data_3CNA # _entry.id 3CNA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3CNA pdb_00003cna 10.2210/pdb3cna/pdb WWPDB D_1000178916 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1976-10-11 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2024-02-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_database_status 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.value' 17 4 'Structure model' '_struct_conn.pdbx_dist_value' 18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 30 4 'Structure model' '_struct_ref_seq_dif.details' 31 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 32 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 33 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3CNA _pdbx_database_status.recvd_initial_deposition_date 1976-09-15 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hardman, K.D.' 1 'Ainsworth, C.F.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure of concanavalin A at 2.4-A resolution.' Biochemistry 11 4910 4919 1972 BICHAW US 0006-2960 0033 ? 4638345 10.1021/bi00776a006 1 'Structure of the Concanavalin A-Methyl-Alpha-D-Mannopyranoside Complex at 6.0 Angstroms Resolution' Biochemistry 15 1120 ? 1976 BICHAW US 0006-2960 0033 ? ? ? 2 'Binding of Nonpolar Molecules by Crystalline Concanavalin A' Biochemistry 12 4442 ? 1973 BICHAW US 0006-2960 0033 ? ? ? 3 'Crystallography of a Metal-Containing Protein, Concanavalin A' Adv.Exp.Med.Biol. 40 103 ? 1973 AEMBAP US 0065-2598 0412 ? ? ? 4 ? 'Atlas of Macromolecular Structure on Microfiche' ? 464 ? 1976 ? ? 0-917934-01-6 0434 'Tracor Jitco Inc.,Rockville,Md.' ? ? 5 ? 'Atlas of Protein Sequence and Structure,Supplement 2' 5 268 ? 1976 ? ? 0-912466-05-7 435 'National Biomedical Research Foundation, Silver Spring,Md.' ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hardman, K.D.' 1 ? primary 'Ainsworth, C.F.' 2 ? 1 'Hardman, K.D.' 3 ? 1 'Ainsworth, C.F.' 4 ? 2 'Hardman, K.D.' 5 ? 2 'Ainsworth, C.F.' 6 ? 3 'Hardman, K.D.' 7 ? # loop_ _citation_editor.citation_id _citation_editor.name _citation_editor.ordinal 4 'Feldmann, R.J.' 1 5 'Dayhoff, M.O.' 2 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CONCANAVALIN A' 25596.299 1 ? ? ? ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 1 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 4 water nat water 18.015 4 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAKWNMQDGKVGTAHIIYNSVDKRLSAVVSYPNADATSVSYDVD LNDVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKSNSTHQTDALHFMFNQFSKDQKDLILQGDATTGTDGNLELTRVS SNGSPEGSSVGRALFYAPVHIWESSAATVSFEATFAFLIKSPDSHPADGIAFFISNIDSSIPSGSTGRLLGLFPDAN ; _entity_poly.pdbx_seq_one_letter_code_can ;ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAKWNMQDGKVGTAHIIYNSVDKRLSAVVSYPNADATSVSYDVD LNDVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKSNSTHQTDALHFMFNQFSKDQKDLILQGDATTGTDGNLELTRVS SNGSPEGSSVGRALFYAPVHIWESSAATVSFEATFAFLIKSPDSHPADGIAFFISNIDSSIPSGSTGRLLGLFPDAN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 'CALCIUM ION' CA 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 THR n 1 4 ILE n 1 5 VAL n 1 6 ALA n 1 7 VAL n 1 8 GLU n 1 9 LEU n 1 10 ASP n 1 11 THR n 1 12 TYR n 1 13 PRO n 1 14 ASN n 1 15 THR n 1 16 ASP n 1 17 ILE n 1 18 GLY n 1 19 ASP n 1 20 PRO n 1 21 SER n 1 22 TYR n 1 23 PRO n 1 24 HIS n 1 25 ILE n 1 26 GLY n 1 27 ILE n 1 28 ASP n 1 29 ILE n 1 30 LYS n 1 31 SER n 1 32 VAL n 1 33 ARG n 1 34 SER n 1 35 LYS n 1 36 LYS n 1 37 THR n 1 38 ALA n 1 39 LYS n 1 40 TRP n 1 41 ASN n 1 42 MET n 1 43 GLN n 1 44 ASP n 1 45 GLY n 1 46 LYS n 1 47 VAL n 1 48 GLY n 1 49 THR n 1 50 ALA n 1 51 HIS n 1 52 ILE n 1 53 ILE n 1 54 TYR n 1 55 ASN n 1 56 SER n 1 57 VAL n 1 58 ASP n 1 59 LYS n 1 60 ARG n 1 61 LEU n 1 62 SER n 1 63 ALA n 1 64 VAL n 1 65 VAL n 1 66 SER n 1 67 TYR n 1 68 PRO n 1 69 ASN n 1 70 ALA n 1 71 ASP n 1 72 ALA n 1 73 THR n 1 74 SER n 1 75 VAL n 1 76 SER n 1 77 TYR n 1 78 ASP n 1 79 VAL n 1 80 ASP n 1 81 LEU n 1 82 ASN n 1 83 ASP n 1 84 VAL n 1 85 LEU n 1 86 PRO n 1 87 GLU n 1 88 TRP n 1 89 VAL n 1 90 ARG n 1 91 VAL n 1 92 GLY n 1 93 LEU n 1 94 SER n 1 95 ALA n 1 96 SER n 1 97 THR n 1 98 GLY n 1 99 LEU n 1 100 TYR n 1 101 LYS n 1 102 GLU n 1 103 THR n 1 104 ASN n 1 105 THR n 1 106 ILE n 1 107 LEU n 1 108 SER n 1 109 TRP n 1 110 SER n 1 111 PHE n 1 112 THR n 1 113 SER n 1 114 LYS n 1 115 LEU n 1 116 LYS n 1 117 SER n 1 118 ASN n 1 119 SER n 1 120 THR n 1 121 HIS n 1 122 GLN n 1 123 THR n 1 124 ASP n 1 125 ALA n 1 126 LEU n 1 127 HIS n 1 128 PHE n 1 129 MET n 1 130 PHE n 1 131 ASN n 1 132 GLN n 1 133 PHE n 1 134 SER n 1 135 LYS n 1 136 ASP n 1 137 GLN n 1 138 LYS n 1 139 ASP n 1 140 LEU n 1 141 ILE n 1 142 LEU n 1 143 GLN n 1 144 GLY n 1 145 ASP n 1 146 ALA n 1 147 THR n 1 148 THR n 1 149 GLY n 1 150 THR n 1 151 ASP n 1 152 GLY n 1 153 ASN n 1 154 LEU n 1 155 GLU n 1 156 LEU n 1 157 THR n 1 158 ARG n 1 159 VAL n 1 160 SER n 1 161 SER n 1 162 ASN n 1 163 GLY n 1 164 SER n 1 165 PRO n 1 166 GLU n 1 167 GLY n 1 168 SER n 1 169 SER n 1 170 VAL n 1 171 GLY n 1 172 ARG n 1 173 ALA n 1 174 LEU n 1 175 PHE n 1 176 TYR n 1 177 ALA n 1 178 PRO n 1 179 VAL n 1 180 HIS n 1 181 ILE n 1 182 TRP n 1 183 GLU n 1 184 SER n 1 185 SER n 1 186 ALA n 1 187 ALA n 1 188 THR n 1 189 VAL n 1 190 SER n 1 191 PHE n 1 192 GLU n 1 193 ALA n 1 194 THR n 1 195 PHE n 1 196 ALA n 1 197 PHE n 1 198 LEU n 1 199 ILE n 1 200 LYS n 1 201 SER n 1 202 PRO n 1 203 ASP n 1 204 SER n 1 205 HIS n 1 206 PRO n 1 207 ALA n 1 208 ASP n 1 209 GLY n 1 210 ILE n 1 211 ALA n 1 212 PHE n 1 213 PHE n 1 214 ILE n 1 215 SER n 1 216 ASN n 1 217 ILE n 1 218 ASP n 1 219 SER n 1 220 SER n 1 221 ILE n 1 222 PRO n 1 223 SER n 1 224 GLY n 1 225 SER n 1 226 THR n 1 227 GLY n 1 228 ARG n 1 229 LEU n 1 230 LEU n 1 231 GLY n 1 232 LEU n 1 233 PHE n 1 234 PRO n 1 235 ASP n 1 236 ALA n 1 237 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'jack bean' _entity_src_gen.gene_src_genus Canavalia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Canavalia ensiformis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3823 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 TRP 88 88 88 TRP TRP A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 HIS 121 121 121 HIS HIS A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 HIS 127 127 127 HIS HIS A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 MET 129 129 129 MET MET A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 ASN 131 131 131 ASN ASN A . n A 1 132 GLN 132 132 132 GLN GLN A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 THR 150 150 150 THR THR A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 ASN 153 153 153 ASN ASN A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 ARG 158 158 158 ARG ARG A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 SER 160 160 160 SER SER A . n A 1 161 SER 161 161 161 SER SER A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 SER 168 168 168 SER SER A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 PHE 175 175 175 PHE PHE A . n A 1 176 TYR 176 176 176 TYR TYR A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 PRO 178 178 178 PRO PRO A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 HIS 180 180 180 HIS HIS A . n A 1 181 ILE 181 181 181 ILE ILE A . n A 1 182 TRP 182 182 182 TRP TRP A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 SER 184 184 184 SER SER A . n A 1 185 SER 185 185 185 SER SER A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 THR 188 188 188 THR THR A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 PHE 191 191 191 PHE PHE A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 THR 194 194 194 THR THR A . n A 1 195 PHE 195 195 195 PHE PHE A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 PHE 197 197 197 PHE PHE A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 ILE 199 199 199 ILE ILE A . n A 1 200 LYS 200 200 200 LYS LYS A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 PRO 202 202 202 PRO PRO A . n A 1 203 ASP 203 203 203 ASP ASP A . n A 1 204 SER 204 204 204 SER SER A . n A 1 205 HIS 205 205 205 HIS HIS A . n A 1 206 PRO 206 206 206 PRO PRO A . n A 1 207 ALA 207 207 207 ALA ALA A . n A 1 208 ASP 208 208 208 ASP ASP A . n A 1 209 GLY 209 209 209 GLY GLY A . n A 1 210 ILE 210 210 210 ILE ILE A . n A 1 211 ALA 211 211 211 ALA ALA A . n A 1 212 PHE 212 212 212 PHE PHE A . n A 1 213 PHE 213 213 213 PHE PHE A . n A 1 214 ILE 214 214 214 ILE ILE A . n A 1 215 SER 215 215 215 SER SER A . n A 1 216 ASN 216 216 216 ASN ASN A . n A 1 217 ILE 217 217 217 ILE ILE A . n A 1 218 ASP 218 218 218 ASP ASP A . n A 1 219 SER 219 219 219 SER SER A . n A 1 220 SER 220 220 220 SER SER A . n A 1 221 ILE 221 221 221 ILE ILE A . n A 1 222 PRO 222 222 222 PRO PRO A . n A 1 223 SER 223 223 223 SER SER A . n A 1 224 GLY 224 224 224 GLY GLY A . n A 1 225 SER 225 225 225 SER SER A . n A 1 226 THR 226 226 226 THR THR A . n A 1 227 GLY 227 227 227 GLY GLY A . n A 1 228 ARG 228 228 228 ARG ARG A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 PHE 233 233 233 PHE PHE A . n A 1 234 PRO 234 234 234 PRO PRO A . n A 1 235 ASP 235 235 235 ASP ASP A . n A 1 236 ALA 236 236 236 ALA ALA A . n A 1 237 ASN 237 237 237 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 238 1 MN MN A . C 3 CA 1 239 2 CA CA A . D 4 HOH 1 240 3 HOH HOH A . D 4 HOH 2 241 4 HOH HOH A . D 4 HOH 3 242 5 HOH HOH A . D 4 HOH 4 243 6 HOH HOH A . # _cell.entry_id 3CNA _cell.length_a 63.150 _cell.length_b 86.910 _cell.length_c 89.250 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 3CNA _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 # _exptl.entry_id 3CNA _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.39 _exptl_crystal.density_percent_sol 48.56 _exptl_crystal.description ? # _refine.entry_id 3CNA _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low ? _refine.ls_d_res_high 2.4 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1807 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 4 _refine_hist.number_atoms_total 1813 _refine_hist.d_res_high 2.4 _refine_hist.d_res_low . # _database_PDB_matrix.entry_id 3CNA _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.000000 _database_PDB_matrix.origx_vector[2] 0.000000 _database_PDB_matrix.origx_vector[3] 0.000000 # _struct.entry_id 3CNA _struct.title 'STRUCTURE OF CONCANAVALIN A AT 2.4 ANGSTROMS RESOLUTION' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3CNA _struct_keywords.pdbx_keywords 'LECTIN (AGGLUTININ)' _struct_keywords.text 'LECTIN (AGGLUTININ)' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CONA_CANEN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P02866 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAKWNMQDGKVGTAHIIYNSVDKRLSAVVSYPNADATSVSYDVD LNDVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKSNSTHQTDALHFMFNQFSKDQKDLILQGDATTGTDGNLELTRVS SNGSPEGSSVGRALFYAPVHIWESSATVSAFEATFAFLIKSPDSHPADGIAFFISNIDSSIPSGSTGRLLGLFPDAN ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3CNA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 237 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02866 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 237 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 237 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3CNA ALA A 186 ? UNP P02866 ? ? insertion 186 1 1 3CNA ? A ? ? UNP P02866 ALA 190 deletion ? 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 8 OE2 ? ? ? 1_555 B MN . MN ? ? A GLU 8 A MN 238 1_555 ? ? ? ? ? ? ? 2.684 ? ? metalc2 metalc ? ? A ASP 10 OD1 ? ? ? 1_555 B MN . MN ? ? A ASP 10 A MN 238 1_555 ? ? ? ? ? ? ? 2.666 ? ? metalc3 metalc ? ? A ASP 10 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 10 A CA 239 1_555 ? ? ? ? ? ? ? 2.086 ? ? metalc4 metalc ? ? A TYR 12 O ? ? ? 1_555 C CA . CA ? ? A TYR 12 A CA 239 1_555 ? ? ? ? ? ? ? 1.955 ? ? metalc5 metalc ? ? A ASN 14 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 14 A CA 239 1_555 ? ? ? ? ? ? ? 2.043 ? ? metalc6 metalc ? ? A ASP 19 OD1 ? ? ? 1_555 B MN . MN ? ? A ASP 19 A MN 238 1_555 ? ? ? ? ? ? ? 2.322 ? ? metalc7 metalc ? ? A ASP 19 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 19 A CA 239 1_555 ? ? ? ? ? ? ? 2.255 ? ? metalc8 metalc ? ? A HIS 24 NE2 ? ? ? 1_555 B MN . MN ? ? A HIS 24 A MN 238 1_555 ? ? ? ? ? ? ? 2.066 ? ? metalc9 metalc ? ? C CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 239 A HOH 242 1_555 ? ? ? ? ? ? ? 2.824 ? ? metalc10 metalc ? ? C CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 239 A HOH 243 1_555 ? ? ? ? ? ? ? 1.942 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 8 ? A GLU 8 ? 1_555 MN ? B MN . ? A MN 238 ? 1_555 OD1 ? A ASP 10 ? A ASP 10 ? 1_555 79.0 ? 2 OE2 ? A GLU 8 ? A GLU 8 ? 1_555 MN ? B MN . ? A MN 238 ? 1_555 OD1 ? A ASP 19 ? A ASP 19 ? 1_555 151.4 ? 3 OD1 ? A ASP 10 ? A ASP 10 ? 1_555 MN ? B MN . ? A MN 238 ? 1_555 OD1 ? A ASP 19 ? A ASP 19 ? 1_555 113.8 ? 4 OE2 ? A GLU 8 ? A GLU 8 ? 1_555 MN ? B MN . ? A MN 238 ? 1_555 NE2 ? A HIS 24 ? A HIS 24 ? 1_555 104.4 ? 5 OD1 ? A ASP 10 ? A ASP 10 ? 1_555 MN ? B MN . ? A MN 238 ? 1_555 NE2 ? A HIS 24 ? A HIS 24 ? 1_555 121.2 ? 6 OD1 ? A ASP 19 ? A ASP 19 ? 1_555 MN ? B MN . ? A MN 238 ? 1_555 NE2 ? A HIS 24 ? A HIS 24 ? 1_555 90.8 ? 7 OD2 ? A ASP 10 ? A ASP 10 ? 1_555 CA ? C CA . ? A CA 239 ? 1_555 O ? A TYR 12 ? A TYR 12 ? 1_555 87.4 ? 8 OD2 ? A ASP 10 ? A ASP 10 ? 1_555 CA ? C CA . ? A CA 239 ? 1_555 OD1 ? A ASN 14 ? A ASN 14 ? 1_555 146.7 ? 9 O ? A TYR 12 ? A TYR 12 ? 1_555 CA ? C CA . ? A CA 239 ? 1_555 OD1 ? A ASN 14 ? A ASN 14 ? 1_555 98.2 ? 10 OD2 ? A ASP 10 ? A ASP 10 ? 1_555 CA ? C CA . ? A CA 239 ? 1_555 OD2 ? A ASP 19 ? A ASP 19 ? 1_555 117.4 ? 11 O ? A TYR 12 ? A TYR 12 ? 1_555 CA ? C CA . ? A CA 239 ? 1_555 OD2 ? A ASP 19 ? A ASP 19 ? 1_555 108.1 ? 12 OD1 ? A ASN 14 ? A ASN 14 ? 1_555 CA ? C CA . ? A CA 239 ? 1_555 OD2 ? A ASP 19 ? A ASP 19 ? 1_555 92.2 ? 13 OD2 ? A ASP 10 ? A ASP 10 ? 1_555 CA ? C CA . ? A CA 239 ? 1_555 O ? D HOH . ? A HOH 242 ? 1_555 74.1 ? 14 O ? A TYR 12 ? A TYR 12 ? 1_555 CA ? C CA . ? A CA 239 ? 1_555 O ? D HOH . ? A HOH 242 ? 1_555 109.0 ? 15 OD1 ? A ASN 14 ? A ASN 14 ? 1_555 CA ? C CA . ? A CA 239 ? 1_555 O ? D HOH . ? A HOH 242 ? 1_555 73.1 ? 16 OD2 ? A ASP 19 ? A ASP 19 ? 1_555 CA ? C CA . ? A CA 239 ? 1_555 O ? D HOH . ? A HOH 242 ? 1_555 141.6 ? 17 OD2 ? A ASP 10 ? A ASP 10 ? 1_555 CA ? C CA . ? A CA 239 ? 1_555 O ? D HOH . ? A HOH 243 ? 1_555 95.7 ? 18 O ? A TYR 12 ? A TYR 12 ? 1_555 CA ? C CA . ? A CA 239 ? 1_555 O ? D HOH . ? A HOH 243 ? 1_555 174.1 ? 19 OD1 ? A ASN 14 ? A ASN 14 ? 1_555 CA ? C CA . ? A CA 239 ? 1_555 O ? D HOH . ? A HOH 243 ? 1_555 81.9 ? 20 OD2 ? A ASP 19 ? A ASP 19 ? 1_555 CA ? C CA . ? A CA 239 ? 1_555 O ? D HOH . ? A HOH 243 ? 1_555 66.0 ? 21 O ? D HOH . ? A HOH 242 ? 1_555 CA ? C CA . ? A CA 239 ? 1_555 O ? D HOH . ? A HOH 243 ? 1_555 76.7 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 207 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 207 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 ASP _struct_mon_prot_cis.pdbx_label_seq_id_2 208 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 ASP _struct_mon_prot_cis.pdbx_auth_seq_id_2 208 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 8.82 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details I ? 6 ? II ? 7 ? III ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense I 1 2 ? anti-parallel I 2 3 ? anti-parallel I 3 4 ? anti-parallel I 4 5 ? anti-parallel I 5 6 ? anti-parallel II 1 2 ? anti-parallel II 2 3 ? anti-parallel II 3 4 ? anti-parallel II 4 5 ? anti-parallel II 5 6 ? anti-parallel II 6 7 ? anti-parallel III 1 2 ? anti-parallel III 2 3 ? anti-parallel III 3 4 ? anti-parallel III 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id I 1 THR A 73 ? VAL A 79 ? THR A 73 VAL A 79 I 2 LYS A 59 ? TYR A 67 ? LYS A 59 TYR A 67 I 3 THR A 49 ? SER A 56 ? THR A 49 SER A 56 I 4 VAL A 189 ? LEU A 198 ? VAL A 189 LEU A 198 I 5 LEU A 107 ? LEU A 115 ? LEU A 107 LEU A 115 I 6 ASP A 124 ? ASN A 131 ? ASP A 124 ASN A 131 II 1 LYS A 35 ? ALA A 38 ? LYS A 35 ALA A 38 II 2 HIS A 24 ? LYS A 30 ? HIS A 24 LYS A 30 II 3 ILE A 4 ? ASP A 10 ? ILE A 4 ASP A 10 II 4 ASP A 208 ? SER A 215 ? ASP A 208 SER A 215 II 5 ARG A 90 ? THR A 97 ? ARG A 90 THR A 97 II 6 SER A 169 ? TYR A 176 ? SER A 169 TYR A 176 II 7 ASP A 139 ? ASP A 145 ? ASP A 139 ASP A 145 III 1 LYS A 46 ? GLY A 48 ? LYS A 46 GLY A 48 III 2 PHE A 197 ? ILE A 199 ? PHE A 197 ILE A 199 III 3 ASN A 104 ? LEU A 107 ? ASN A 104 LEU A 107 III 4 ASN A 153 ? LEU A 156 ? ASN A 153 LEU A 156 III 5 THR A 147 ? THR A 150 ? THR A 147 THR A 150 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details MN Author ? ? ? ? 7 'RESIDUES BINDING THE MANGANESE ION' CA Author ? ? ? ? 7 'RESIDUES BINDING THE CALCIUM ION' CHO Author ? ? ? ? 12 'RESIDUES INVOLVED IN CARBOHYDRATE BINDING' NP Author ? ? ? ? 10 'RESIDUES INVOLVED IN BINDING NON-POLAR GROUPS' AC1 Software A MN 238 ? 6 'BINDING SITE FOR RESIDUE MN A 238' AC2 Software A CA 239 ? 6 'BINDING SITE FOR RESIDUE CA A 239' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 MN 7 GLU A 8 ? GLU A 8 . ? 1_555 ? 2 MN 7 ASP A 10 ? ASP A 10 . ? 1_555 ? 3 MN 7 ASP A 19 ? ASP A 19 . ? 1_555 ? 4 MN 7 HIS A 24 ? HIS A 24 . ? 1_555 ? 5 MN 7 SER A 34 ? SER A 34 . ? 1_555 ? 6 MN 7 HOH D . ? HOH A 240 . ? 1_555 ? 7 MN 7 HOH D . ? HOH A 241 . ? 1_555 ? 8 CA 7 ASP A 10 ? ASP A 10 . ? 1_555 ? 9 CA 7 TYR A 12 ? TYR A 12 . ? 1_555 ? 10 CA 7 ASN A 14 ? ASN A 14 . ? 1_555 ? 11 CA 7 ASP A 19 ? ASP A 19 . ? 1_555 ? 12 CA 7 ASP A 208 ? ASP A 208 . ? 1_555 ? 13 CA 7 HOH D . ? HOH A 242 . ? 1_555 ? 14 CA 7 HOH D . ? HOH A 243 . ? 1_555 ? 15 CHO 12 TYR A 12 ? TYR A 12 . ? 1_555 ? 16 CHO 12 PRO A 13 ? PRO A 13 . ? 1_555 ? 17 CHO 12 ASN A 14 ? ASN A 14 . ? 1_555 ? 18 CHO 12 THR A 15 ? THR A 15 . ? 1_555 ? 19 CHO 12 ASP A 16 ? ASP A 16 . ? 1_555 ? 20 CHO 12 LEU A 99 ? LEU A 99 . ? 1_555 ? 21 CHO 12 TYR A 100 ? TYR A 100 . ? 1_555 ? 22 CHO 12 SER A 168 ? SER A 168 . ? 1_555 ? 23 CHO 12 HIS A 205 ? HIS A 205 . ? 1_555 ? 24 CHO 12 PRO A 206 ? PRO A 206 . ? 1_555 ? 25 CHO 12 ALA A 207 ? ALA A 207 . ? 1_555 ? 26 CHO 12 ASP A 208 ? ASP A 208 . ? 1_555 ? 27 NP 10 TYR A 54 ? TYR A 54 . ? 1_555 ? 28 NP 10 LEU A 81 ? LEU A 81 . ? 1_555 ? 29 NP 10 LEU A 85 ? LEU A 85 . ? 1_555 ? 30 NP 10 VAL A 89 ? VAL A 89 . ? 1_555 ? 31 NP 10 VAL A 91 ? VAL A 91 . ? 1_555 ? 32 NP 10 PHE A 111 ? PHE A 111 . ? 1_555 ? 33 NP 10 VAL A 179 ? VAL A 179 . ? 1_555 ? 34 NP 10 ILE A 181 ? ILE A 181 . ? 1_555 ? 35 NP 10 PHE A 191 ? PHE A 191 . ? 1_555 ? 36 NP 10 ILE A 214 ? ILE A 214 . ? 1_555 ? 37 AC1 6 GLU A 8 ? GLU A 8 . ? 1_555 ? 38 AC1 6 ASP A 10 ? ASP A 10 . ? 1_555 ? 39 AC1 6 ASP A 19 ? ASP A 19 . ? 1_555 ? 40 AC1 6 HIS A 24 ? HIS A 24 . ? 1_555 ? 41 AC1 6 HOH D . ? HOH A 240 . ? 1_555 ? 42 AC1 6 HOH D . ? HOH A 241 . ? 1_555 ? 43 AC2 6 ASP A 10 ? ASP A 10 . ? 1_555 ? 44 AC2 6 TYR A 12 ? TYR A 12 . ? 1_555 ? 45 AC2 6 ASN A 14 ? ASN A 14 . ? 1_555 ? 46 AC2 6 ASP A 19 ? ASP A 19 . ? 1_555 ? 47 AC2 6 HOH D . ? HOH A 242 . ? 1_555 ? 48 AC2 6 HOH D . ? HOH A 243 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LYS 135 ? ? OD2 A ASP 136 ? ? 1.22 2 1 O A ASN 14 ? ? CB A ASP 19 ? ? 1.72 3 1 OH A TYR 54 ? ? O A ASP 80 ? ? 1.74 4 1 O A LYS 116 ? ? OG A SER 117 ? ? 1.78 5 1 O A ASN 118 ? ? N A THR 120 ? ? 1.80 6 1 CD1 A LEU 115 ? ? CE1 A HIS 180 ? ? 1.87 7 1 OE2 A GLU 87 ? ? CD1 A TRP 182 ? ? 1.91 8 1 O A SER 134 ? ? CG2 A THR 148 ? ? 1.98 9 1 CG A GLU 102 ? ? O A ALA 207 ? ? 2.00 10 1 OE2 A GLU 87 ? ? CG A TRP 182 ? ? 2.01 11 1 OE2 A GLU 87 ? ? NE1 A TRP 182 ? ? 2.04 12 1 O A ARG 228 ? ? N A LEU 230 ? ? 2.06 13 1 OD2 A ASP 208 ? ? O A HOH 242 ? ? 2.07 14 1 CG A GLU 87 ? ? CB A TRP 182 ? ? 2.08 15 1 ND2 A ASN 162 ? ? OG A SER 164 ? ? 2.13 16 1 OE2 A GLU 87 ? ? CE2 A TRP 182 ? ? 2.15 17 1 CB A ILE 141 ? ? O A LEU 174 ? ? 2.16 18 1 OE2 A GLU 87 ? ? CD2 A TRP 182 ? ? 2.16 19 1 OE1 A GLU 8 ? ? OD1 A ASP 10 ? ? 2.17 20 1 CB A PRO 222 ? ? OG A SER 225 ? ? 2.18 21 1 CA A THR 15 ? ? O A ASP 19 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OD1 A ASP 58 ? ? 1_555 CD A ARG 60 ? ? 3_555 1.44 2 1 NE2 A GLN 122 ? ? 1_555 OE1 A GLN 132 ? ? 4_555 1.49 3 1 OD1 A ASP 58 ? ? 1_555 NH1 A ARG 60 ? ? 3_555 1.88 4 1 OD1 A ASP 58 ? ? 1_555 NE A ARG 60 ? ? 3_555 2.06 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 C _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 ASN _pdbx_validate_rmsd_bond.auth_seq_id_1 237 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 O _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 ASN _pdbx_validate_rmsd_bond.auth_seq_id_2 237 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.378 _pdbx_validate_rmsd_bond.bond_target_value 1.229 _pdbx_validate_rmsd_bond.bond_deviation 0.149 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.019 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ILE _pdbx_validate_rmsd_angle.auth_seq_id_1 106 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ILE _pdbx_validate_rmsd_angle.auth_seq_id_2 106 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ILE _pdbx_validate_rmsd_angle.auth_seq_id_3 106 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 129.76 _pdbx_validate_rmsd_angle.angle_target_value 110.90 _pdbx_validate_rmsd_angle.angle_deviation 18.86 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.00 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 20 ? ? -62.27 -179.51 2 1 LYS A 30 ? ? 54.99 -1.29 3 1 ARG A 33 ? ? -62.61 76.31 4 1 SER A 34 ? ? -29.13 143.54 5 1 ASN A 69 ? ? 55.60 -14.74 6 1 LEU A 81 ? ? 90.54 -12.18 7 1 ALA A 95 ? ? -178.28 145.79 8 1 GLU A 102 ? ? 168.71 152.08 9 1 LYS A 116 ? ? -132.46 -154.99 10 1 SER A 117 ? ? 81.53 -120.73 11 1 ASN A 118 ? ? 39.34 15.11 12 1 SER A 119 ? ? 30.03 5.61 13 1 THR A 123 ? ? 79.74 150.40 14 1 PHE A 128 ? ? 166.57 147.67 15 1 ASN A 131 ? ? -169.75 -34.27 16 1 ASP A 136 ? ? 77.92 74.16 17 1 LYS A 138 ? ? 96.27 -37.74 18 1 ASP A 145 ? ? -54.72 -1.80 19 1 THR A 150 ? ? -142.74 -45.11 20 1 ASP A 151 ? ? -162.27 30.71 21 1 SER A 164 ? ? -115.88 77.79 22 1 TRP A 182 ? ? -125.63 -130.84 23 1 GLU A 183 ? ? 101.71 120.48 24 1 THR A 188 ? ? 178.42 121.61 25 1 LYS A 200 ? ? -80.82 -133.19 26 1 SER A 201 ? ? 117.84 112.73 27 1 ALA A 211 ? ? -151.50 -154.23 28 1 SER A 215 ? ? 179.56 -176.84 29 1 ASN A 216 ? ? -56.10 -179.51 30 1 ASP A 218 ? ? -89.15 32.85 31 1 SER A 225 ? ? -89.04 43.04 32 1 ARG A 228 ? ? -68.53 -74.14 33 1 LEU A 229 ? ? -8.68 -52.07 34 1 LEU A 230 ? ? 103.90 -9.53 35 1 LEU A 232 ? ? -136.12 -32.77 36 1 PRO A 234 ? ? -62.63 14.03 37 1 ASP A 235 ? ? 118.99 -88.44 38 1 ALA A 236 ? ? -50.57 96.73 # loop_ _pdbx_validate_chiral.id _pdbx_validate_chiral.PDB_model_num _pdbx_validate_chiral.auth_atom_id _pdbx_validate_chiral.label_alt_id _pdbx_validate_chiral.auth_asym_id _pdbx_validate_chiral.auth_comp_id _pdbx_validate_chiral.auth_seq_id _pdbx_validate_chiral.PDB_ins_code _pdbx_validate_chiral.details _pdbx_validate_chiral.omega 1 1 CB ? A ILE 106 ? PLANAR . 2 1 CB ? A THR 157 ? 'WRONG HAND' . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 HOH O O N N 145 HOH H1 H N N 146 HOH H2 H N N 147 ILE N N N N 148 ILE CA C N S 149 ILE C C N N 150 ILE O O N N 151 ILE CB C N S 152 ILE CG1 C N N 153 ILE CG2 C N N 154 ILE CD1 C N N 155 ILE OXT O N N 156 ILE H H N N 157 ILE H2 H N N 158 ILE HA H N N 159 ILE HB H N N 160 ILE HG12 H N N 161 ILE HG13 H N N 162 ILE HG21 H N N 163 ILE HG22 H N N 164 ILE HG23 H N N 165 ILE HD11 H N N 166 ILE HD12 H N N 167 ILE HD13 H N N 168 ILE HXT H N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 LYS N N N N 192 LYS CA C N S 193 LYS C C N N 194 LYS O O N N 195 LYS CB C N N 196 LYS CG C N N 197 LYS CD C N N 198 LYS CE C N N 199 LYS NZ N N N 200 LYS OXT O N N 201 LYS H H N N 202 LYS H2 H N N 203 LYS HA H N N 204 LYS HB2 H N N 205 LYS HB3 H N N 206 LYS HG2 H N N 207 LYS HG3 H N N 208 LYS HD2 H N N 209 LYS HD3 H N N 210 LYS HE2 H N N 211 LYS HE3 H N N 212 LYS HZ1 H N N 213 LYS HZ2 H N N 214 LYS HZ3 H N N 215 LYS HXT H N N 216 MET N N N N 217 MET CA C N S 218 MET C C N N 219 MET O O N N 220 MET CB C N N 221 MET CG C N N 222 MET SD S N N 223 MET CE C N N 224 MET OXT O N N 225 MET H H N N 226 MET H2 H N N 227 MET HA H N N 228 MET HB2 H N N 229 MET HB3 H N N 230 MET HG2 H N N 231 MET HG3 H N N 232 MET HE1 H N N 233 MET HE2 H N N 234 MET HE3 H N N 235 MET HXT H N N 236 MN MN MN N N 237 PHE N N N N 238 PHE CA C N S 239 PHE C C N N 240 PHE O O N N 241 PHE CB C N N 242 PHE CG C Y N 243 PHE CD1 C Y N 244 PHE CD2 C Y N 245 PHE CE1 C Y N 246 PHE CE2 C Y N 247 PHE CZ C Y N 248 PHE OXT O N N 249 PHE H H N N 250 PHE H2 H N N 251 PHE HA H N N 252 PHE HB2 H N N 253 PHE HB3 H N N 254 PHE HD1 H N N 255 PHE HD2 H N N 256 PHE HE1 H N N 257 PHE HE2 H N N 258 PHE HZ H N N 259 PHE HXT H N N 260 PRO N N N N 261 PRO CA C N S 262 PRO C C N N 263 PRO O O N N 264 PRO CB C N N 265 PRO CG C N N 266 PRO CD C N N 267 PRO OXT O N N 268 PRO H H N N 269 PRO HA H N N 270 PRO HB2 H N N 271 PRO HB3 H N N 272 PRO HG2 H N N 273 PRO HG3 H N N 274 PRO HD2 H N N 275 PRO HD3 H N N 276 PRO HXT H N N 277 SER N N N N 278 SER CA C N S 279 SER C C N N 280 SER O O N N 281 SER CB C N N 282 SER OG O N N 283 SER OXT O N N 284 SER H H N N 285 SER H2 H N N 286 SER HA H N N 287 SER HB2 H N N 288 SER HB3 H N N 289 SER HG H N N 290 SER HXT H N N 291 THR N N N N 292 THR CA C N S 293 THR C C N N 294 THR O O N N 295 THR CB C N R 296 THR OG1 O N N 297 THR CG2 C N N 298 THR OXT O N N 299 THR H H N N 300 THR H2 H N N 301 THR HA H N N 302 THR HB H N N 303 THR HG1 H N N 304 THR HG21 H N N 305 THR HG22 H N N 306 THR HG23 H N N 307 THR HXT H N N 308 TRP N N N N 309 TRP CA C N S 310 TRP C C N N 311 TRP O O N N 312 TRP CB C N N 313 TRP CG C Y N 314 TRP CD1 C Y N 315 TRP CD2 C Y N 316 TRP NE1 N Y N 317 TRP CE2 C Y N 318 TRP CE3 C Y N 319 TRP CZ2 C Y N 320 TRP CZ3 C Y N 321 TRP CH2 C Y N 322 TRP OXT O N N 323 TRP H H N N 324 TRP H2 H N N 325 TRP HA H N N 326 TRP HB2 H N N 327 TRP HB3 H N N 328 TRP HD1 H N N 329 TRP HE1 H N N 330 TRP HE3 H N N 331 TRP HZ2 H N N 332 TRP HZ3 H N N 333 TRP HH2 H N N 334 TRP HXT H N N 335 TYR N N N N 336 TYR CA C N S 337 TYR C C N N 338 TYR O O N N 339 TYR CB C N N 340 TYR CG C Y N 341 TYR CD1 C Y N 342 TYR CD2 C Y N 343 TYR CE1 C Y N 344 TYR CE2 C Y N 345 TYR CZ C Y N 346 TYR OH O N N 347 TYR OXT O N N 348 TYR H H N N 349 TYR H2 H N N 350 TYR HA H N N 351 TYR HB2 H N N 352 TYR HB3 H N N 353 TYR HD1 H N N 354 TYR HD2 H N N 355 TYR HE1 H N N 356 TYR HE2 H N N 357 TYR HH H N N 358 TYR HXT H N N 359 VAL N N N N 360 VAL CA C N S 361 VAL C C N N 362 VAL O O N N 363 VAL CB C N N 364 VAL CG1 C N N 365 VAL CG2 C N N 366 VAL OXT O N N 367 VAL H H N N 368 VAL H2 H N N 369 VAL HA H N N 370 VAL HB H N N 371 VAL HG11 H N N 372 VAL HG12 H N N 373 VAL HG13 H N N 374 VAL HG21 H N N 375 VAL HG22 H N N 376 VAL HG23 H N N 377 VAL HXT H N N 378 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _atom_sites.entry_id 3CNA _atom_sites.fract_transf_matrix[1][1] .015835 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] .011506 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] .011204 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # _atom_sites_footnote.id 1 _atom_sites_footnote.text ;THESE RESIDUES (187-190) ARE ORDERED IN THIS COORDINATE SET TO REFLECT BEST AGREEMENT WITH THE ELECTRON DENSITY. THIS REGION WAS AMBIGUOUS IN THE CHEMICAL DETERMINATION OF THE PRIMARY STRUCTURE. ; # loop_ _atom_type.symbol C CA MN N O S # loop_ #