6 _cell.length_a 78.894 _cell.length_b 78.894 _cell.length_c 93.384 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3BX6 _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Alpha-1-acid glycoprotein' 22698.303 1 ? ? ? ? 2 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143 1 ? ? ? ? 3 water nat water 18.015 137 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'AGP, Orosomucoid' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLN VQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDW KKDKCEPLEKQHEKERKQEEGESAWSHPQFEK ; _entity_poly.pdbx_seq_one_letter_code_can ;QIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLN VQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDW KKDKCEPLEKQHEKERKQEEGESAWSHPQFEK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 ILE n 1 3 PRO n 1 4 LEU n 1 5 CYS n 1 6 ALA n 1 7 ASN n 1 8 LEU n 1 9 VAL n 1 10 PRO n 1 11 VAL n 1 12 PRO n 1 13 ILE n 1 14 THR n 1 15 ASN n 1 16 ALA n 1 17 THR n 1 18 LEU n 1 19 ASP n 1 20 GLN n 1 21 ILE n 1 22 THR n 1 23 GLY n 1 24 LYS n 1 25 TRP n 1 26 PHE n 1 27 TYR n 1 28 ILE n 1 29 ALA n 1 30 SER n 1 31 ALA n 1 32 PHE n 1 33 ARG n 1 34 ASN n 1 35 GLU n 1 36 GLU n 1 37 TYR n 1 38 ASN n 1 39 LYS n 1 40 SER n 1 41 VAL n 1 42 GLN n 1 43 GLU n 1 44 ILE n 1 45 GLN n 1 46 ALA n 1 47 THR n 1 48 PHE n 1 49 PHE n 1 50 TYR n 1 51 PHE n 1 52 THR n 1 53 PRO n 1 54 ASN n 1 55 LYS n 1 56 THR n 1 57 GLU n 1 58 ASP n 1 59 THR n 1 60 ILE n 1 61 PHE n 1 62 LEU n 1 63 ARG n 1 64 GLU n 1 65 TYR n 1 66 GLN n 1 67 THR n 1 68 ARG n 1 69 GLN n 1 70 ASP n 1 71 GLN n 1 72 CYS n 1 73 ILE n 1 74 TYR n 1 75 ASN n 1 76 THR n 1 77 THR n 1 78 TYR n 1 79 LEU n 1 80 ASN n 1 81 VAL n 1 82 GLN n 1 83 ARG n 1 84 GLU n 1 85 ASN n 1 86 GLY n 1 87 THR n 1 88 ILE n 1 89 SER n 1 90 ARG n 1 91 TYR n 1 92 VAL n 1 93 GLY n 1 94 GLY n 1 95 GLN n 1 96 GLU n 1 97 HIS n 1 98 PHE n 1 99 ALA n 1 100 HIS n 1 101 LEU n 1 102 LEU n 1 103 ILE n 1 104 LEU n 1 105 ARG n 1 106 ASP n 1 107 THR n 1 108 LYS n 1 109 THR n 1 110 TYR n 1 111 MET n 1 112 LEU n 1 113 ALA n 1 114 PHE n 1 115 ASP n 1 116 VAL n 1 117 ASN n 1 118 ASP n 1 119 GLU n 1 120 LYS n 1 121 ASN n 1 122 TRP n 1 123 GLY n 1 124 LEU n 1 125 SER n 1 126 VAL n 1 127 TYR n 1 128 ALA n 1 129 ASP n 1 130 LYS n 1 131 PRO n 1 132 GLU n 1 133 THR n 1 134 THR n 1 135 LYS n 1 136 GLU n 1 137 GLN n 1 138 LEU n 1 139 GLY n 1 140 GLU n 1 141 PHE n 1 142 TYR n 1 143 GLU n 1 144 ALA n 1 145 LEU n 1 146 ASP n 1 147 CYS n 1 148 LEU n 1 149 ARG n 1 150 ILE n 1 151 PRO n 1 152 LYS n 1 153 SER n 1 154 ASP n 1 155 VAL n 1 156 VAL n 1 157 TYR n 1 158 THR n 1 159 ASP n 1 160 TRP n 1 161 LYS n 1 162 LYS n 1 163 ASP n 1 164 LYS n 1 165 CYS n 1 166 GLU n 1 167 PRO n 1 168 LEU n 1 169 GLU n 1 170 LYS n 1 171 GLN n 1 172 HIS n 1 173 GLU n 1 174 LYS n 1 175 GLU n 1 176 ARG n 1 177 LYS n 1 178 GLN n 1 179 GLU n 1 180 GLU n 1 181 GLY n 1 182 GLU n 1 183 SER n 1 184 ALA n 1 185 TRP n 1 186 SER n 1 187 HIS n 1 188 PRO n 1 189 GLN n 1 190 PHE n 1 191 GLU n 1 192 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ORM, ORM1, AGP1, AGP-A' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain MC4100deltaSKP _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pAGP1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A1AG1_HUMAN _struct_ref.pdbx_db_accession P02763 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLN VQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDW KKDKCEPLEKQHEKERKQEEGES ; _struct_ref.pdbx_align_begin 19 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3BX6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 183 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02763 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 201 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 183 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3BX6 ALA A 184 ? UNP P02763 ? ? 'EXPRESSION TAG' 184 1 1 3BX6 TRP A 185 ? UNP P02763 ? ? 'EXPRESSION TAG' 185 2 1 3BX6 SER A 186 ? UNP P02763 ? ? 'EXPRESSION TAG' 186 3 1 3BX6 HIS A 187 ? UNP P02763 ? ? 'EXPRESSION TAG' 187 4 1 3BX6 PRO A 188 ? UNP P02763 ? ? 'EXPRESSION TAG' 188 5 1 3BX6 GLN A 189 ? UNP P02763 ? ? 'EXPRESSION TAG' 189 6 1 3BX6 PHE A 190 ? UNP P02763 ? ? 'EXPRESSION TAG' 190 7 1 3BX6 GLU A 191 ? UNP P02763 ? ? 'EXPRESSION TAG' 191 8 1 3BX6 LYS A 192 ? UNP P02763 ? ? 'EXPRESSION TAG' 192 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TRS non-polymer . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1' 122.143 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3BX6 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 2 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.20 _exptl_crystal.density_percent_sol 61.57 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_details '1.9-2.2 M sodium/potassium phosphate, pH 6.4-6.9, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # loop_ _diffrn.id _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.crystal_id 1 100 ? 1 2 100 ? 1 # loop_ _diffrn_detector.diffrn_id _diffrn_detector.detector _diffrn_detector.type _diffrn_detector.pdbx_collection_date _diffrn_detector.details 1 CCD 'MARMOSAIC 225 mm CCD' 2007-03-09 ? 2 CCD 'ADSC QUANTUM 315' 2006-03-13 ? # loop_ _diffrn_radiation.diffrn_id _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.monochromator _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_scattering_type 1 1 M mirror 'SINGLE WAVELENGTH' x-ray 2 1 M mirror 'SINGLE WAVELENGTH' x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9184 1.0 2 1.0054 1.0 # loop_ _diffrn_source.diffrn_id _diffrn_source.source _diffrn_source.type _diffrn_source.pdbx_synchrotron_site _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_wavelength_list 1 SYNCHROTRON 'BESSY BEAMLINE 14.1' BESSY 14.1 ? 0.9184 2 SYNCHROTRON 'ESRF BEAMLINE ID23-1' ESRF ID23-1 ? 1.0054 # _reflns.entry_id 3BX6 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 1.8 _reflns.number_obs 26679 _reflns.number_all ? _reflns.percent_possible_obs 97.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 5.9 _reflns.pdbx_netI_over_sigmaI 31.5 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 9.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1,2 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.86 _reflns_shell.percent_possible_all 82.3 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 40.6 _reflns_shell.meanI_over_sigI_obs 3.0 _reflns_shell.pdbx_redundancy 6.9 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3BX6 _refine.ls_number_reflns_obs 25899 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 1.80 _refine.ls_percent_reflns_obs 97.59 _refine.ls_R_factor_obs 0.21659 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.21560 _refine.ls_R_factor_R_free 0.23576 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 1374 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.948 _refine.correlation_coeff_Fo_to_Fc_free 0.943 _refine.B_iso_mean 30.081 _refine.aniso_B[1][1] -0.79 _refine.aniso_B[2][2] -0.79 _refine.aniso_B[3][3] 1.58 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct UV-RIP _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.110 _refine.pdbx_overall_ESU_R_Free 0.105 _refine.overall_SU_ML 0.071 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 2.254 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1364 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.number_atoms_solvent 137 _refine_hist.number_atoms_total 1509 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.015 0.022 ? 1409 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.390 1.937 ? 1928 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.354 5.000 ? 171 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 37.601 24.571 ? 70 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 12.100 15.000 ? 207 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 15.189 15.000 ? 6 'X-RAY DIFFRACTION' ? r_chiral_restr 0.100 0.200 ? 214 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.020 ? 1097 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.225 0.200 ? 713 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.309 0.200 ? 966 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.129 0.200 ? 46 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.217 0.200 ? 46 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.062 0.200 ? 4 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.051 1.500 ? 884 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.758 2.000 ? 1393 'X-RAY DIFFRACTION' ? r_scbond_it 2.569 3.000 ? 608 'X-RAY DIFFRACTION' ? r_scangle_it 3.519 4.500 ? 535 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.800 _refine_ls_shell.d_res_low 1.847 _refine_ls_shell.number_reflns_R_work 1547 _refine_ls_shell.R_factor_R_work 0.290 _refine_ls_shell.percent_reflns_obs 81.18 _refine_ls_shell.R_factor_R_free 0.352 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 84 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param ? 'X-RAY DIFFRACTION' 2 water_rep.param ? 'X-RAY DIFFRACTION' 3 tam.par ? 'X-RAY DIFFRACTION' # _struct.entry_id 3BX6 _struct.title 'Crystal structure of human alpha 1 acid glycoprotein' _struct.pdbx_descriptor 'Alpha-1-acid glycoprotein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3BX6 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'Plasma Protein, Acute phase protein, Glycoprotein, Polymorphism, Pyrrolidone carboxylic acid, SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 5 ? VAL A 9 ? CYS A 5 VAL A 9 5 ? 5 HELX_P HELX_P2 2 THR A 14 ? THR A 22 ? THR A 14 THR A 22 1 ? 9 HELX_P HELX_P3 3 ASN A 34 ? GLN A 42 ? ASN A 34 GLN A 42 1 ? 9 HELX_P HELX_P4 4 ASP A 118 ? ASN A 121 ? ASP A 118 ASN A 121 5 ? 4 HELX_P HELX_P5 5 LEU A 138 ? ARG A 149 ? LEU A 138 ARG A 149 1 ? 12 HELX_P HELX_P6 6 PRO A 151 ? VAL A 155 ? PRO A 151 VAL A 155 5 ? 5 HELX_P HELX_P7 7 ASP A 159 ? ASP A 163 ? ASP A 159 ASP A 163 5 ? 5 HELX_P HELX_P8 8 CYS A 165 ? HIS A 172 ? CYS A 165 HIS A 172 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 147 SG ? ? A CYS 5 A CYS 147 1_555 ? ? ? ? ? ? ? 2.028 ? disulf2 disulf ? ? A CYS 72 SG ? ? ? 1_555 A CYS 165 SG ? ? A CYS 72 A CYS 165 1_555 ? ? ? ? ? ? ? 2.095 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel A 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 156 ? TYR A 157 ? VAL A 156 TYR A 157 A 2 GLY A 23 ? PHE A 32 ? GLY A 23 PHE A 32 A 3 GLY A 123 ? ALA A 128 ? GLY A 123 ALA A 128 A 4 THR A 109 ? PHE A 114 ? THR A 109 PHE A 114 A 5 GLN A 95 ? ILE A 103 ? GLN A 95 ILE A 103 A 6 THR A 87 ? VAL A 92 ? THR A 87 VAL A 92 A 7 GLN A 71 ? GLN A 82 ? GLN A 71 GLN A 82 A 8 THR A 59 ? ARG A 68 ? THR A 59 ARG A 68 A 9 ILE A 44 ? ASN A 54 ? ILE A 44 ASN A 54 A 10 GLY A 23 ? PHE A 32 ? GLY A 23 PHE A 32 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 156 ? O VAL A 156 N SER A 30 ? N SER A 30 A 2 3 N PHE A 26 ? N PHE A 26 O ALA A 128 ? O ALA A 128 A 3 4 O TYR A 127 ? O TYR A 127 N TYR A 110 ? N TYR A 110 A 4 5 O MET A 111 ? O MET A 111 N LEU A 102 ? N LEU A 102 A 5 6 O GLN A 95 ? O GLN A 95 N VAL A 92 ? N VAL A 92 A 6 7 O THR A 87 ? O THR A 87 N GLN A 82 ? N GLN A 82 A 7 8 O ASN A 75 ? O ASN A 75 N GLU A 64 ? N GLU A 64 A 8 9 O TYR A 65 ? O TYR A 65 N PHE A 48 ? N PHE A 48 A 9 10 O THR A 47 ? O THR A 47 N TYR A 27 ? N TYR A 27 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE TRS A 193' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 LEU A 62 ? LEU A 62 . ? 1_555 ? 2 AC1 5 ARG A 90 ? ARG A 90 . ? 1_555 ? 3 AC1 5 LEU A 112 ? LEU A 112 . ? 1_555 ? 4 AC1 5 TYR A 127 ? TYR A 127 . ? 1_555 ? 5 AC1 5 HOH C . ? HOH A 300 . ? 1_555 ? # _atom_sites.entry_id 3BX6 _atom_sites.fract_transf_matrix[1][1] 0.012675 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012675 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010708 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 1 1 GLN GLN A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 TRP 25 25 25 TRP TRP A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 MET 111 111 111 MET MET A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 TRP 122 122 122 TRP TRP A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 PRO 131 131 131 PRO PRO A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 TYR 142 142 142 TYR TYR A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 CYS 147 147 147 CYS CYS A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 PRO 151 151 151 PRO PRO A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 TRP 160 160 160 TRP TRP A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 LYS 164 164 164 LYS LYS A . n A 1 165 CYS 165 165 165 CYS CYS A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 PRO 167 167 167 PRO PRO A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 LYS 170 170 170 LYS LYS A . n A 1 171 GLN 171 171 171 GLN GLN A . n A 1 172 HIS 172 172 172 HIS HIS A . n A 1 173 GLU 173 173 ? ? ? A . n A 1 174 LYS 174 174 ? ? ? A . n A 1 175 GLU 175 175 ? ? ? A . n A 1 176 ARG 176 176 ? ? ? A . n A 1 177 LYS 177 177 ? ? ? A . n A 1 178 GLN 178 178 ? ? ? A . n A 1 179 GLU 179 179 ? ? ? A . n A 1 180 GLU 180 180 ? ? ? A . n A 1 181 GLY 181 181 ? ? ? A . n A 1 182 GLU 182 182 ? ? ? A . n A 1 183 SER 183 183 ? ? ? A . n A 1 184 ALA 184 184 ? ? ? A . n A 1 185 TRP 185 185 ? ? ? A . n A 1 186 SER 186 186 ? ? ? A . n A 1 187 HIS 187 187 ? ? ? A . n A 1 188 PRO 188 188 ? ? ? A . n A 1 189 GLN 189 189 ? ? ? A . n A 1 190 PHE 190 190 ? ? ? A . n A 1 191 GLU 191 191 ? ? ? A . n A 1 192 LYS 192 192 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 TRS 1 193 1 TRS TRS A . C 3 HOH 1 194 1 HOH TIP A . C 3 HOH 2 195 2 HOH TIP A . C 3 HOH 3 196 3 HOH TIP A . C 3 HOH 4 197 4 HOH TIP A . C 3 HOH 5 198 5 HOH TIP A . C 3 HOH 6 199 6 HOH TIP A . C 3 HOH 7 200 7 HOH TIP A . C 3 HOH 8 201 8 HOH TIP A . C 3 HOH 9 202 9 HOH TIP A . C 3 HOH 10 203 10 HOH TIP A . C 3 HOH 11 204 11 HOH TIP A . C 3 HOH 12 205 12 HOH TIP A . C 3 HOH 13 206 13 HOH TIP A . C 3 HOH 14 207 14 HOH TIP A . C 3 HOH 15 208 15 HOH TIP A . C 3 HOH 16 209 16 HOH TIP A . C 3 HOH 17 210 17 HOH TIP A . C 3 HOH 18 211 18 HOH TIP A . C 3 HOH 19 212 19 HOH TIP A . C 3 HOH 20 213 20 HOH TIP A . C 3 HOH 21 214 21 HOH TIP A . C 3 HOH 22 215 22 HOH TIP A . C 3 HOH 23 216 23 HOH TIP A . C 3 HOH 24 217 24 HOH TIP A . C 3 HOH 25 218 25 HOH TIP A . C 3 HOH 26 219 26 HOH TIP A . C 3 HOH 27 220 27 HOH TIP A . C 3 HOH 28 221 28 HOH TIP A . C 3 HOH 29 222 29 HOH TIP A . C 3 HOH 30 223 30 HOH TIP A . C 3 HOH 31 224 31 HOH TIP A . C 3 HOH 32 225 32 HOH TIP A . C 3 HOH 33 226 33 HOH TIP A . C 3 HOH 34 227 34 HOH TIP A . C 3 HOH 35 228 35 HOH TIP A . C 3 HOH 36 229 36 HOH TIP A . C 3 HOH 37 230 37 HOH TIP A . C 3 HOH 38 231 38 HOH TIP A . C 3 HOH 39 232 39 HOH TIP A . C 3 HOH 40 233 40 HOH TIP A . C 3 HOH 41 234 41 HOH TIP A . C 3 HOH 42 235 42 HOH TIP A . C 3 HOH 43 236 43 HOH TIP A . C 3 HOH 44 237 44 HOH TIP A . C 3 HOH 45 238 45 HOH TIP A . C 3 HOH 46 239 46 HOH TIP A . C 3 HOH 47 240 47 HOH TIP A . C 3 HOH 48 241 48 HOH TIP A . C 3 HOH 49 242 49 HOH TIP A . C 3 HOH 50 243 50 HOH TIP A . C 3 HOH 51 244 51 HOH TIP A . C 3 HOH 52 245 52 HOH TIP A . C 3 HOH 53 246 53 HOH TIP A . C 3 HOH 54 247 54 HOH TIP A . C 3 HOH 55 248 55 HOH TIP A . C 3 HOH 56 249 56 HOH TIP A . C 3 HOH 57 250 57 HOH TIP A . C 3 HOH 58 251 58 HOH TIP A . C 3 HOH 59 252 59 HOH TIP A . C 3 HOH 60 253 60 HOH TIP A . C 3 HOH 61 254 61 HOH TIP A . C 3 HOH 62 255 62 HOH TIP A . C 3 HOH 63 256 63 HOH TIP A . C 3 HOH 64 257 64 HOH TIP A . C 3 HOH 65 258 65 HOH TIP A . C 3 HOH 66 259 66 HOH TIP A . C 3 HOH 67 260 67 HOH TIP A . C 3 HOH 68 261 68 HOH TIP A . C 3 HOH 69 262 69 HOH TIP A . C 3 HOH 70 263 70 HOH TIP A . C 3 HOH 71 264 71 HOH TIP A . C 3 HOH 72 265 72 HOH TIP A . C 3 HOH 73 266 73 HOH TIP A . C 3 HOH 74 267 74 HOH TIP A . C 3 HOH 75 268 75 HOH TIP A . C 3 HOH 76 269 76 HOH TIP A . C 3 HOH 77 270 77 HOH TIP A . C 3 HOH 78 271 78 HOH TIP A . C 3 HOH 79 272 79 HOH TIP A . C 3 HOH 80 273 80 HOH TIP A . C 3 HOH 81 274 81 HOH TIP A . C 3 HOH 82 275 82 HOH TIP A . C 3 HOH 83 276 83 HOH TIP A . C 3 HOH 84 277 84 HOH TIP A . C 3 HOH 85 278 85 HOH TIP A . C 3 HOH 86 279 86 HOH TIP A . C 3 HOH 87 280 87 HOH TIP A . C 3 HOH 88 281 88 HOH TIP A . C 3 HOH 89 282 89 HOH TIP A . C 3 HOH 90 283 90 HOH TIP A . C 3 HOH 91 284 91 HOH TIP A . C 3 HOH 92 285 92 HOH TIP A . C 3 HOH 93 286 93 HOH TIP A . C 3 HOH 94 287 94 HOH TIP A . C 3 HOH 95 288 95 HOH TIP A . C 3 HOH 96 289 96 HOH TIP A . C 3 HOH 97 290 97 HOH TIP A . C 3 HOH 98 291 98 HOH TIP A . C 3 HOH 99 292 99 HOH TIP A . C 3 HOH 100 293 100 HOH TIP A . C 3 HOH 101 294 101 HOH TIP A . C 3 HOH 102 295 102 HOH TIP A . C 3 HOH 103 296 103 HOH TIP A . C 3 HOH 104 297 104 HOH TIP A . C 3 HOH 105 298 105 HOH TIP A . C 3 HOH 106 299 106 HOH TIP A . C 3 HOH 107 300 107 HOH TIP A . C 3 HOH 108 301 108 HOH TIP A . C 3 HOH 109 302 109 HOH TIP A . C 3 HOH 110 303 110 HOH TIP A . C 3 HOH 111 304 111 HOH TIP A . C 3 HOH 112 305 112 HOH TIP A . C 3 HOH 113 306 113 HOH TIP A . C 3 HOH 114 307 114 HOH TIP A . C 3 HOH 115 308 115 HOH TIP A . C 3 HOH 116 309 116 HOH TIP A . C 3 HOH 117 310 117 HOH TIP A . C 3 HOH 118 311 118 HOH TIP A . C 3 HOH 119 312 119 HOH TIP A . C 3 HOH 120 313 120 HOH TIP A . C 3 HOH 121 314 121 HOH TIP A . C 3 HOH 122 315 122 HOH TIP A . C 3 HOH 123 316 123 HOH TIP A . C 3 HOH 124 317 124 HOH TIP A . C 3 HOH 125 318 125 HOH TIP A . C 3 HOH 126 319 126 HOH TIP A . C 3 HOH 127 320 127 HOH TIP A . C 3 HOH 128 321 128 HOH TIP A . C 3 HOH 129 322 129 HOH TIP A . C 3 HOH 130 323 130 HOH TIP A . C 3 HOH 131 324 131 HOH TIP A . C 3 HOH 132 325 132 HOH TIP A . C 3 HOH 133 326 133 HOH TIP A . C 3 HOH 134 327 134 HOH TIP A . C 3 HOH 135 328 135 HOH TIP A . C 3 HOH 136 329 136 HOH TIP A . C 3 HOH 137 330 137 HOH TIP A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-12-02 2 'Structure model' 1 1 2010-02-09 3 'Structure model' 1 2 2011-07-13 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 3 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal CNS . ? package 'Axel T. Brunger' axel.brunger@yale.edu refinement http://cns.csb.yale.edu/v1.1/ Fortran_77 ? 1 PDB_EXTRACT 3.004 'September 10, 2007' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 2 HKL-2000 . ? ? ? ? 'data collection' ? ? ? 3 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 4 HKL-2000 . ? ? ? ? 'data scaling' ? ? ? 5 SHELXS . ? ? ? ? phasing ? ? ? 6 REFMAC 5.2.0019 ? ? ? ? refinement ? ? ? 7 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 119 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 235 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.97 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 107 ? ? -65.04 4.88 2 1 ASN A 117 ? ? -95.62 -152.28 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 1 ? CG ? A GLN 1 CG 2 1 Y 1 A GLN 1 ? CD ? A GLN 1 CD 3 1 Y 1 A GLN 1 ? OE1 ? A GLN 1 OE1 4 1 Y 1 A GLN 1 ? NE2 ? A GLN 1 NE2 5 1 Y 1 A GLU 35 ? CG ? A GLU 35 CG 6 1 Y 1 A GLU 35 ? CD ? A GLU 35 CD 7 1 Y 1 A GLU 35 ? OE1 ? A GLU 35 OE1 8 1 Y 1 A GLU 35 ? OE2 ? A GLU 35 OE2 9 1 Y 1 A GLU 36 ? CG ? A GLU 36 CG 10 1 Y 1 A GLU 36 ? CD ? A GLU 36 CD 11 1 Y 1 A GLU 36 ? OE1 ? A GLU 36 OE1 12 1 Y 1 A GLU 36 ? OE2 ? A GLU 36 OE2 13 1 Y 1 A LYS 39 ? CG ? A LYS 39 CG 14 1 Y 1 A LYS 39 ? CD ? A LYS 39 CD 15 1 Y 1 A LYS 39 ? CE ? A LYS 39 CE 16 1 Y 1 A LYS 39 ? NZ ? A LYS 39 NZ 17 1 Y 1 A GLU 43 ? CG ? A GLU 43 CG 18 1 Y 1 A GLU 43 ? CD ? A GLU 43 CD 19 1 Y 1 A GLU 43 ? OE1 ? A GLU 43 OE1 20 1 Y 1 A GLU 43 ? OE2 ? A GLU 43 OE2 21 1 Y 1 A GLN 69 ? CG ? A GLN 69 CG 22 1 Y 1 A GLN 69 ? CD ? A GLN 69 CD 23 1 Y 1 A GLN 69 ? OE1 ? A GLN 69 OE1 24 1 Y 1 A GLN 69 ? NE2 ? A GLN 69 NE2 25 1 Y 1 A GLN 95 ? CG ? A GLN 95 CG 26 1 Y 1 A GLN 95 ? CD ? A GLN 95 CD 27 1 Y 1 A GLN 95 ? OE1 ? A GLN 95 OE1 28 1 Y 1 A GLN 95 ? NE2 ? A GLN 95 NE2 29 1 Y 1 A THR 107 ? OG1 ? A THR 107 OG1 30 1 Y 1 A THR 107 ? CG2 ? A THR 107 CG2 31 1 Y 1 A LYS 108 ? CG ? A LYS 108 CG 32 1 Y 1 A LYS 108 ? CD ? A LYS 108 CD 33 1 Y 1 A LYS 108 ? CE ? A LYS 108 CE 34 1 Y 1 A LYS 108 ? NZ ? A LYS 108 NZ 35 1 Y 1 A LYS 120 ? CG ? A LYS 120 CG 36 1 Y 1 A LYS 120 ? CD ? A LYS 120 CD 37 1 Y 1 A LYS 120 ? CE ? A LYS 120 CE 38 1 Y 1 A LYS 120 ? NZ ? A LYS 120 NZ 39 1 Y 1 A GLU 132 ? CG ? A GLU 132 CG 40 1 Y 1 A GLU 132 ? CD ? A GLU 132 CD 41 1 Y 1 A GLU 132 ? OE1 ? A GLU 132 OE1 42 1 Y 1 A GLU 132 ? OE2 ? A GLU 132 OE2 43 1 Y 1 A LYS 135 ? CG ? A LYS 135 CG 44 1 Y 1 A LYS 135 ? CD ? A LYS 135 CD 45 1 Y 1 A LYS 135 ? CE ? A LYS 135 CE 46 1 Y 1 A LYS 135 ? NZ ? A LYS 135 NZ 47 1 Y 1 A GLU 136 ? CG ? A GLU 136 CG 48 1 Y 1 A GLU 136 ? CD ? A GLU 136 CD 49 1 Y 1 A GLU 136 ? OE1 ? A GLU 136 OE1 50 1 Y 1 A GLU 136 ? OE2 ? A GLU 136 OE2 51 1 Y 1 A ARG 149 ? CG ? A ARG 149 CG 52 1 Y 1 A ARG 149 ? CD ? A ARG 149 CD 53 1 Y 1 A ARG 149 ? NE ? A ARG 149 NE 54 1 Y 1 A ARG 149 ? CZ ? A ARG 149 CZ 55 1 Y 1 A ARG 149 ? NH1 ? A ARG 149 NH1 56 1 Y 1 A ARG 149 ? NH2 ? A ARG 149 NH2 57 1 Y 1 A LYS 161 ? CG ? A LYS 161 CG 58 1 Y 1 A LYS 161 ? CD ? A LYS 161 CD 59 1 Y 1 A LYS 161 ? CE ? A LYS 161 CE 60 1 Y 1 A LYS 161 ? NZ ? A LYS 161 NZ 61 1 Y 1 A LYS 170 ? CG ? A LYS 170 CG 62 1 Y 1 A LYS 170 ? CD ? A LYS 170 CD 63 1 Y 1 A LYS 170 ? CE ? A LYS 170 CE 64 1 Y 1 A LYS 170 ? NZ ? A LYS 170 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 173 ? A GLU 173 2 1 Y 1 A LYS 174 ? A LYS 174 3 1 Y 1 A GLU 175 ? A GLU 175 4 1 Y 1 A ARG 176 ? A ARG 176 5 1 Y 1 A LYS 177 ? A LYS 177 6 1 Y 1 A GLN 178 ? A GLN 178 7 1 Y 1 A GLU 179 ? A GLU 179 8 1 Y 1 A GLU 180 ? A GLU 180 9 1 Y 1 A GLY 181 ? A GLY 181 10 1 Y 1 A GLU 182 ? A GLU 182 11 1 Y 1 A SER 183 ? A SER 183 12 1 Y 1 A ALA 184 ? A ALA 184 13 1 Y 1 A TRP 185 ? A TRP 185 14 1 Y 1 A SER 186 ? A SER 186 15 1 Y 1 A HIS 187 ? A HIS 187 16 1 Y 1 A PRO 188 ? A PRO 188 17 1 Y 1 A GLN 189 ? A GLN 189 18 1 Y 1 A PHE 190 ? A PHE 190 19 1 Y 1 A GLU 191 ? A GLU 191 20 1 Y 1 A LYS 192 ? A LYS 192 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 3 water HOH #