data_3C64 # _entry.id 3C64 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3C64 RCSB RCSB046388 WWPDB D_1000046388 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3C64 _pdbx_database_status.recvd_initial_deposition_date 2008-02-02 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Klein, M.M.' 1 'Gittis, A.G.' 2 'Su, H.P.' 3 'Makobongo, M.O.' 4 'Moore, J.M.' 5 'Singh, S.' 6 'Miller, L.H.' 7 'Garboczi, D.N.' 8 # _citation.id primary _citation.title ;The Cysteine-Rich Interdomain Region from the Highly Variable Plasmodium falciparum Erythrocyte Membrane Protein-1 Exhibits a Conserved Structure. ; _citation.journal_abbrev 'Plos Pathog.' _citation.journal_volume 4 _citation.page_first e1000147 _citation.page_last e1000147 _citation.year 2008 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1553-7366 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18773118 _citation.pdbx_database_id_DOI 10.1371/journal.ppat.1000147 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Klein, M.M.' 1 primary 'Gittis, A.G.' 2 primary 'Su, H.P.' 3 primary 'Makobongo, M.O.' 4 primary 'Moore, J.M.' 5 primary 'Singh, S.' 6 primary 'Miller, L.H.' 7 primary 'Garboczi, D.N.' 8 # _cell.entry_id 3C64 _cell.length_a 93.31 _cell.length_b 93.31 _cell.length_c 85.71 _cell.angle_alpha 90 _cell.angle_beta 90 _cell.angle_gamma 120 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3C64 _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PfEMP1 variant 2 of strain MC' 20932.031 1 ? ? 'UNP residues 576-754' ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 non-polymer syn 'TETRAETHYLENE GLYCOL' 194.226 1 ? ? ? ? 4 water nat water 18.015 23 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EDKIMSYNAFFWMWVHDMLIDSIKWRDEHGRCINKDKGKTCIKGCNKKCICFQKWVEQKKTEWGKIKDHFRKQKDIPKDW THDDFLQTLLMKDLLLEIIQDTYGDANEIKRIEALLEQAGVGGIDFAALAGLYTKGFVAEKDTTIDKLLQHEQKEADKCL KTHTDDTCPPQEDRSVARS ; _entity_poly.pdbx_seq_one_letter_code_can ;EDKIMSYNAFFWMWVHDMLIDSIKWRDEHGRCINKDKGKTCIKGCNKKCICFQKWVEQKKTEWGKIKDHFRKQKDIPKDW THDDFLQTLLMKDLLLEIIQDTYGDANEIKRIEALLEQAGVGGIDFAALAGLYTKGFVAEKDTTIDKLLQHEQKEADKCL KTHTDDTCPPQEDRSVARS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ASP n 1 3 LYS n 1 4 ILE n 1 5 MET n 1 6 SER n 1 7 TYR n 1 8 ASN n 1 9 ALA n 1 10 PHE n 1 11 PHE n 1 12 TRP n 1 13 MET n 1 14 TRP n 1 15 VAL n 1 16 HIS n 1 17 ASP n 1 18 MET n 1 19 LEU n 1 20 ILE n 1 21 ASP n 1 22 SER n 1 23 ILE n 1 24 LYS n 1 25 TRP n 1 26 ARG n 1 27 ASP n 1 28 GLU n 1 29 HIS n 1 30 GLY n 1 31 ARG n 1 32 CYS n 1 33 ILE n 1 34 ASN n 1 35 LYS n 1 36 ASP n 1 37 LYS n 1 38 GLY n 1 39 LYS n 1 40 THR n 1 41 CYS n 1 42 ILE n 1 43 LYS n 1 44 GLY n 1 45 CYS n 1 46 ASN n 1 47 LYS n 1 48 LYS n 1 49 CYS n 1 50 ILE n 1 51 CYS n 1 52 PHE n 1 53 GLN n 1 54 LYS n 1 55 TRP n 1 56 VAL n 1 57 GLU n 1 58 GLN n 1 59 LYS n 1 60 LYS n 1 61 THR n 1 62 GLU n 1 63 TRP n 1 64 GLY n 1 65 LYS n 1 66 ILE n 1 67 LYS n 1 68 ASP n 1 69 HIS n 1 70 PHE n 1 71 ARG n 1 72 LYS n 1 73 GLN n 1 74 LYS n 1 75 ASP n 1 76 ILE n 1 77 PRO n 1 78 LYS n 1 79 ASP n 1 80 TRP n 1 81 THR n 1 82 HIS n 1 83 ASP n 1 84 ASP n 1 85 PHE n 1 86 LEU n 1 87 GLN n 1 88 THR n 1 89 LEU n 1 90 LEU n 1 91 MET n 1 92 LYS n 1 93 ASP n 1 94 LEU n 1 95 LEU n 1 96 LEU n 1 97 GLU n 1 98 ILE n 1 99 ILE n 1 100 GLN n 1 101 ASP n 1 102 THR n 1 103 TYR n 1 104 GLY n 1 105 ASP n 1 106 ALA n 1 107 ASN n 1 108 GLU n 1 109 ILE n 1 110 LYS n 1 111 ARG n 1 112 ILE n 1 113 GLU n 1 114 ALA n 1 115 LEU n 1 116 LEU n 1 117 GLU n 1 118 GLN n 1 119 ALA n 1 120 GLY n 1 121 VAL n 1 122 GLY n 1 123 GLY n 1 124 ILE n 1 125 ASP n 1 126 PHE n 1 127 ALA n 1 128 ALA n 1 129 LEU n 1 130 ALA n 1 131 GLY n 1 132 LEU n 1 133 TYR n 1 134 THR n 1 135 LYS n 1 136 GLY n 1 137 PHE n 1 138 VAL n 1 139 ALA n 1 140 GLU n 1 141 LYS n 1 142 ASP n 1 143 THR n 1 144 THR n 1 145 ILE n 1 146 ASP n 1 147 LYS n 1 148 LEU n 1 149 LEU n 1 150 GLN n 1 151 HIS n 1 152 GLU n 1 153 GLN n 1 154 LYS n 1 155 GLU n 1 156 ALA n 1 157 ASP n 1 158 LYS n 1 159 CYS n 1 160 LEU n 1 161 LYS n 1 162 THR n 1 163 HIS n 1 164 THR n 1 165 ASP n 1 166 ASP n 1 167 THR n 1 168 CYS n 1 169 PRO n 1 170 PRO n 1 171 GLN n 1 172 GLU n 1 173 ASP n 1 174 ARG n 1 175 SER n 1 176 VAL n 1 177 ALA n 1 178 ARG n 1 179 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MCvar-2 PfEMP1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'Malayan Camp' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Plasmodium falciparum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-DE3-(RIL)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PLM1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q25734_PLAFA _struct_ref.pdbx_db_accession Q25734 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EDKIMSYNAFFWMWVHDMLIDSIKWRDEHGRCINKDKGKTCIKGCNKKCICFQKWVEQKKTEWGKIKDHFRKQKDIPKDW THDDFLQTLLMKDLLLEIIQDTYGDANEIKRIEALLEQAGVGGIDFAALAGLYTKGFVAEKDTTIDKLLQHEQKEADKCL KTHTDDTCPPQEDRSVARS ; _struct_ref.pdbx_align_begin 576 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3C64 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 179 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q25734 _struct_ref_seq.db_align_beg 576 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 754 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 179 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PG4 non-polymer . 'TETRAETHYLENE GLYCOL' ? 'C8 H18 O5' 194.226 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3C64 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.57 _exptl_crystal.density_percent_sol 52.19 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.20 _exptl_crystal_grow.pdbx_details '27% PEG 400, 100MM NACL, 50MM SODIUM CITRATE, pH 4.20, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 93.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV' _diffrn_detector.pdbx_collection_date 2003-06-23 _diffrn_detector.details 'Osmic Blue multilayer optic' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'blue osmic multilayer optics' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 3C64 _reflns.observed_criterion_sigma_I 1.5 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20 _reflns.d_resolution_high 2.4 _reflns.number_obs 9044 _reflns.number_all 9053 _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.126 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 18.8 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 18.2 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.40 _reflns_shell.d_res_low 2.55 _reflns_shell.percent_possible_all 99.9 _reflns_shell.Rmerge_I_obs 0.51 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.4 _reflns_shell.pdbx_redundancy 18.2 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3C64 _refine.ls_number_reflns_obs 9044 _refine.ls_number_reflns_all 9053 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 2.40 _refine.ls_percent_reflns_obs 99.9 _refine.ls_R_factor_obs 0.246 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.246 _refine.ls_R_factor_R_free 0.289 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 748 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 42. _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MIRAS _refine.pdbx_isotropic_thermal_model isotropic _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3C64 _refine_analyze.Luzzati_coordinate_error_obs 0.32 _refine_analyze.Luzzati_sigma_a_obs 0.30 _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free 0.41 _refine_analyze.Luzzati_sigma_a_free 0.43 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1258 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 14 _refine_hist.number_atoms_solvent 23 _refine_hist.number_atoms_total 1295 _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.50 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 20.00 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 1.59 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 3C64 _struct.title 'The MC179 portion of the Cysteine-rich Interdomain Region (CIDR) of a Plasmodium falciparum Erythrocyte Membrane Protein-1 (PfEMP1)' _struct.pdbx_descriptor 'PfEMP1 variant 2 of strain MC' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3C64 _struct_keywords.pdbx_keywords 'CD36-BINDING PROTEIN,CELL ADHESION' _struct_keywords.text 'ALPHA-HELICAL, THREE-Helix Bundle, CD36-BINDING PROTEIN, CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 6 ? HIS A 29 ? SER A 6 HIS A 29 1 ? 24 HELX_P HELX_P2 2 ASN A 46 ? GLN A 73 ? ASN A 46 GLN A 73 1 ? 28 HELX_P HELX_P3 3 TRP A 80 ? TYR A 103 ? TRP A 80 TYR A 103 1 ? 24 HELX_P HELX_P4 4 ASP A 105 ? ALA A 119 ? ASP A 105 ALA A 119 1 ? 15 HELX_P HELX_P5 5 PHE A 126 ? ALA A 128 ? PHE A 126 ALA A 128 5 ? 3 HELX_P HELX_P6 6 LEU A 129 ? PHE A 137 ? LEU A 129 PHE A 137 1 ? 9 HELX_P HELX_P7 7 VAL A 138 ? GLU A 140 ? VAL A 138 GLU A 140 5 ? 3 HELX_P HELX_P8 8 THR A 143 ? HIS A 163 ? THR A 143 HIS A 163 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 49 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 159 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 49 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 159 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.021 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL A 501' AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PG4 A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 LYS A 92 ? LYS A 92 . ? 11_655 ? 2 AC1 4 TYR A 133 ? TYR A 133 . ? 1_555 ? 3 AC1 4 THR A 143 ? THR A 143 . ? 1_555 ? 4 AC1 4 THR A 144 ? THR A 144 . ? 1_555 ? 5 AC2 2 TRP A 25 ? TRP A 25 . ? 1_555 ? 6 AC2 2 THR A 102 ? THR A 102 . ? 5_565 ? # _database_PDB_matrix.entry_id 3C64 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3C64 _atom_sites.fract_transf_matrix[1][1] 0.010717 _atom_sites.fract_transf_matrix[1][2] 0.006187 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012375 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011667 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 ? ? ? A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 TRP 12 12 12 TRP TRP A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 TRP 14 14 14 TRP TRP A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 TRP 25 25 25 TRP TRP A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 GLY 30 30 ? ? ? A . n A 1 31 ARG 31 31 ? ? ? A . n A 1 32 CYS 32 32 ? ? ? A . n A 1 33 ILE 33 33 ? ? ? A . n A 1 34 ASN 34 34 ? ? ? A . n A 1 35 LYS 35 35 ? ? ? A . n A 1 36 ASP 36 36 ? ? ? A . n A 1 37 LYS 37 37 ? ? ? A . n A 1 38 GLY 38 38 ? ? ? A . n A 1 39 LYS 39 39 ? ? ? A . n A 1 40 THR 40 40 ? ? ? A . n A 1 41 CYS 41 41 ? ? ? A . n A 1 42 ILE 42 42 ? ? ? A . n A 1 43 LYS 43 43 ? ? ? A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 TRP 55 55 55 TRP TRP A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 TRP 63 63 63 TRP TRP A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 TRP 80 80 80 TRP TRP A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 MET 91 91 91 MET MET A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 HIS 151 151 151 HIS HIS A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 CYS 159 159 159 CYS CYS A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 HIS 163 163 163 HIS HIS A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 THR 167 167 167 THR THR A . n A 1 168 CYS 168 168 ? ? ? A . n A 1 169 PRO 169 169 ? ? ? A . n A 1 170 PRO 170 170 ? ? ? A . n A 1 171 GLN 171 171 ? ? ? A . n A 1 172 GLU 172 172 ? ? ? A . n A 1 173 ASP 173 173 ? ? ? A . n A 1 174 ARG 174 174 ? ? ? A . n A 1 175 SER 175 175 ? ? ? A . n A 1 176 VAL 176 176 ? ? ? A . n A 1 177 ALA 177 177 ? ? ? A . n A 1 178 ARG 178 178 ? ? ? A . n A 1 179 SER 179 179 ? ? ? A . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 software_defined_assembly PISA dimeric 2 2 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2 A,B,C,D 2 1 A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5110 ? 1 MORE -63.3 ? 1 'SSA (A^2)' 18620 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 11_655 -x+y+1,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 93.3100000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 42.8550000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-09-16 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SHARP phasing . ? 1 CNS refinement 1.1 ? 2 CrystalClear 'data collection' . ? 3 XDS 'data reduction' . ? 4 XDS 'data scaling' . ? 5 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A PRO 77 ? ? N A PRO 77 ? ? CD A PRO 77 ? ? 95.46 111.70 -16.24 1.40 N 2 1 CB A LYS 78 ? ? CA A LYS 78 ? ? C A LYS 78 ? ? 96.31 110.40 -14.09 2.00 N 3 1 N A LYS 78 ? ? CA A LYS 78 ? ? C A LYS 78 ? ? 128.94 111.00 17.94 2.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 73 ? ? -82.42 32.98 2 1 ASP A 79 ? ? 123.85 -61.82 3 1 TRP A 80 ? ? 74.52 -91.78 4 1 ASP A 166 ? ? -57.07 103.44 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 1 ? A GLU 1 2 1 Y 1 A GLY 30 ? A GLY 30 3 1 Y 1 A ARG 31 ? A ARG 31 4 1 Y 1 A CYS 32 ? A CYS 32 5 1 Y 1 A ILE 33 ? A ILE 33 6 1 Y 1 A ASN 34 ? A ASN 34 7 1 Y 1 A LYS 35 ? A LYS 35 8 1 Y 1 A ASP 36 ? A ASP 36 9 1 Y 1 A LYS 37 ? A LYS 37 10 1 Y 1 A GLY 38 ? A GLY 38 11 1 Y 1 A LYS 39 ? A LYS 39 12 1 Y 1 A THR 40 ? A THR 40 13 1 Y 1 A CYS 41 ? A CYS 41 14 1 Y 1 A ILE 42 ? A ILE 42 15 1 Y 1 A LYS 43 ? A LYS 43 16 1 Y 1 A CYS 168 ? A CYS 168 17 1 Y 1 A PRO 169 ? A PRO 169 18 1 Y 1 A PRO 170 ? A PRO 170 19 1 Y 1 A GLN 171 ? A GLN 171 20 1 Y 1 A GLU 172 ? A GLU 172 21 1 Y 1 A ASP 173 ? A ASP 173 22 1 Y 1 A ARG 174 ? A ARG 174 23 1 Y 1 A SER 175 ? A SER 175 24 1 Y 1 A VAL 176 ? A VAL 176 25 1 Y 1 A ALA 177 ? A ALA 177 26 1 Y 1 A ARG 178 ? A ARG 178 27 1 Y 1 A SER 179 ? A SER 179 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 'TETRAETHYLENE GLYCOL' PG4 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 501 501 CL CL A . C 3 PG4 1 301 301 PG4 PG4 A . D 4 HOH 1 201 201 HOH HOH A . D 4 HOH 2 202 202 HOH HOH A . D 4 HOH 3 203 203 HOH HOH A . D 4 HOH 4 204 204 HOH HOH A . D 4 HOH 5 205 205 HOH HOH A . D 4 HOH 6 206 206 HOH HOH A . D 4 HOH 7 207 207 HOH HOH A . D 4 HOH 8 208 208 HOH HOH A . D 4 HOH 9 209 209 HOH HOH A . D 4 HOH 10 210 210 HOH HOH A . D 4 HOH 11 211 211 HOH HOH A . D 4 HOH 12 212 212 HOH HOH A . D 4 HOH 13 213 213 HOH HOH A . D 4 HOH 14 214 214 HOH HOH A . D 4 HOH 15 215 215 HOH HOH A . D 4 HOH 16 216 216 HOH HOH A . D 4 HOH 17 217 217 HOH HOH A . D 4 HOH 18 218 218 HOH HOH A . D 4 HOH 19 219 219 HOH HOH A . D 4 HOH 20 220 220 HOH HOH A . D 4 HOH 21 221 221 HOH HOH A . D 4 HOH 22 222 222 HOH HOH A . D 4 HOH 23 223 223 HOH HOH A . #