data_3CR4 # _entry.id 3CR4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3CR4 RCSB RCSB047112 WWPDB D_1000047112 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3CR2 . unspecified PDB 3CR5 . unspecified # _pdbx_database_status.entry_id 3CR4 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-04-04 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # _audit_author.name 'Charpentier, T.H.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Divalent metal ion complexes of S100B in the absence and presence of pentamidine.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 382 _citation.page_first 56 _citation.page_last 73 _citation.year 2008 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18602402 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2008.06.047 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Charpentier, T.H.' 1 primary 'Wilder, P.T.' 2 primary 'Liriano, M.A.' 3 primary 'Varney, K.M.' 4 primary 'Pozharski, E.' 5 primary 'MacKerell, A.D.' 6 primary 'Coop, A.' 7 primary 'Toth, E.A.' 8 primary 'Weber, D.J.' 9 # _cell.entry_id 3CR4 _cell.length_a 63.587 _cell.length_b 63.587 _cell.length_c 48.248 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3CR4 _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein S100-B' 10681.974 1 ? ? ? ? 2 non-polymer syn '1,5-BIS(4-AMIDINOPHENOXY)PENTANE' 340.419 2 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 4 water nat water 18.015 35 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'S100 calcium-binding protein B, S-100 protein subunit beta, S-100 protein beta chain' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM ITTACHEFFEHE ; _entity_poly.pdbx_seq_one_letter_code_can ;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM ITTACHEFFEHE ; _entity_poly.pdbx_strand_id X _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLU n 1 4 LEU n 1 5 GLU n 1 6 LYS n 1 7 ALA n 1 8 VAL n 1 9 VAL n 1 10 ALA n 1 11 LEU n 1 12 ILE n 1 13 ASP n 1 14 VAL n 1 15 PHE n 1 16 HIS n 1 17 GLN n 1 18 TYR n 1 19 SER n 1 20 GLY n 1 21 ARG n 1 22 GLU n 1 23 GLY n 1 24 ASP n 1 25 LYS n 1 26 HIS n 1 27 LYS n 1 28 LEU n 1 29 LYS n 1 30 LYS n 1 31 SER n 1 32 GLU n 1 33 LEU n 1 34 LYS n 1 35 GLU n 1 36 LEU n 1 37 ILE n 1 38 ASN n 1 39 ASN n 1 40 GLU n 1 41 LEU n 1 42 SER n 1 43 HIS n 1 44 PHE n 1 45 LEU n 1 46 GLU n 1 47 GLU n 1 48 ILE n 1 49 LYS n 1 50 GLU n 1 51 GLN n 1 52 GLU n 1 53 VAL n 1 54 VAL n 1 55 ASP n 1 56 LYS n 1 57 VAL n 1 58 MET n 1 59 GLU n 1 60 THR n 1 61 LEU n 1 62 ASP n 1 63 SER n 1 64 ASP n 1 65 GLY n 1 66 ASP n 1 67 GLY n 1 68 GLU n 1 69 CYS n 1 70 ASP n 1 71 PHE n 1 72 GLN n 1 73 GLU n 1 74 PHE n 1 75 MET n 1 76 ALA n 1 77 PHE n 1 78 VAL n 1 79 ALA n 1 80 MET n 1 81 ILE n 1 82 THR n 1 83 THR n 1 84 ALA n 1 85 CYS n 1 86 HIS n 1 87 GLU n 1 88 PHE n 1 89 PHE n 1 90 GLU n 1 91 HIS n 1 92 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Bovine _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene S100B _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'HMS174(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code S100B_BOVIN _struct_ref.pdbx_db_accession P02638 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAM ITTACHEFFEHE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3CR4 _struct_ref_seq.pdbx_strand_id X _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 92 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02638 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 92 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 91 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PNT non-polymer . '1,5-BIS(4-AMIDINOPHENOXY)PENTANE' ? 'C19 H24 N4 O2' 340.419 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3CR4 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.28 _exptl_crystal.density_percent_sol 46.12 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.1 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'PEG3350, CaCl2, Penamidine, Cacodylate buffer, pH 7.1, VAPOR DIFFUSION, SITTING DROP, temperature 298K' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.pdbx_collection_date 2005-08-05 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU MICROMAX-007' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 3CR4 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.000 _reflns.d_resolution_high 2.150 _reflns.number_obs 5795 _reflns.number_all ? _reflns.percent_possible_obs 100.000 _reflns.pdbx_Rmerge_I_obs 0.081 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 9.600 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 12.000 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_unique_obs _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.15 2.23 100.00 0.666 ? ? 12.10 ? ? ? ? ? ? 1 1 2.23 2.32 100.00 0.502 ? ? 12.10 ? ? ? ? ? ? 2 1 2.32 2.42 100.00 0.375 ? ? 12.20 ? ? ? ? ? ? 3 1 2.42 2.55 100.00 0.281 ? ? 12.10 ? ? ? ? ? ? 4 1 2.55 2.71 100.00 0.227 ? ? 12.30 ? ? ? ? ? ? 5 1 2.71 2.92 100.00 0.142 ? ? 12.20 ? ? ? ? ? ? 6 1 2.92 3.21 100.00 0.106 ? ? 12.20 ? ? ? ? ? ? 7 1 3.21 3.68 100.00 0.064 ? ? 12.20 ? ? ? ? ? ? 8 1 3.68 4.63 100.00 0.046 ? ? 11.90 ? ? ? ? ? ? 9 1 4.63 50.00 99.70 0.031 ? ? 11.00 ? ? ? ? ? ? 10 1 # _refine.entry_id 3CR4 _refine.ls_number_reflns_obs 5502 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 44.95 _refine.ls_d_res_high 2.15 _refine.ls_percent_reflns_obs 99.98 _refine.ls_R_factor_obs 0.21086 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.20858 _refine.ls_R_factor_R_free 0.26596 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.6 _refine.ls_number_reflns_R_free 263 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.950 _refine.correlation_coeff_Fo_to_Fc_free 0.891 _refine.B_iso_mean 35.872 _refine.aniso_B[1][1] -0.32 _refine.aniso_B[2][2] -0.32 _refine.aniso_B[3][3] 0.64 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.274 _refine.pdbx_overall_ESU_R_Free 0.223 _refine.overall_SU_ML 0.152 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 13.390 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 727 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 52 _refine_hist.number_atoms_solvent 35 _refine_hist.number_atoms_total 814 _refine_hist.d_res_high 2.15 _refine_hist.d_res_low 44.95 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.008 0.021 ? 790 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.135 2.019 ? 1053 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 4.409 5.000 ? 89 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 35.177 26.500 ? 40 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 16.115 15.000 ? 145 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 8.486 15.000 ? 1 'X-RAY DIFFRACTION' ? r_chiral_restr 0.091 0.200 ? 108 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.003 0.020 ? 598 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.213 0.200 ? 365 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.302 0.200 ? 534 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.117 0.200 ? 39 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined 0.097 0.200 ? 9 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.162 0.200 ? 52 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.144 0.200 ? 9 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.458 1.500 ? 460 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 0.713 2.000 ? 714 'X-RAY DIFFRACTION' ? r_scbond_it 1.082 3.000 ? 368 'X-RAY DIFFRACTION' ? r_scangle_it 1.671 4.500 ? 339 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.147 _refine_ls_shell.d_res_low 2.203 _refine_ls_shell.number_reflns_R_work 390 _refine_ls_shell.R_factor_R_work 0.252 _refine_ls_shell.percent_reflns_obs 99.76 _refine_ls_shell.R_factor_R_free 0.267 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 27 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3CR4 _struct.title 'X-ray structure of bovine Pnt,Ca(2+)-S100B' _struct.pdbx_descriptor 'Protein S100-B' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3CR4 _struct_keywords.text 'EF hand, Alpha helical, Metal-binding, Nucleus, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 2 ? GLY A 20 ? SER X 1 GLY X 19 1 ? 19 HELX_P HELX_P2 2 LYS A 29 ? LEU A 41 ? LYS X 28 LEU X 40 1 ? 13 HELX_P HELX_P3 3 GLU A 50 ? ASP A 62 ? GLU X 49 ASP X 61 1 ? 13 HELX_P HELX_P4 4 ASP A 70 ? GLU A 87 ? ASP X 69 GLU X 86 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A SER 19 O ? ? ? 1_555 D CA . CA ? ? X SER 18 X CA 103 1_555 ? ? ? ? ? ? ? 2.286 ? metalc2 metalc ? ? A GLU 22 O ? ? ? 1_555 D CA . CA ? ? X GLU 21 X CA 103 1_555 ? ? ? ? ? ? ? 2.400 ? metalc3 metalc ? ? A ASP 24 O ? ? ? 1_555 D CA . CA ? ? X ASP 23 X CA 103 1_555 ? ? ? ? ? ? ? 2.377 ? metalc4 metalc ? ? A LYS 27 O ? ? ? 1_555 D CA . CA ? ? X LYS 26 X CA 103 1_555 ? ? ? ? ? ? ? 2.394 ? metalc5 metalc ? ? A GLU 32 OE1 ? ? ? 1_555 D CA . CA ? ? X GLU 31 X CA 103 1_555 ? ? ? ? ? ? ? 2.494 ? metalc6 metalc ? ? A GLU 32 OE2 ? ? ? 1_555 D CA . CA ? ? X GLU 31 X CA 103 1_555 ? ? ? ? ? ? ? 2.554 ? metalc7 metalc ? ? A ASP 62 OD1 ? ? ? 1_555 E CA . CA ? ? X ASP 61 X CA 104 1_555 ? ? ? ? ? ? ? 2.303 ? metalc8 metalc ? ? A ASP 64 OD1 ? ? ? 1_555 E CA . CA ? ? X ASP 63 X CA 104 1_555 ? ? ? ? ? ? ? 2.306 ? metalc9 metalc ? ? A ASP 66 OD1 ? ? ? 1_555 E CA . CA ? ? X ASP 65 X CA 104 1_555 ? ? ? ? ? ? ? 2.298 ? metalc10 metalc ? ? A GLU 68 O ? ? ? 1_555 E CA . CA ? ? X GLU 67 X CA 104 1_555 ? ? ? ? ? ? ? 2.344 ? metalc11 metalc ? ? A GLU 73 OE1 ? ? ? 1_555 E CA . CA ? ? X GLU 72 X CA 104 1_555 ? ? ? ? ? ? ? 2.540 ? metalc12 metalc ? ? A GLU 73 OE2 ? ? ? 1_555 E CA . CA ? ? X GLU 72 X CA 104 1_555 ? ? ? ? ? ? ? 2.569 ? metalc13 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? X CA 103 X HOH 105 1_555 ? ? ? ? ? ? ? 2.292 ? metalc14 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? X CA 104 X HOH 112 1_555 ? ? ? ? ? ? ? 2.485 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE PNT X 101' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE PNT X 102' AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA X 103' AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA X 104' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 MET A 1 ? MET X 0 . ? 2_555 ? 2 AC1 7 ILE A 12 ? ILE X 11 . ? 2_555 ? 3 AC1 7 ASP A 13 ? ASP X 12 . ? 2_555 ? 4 AC1 7 HIS A 16 ? HIS X 15 . ? 2_555 ? 5 AC1 7 CYS A 85 ? CYS X 84 . ? 7_556 ? 6 AC1 7 HIS A 86 ? HIS X 85 . ? 1_555 ? 7 AC1 7 PHE A 88 ? PHE X 87 . ? 1_555 ? 8 AC2 4 MET A 1 ? MET X 0 . ? 8_555 ? 9 AC2 4 HIS A 43 ? HIS X 42 . ? 7_556 ? 10 AC2 4 PHE A 44 ? PHE X 43 . ? 1_555 ? 11 AC2 4 PHE A 89 ? PHE X 88 . ? 1_555 ? 12 AC3 6 SER A 19 ? SER X 18 . ? 1_555 ? 13 AC3 6 GLU A 22 ? GLU X 21 . ? 1_555 ? 14 AC3 6 ASP A 24 ? ASP X 23 . ? 1_555 ? 15 AC3 6 LYS A 27 ? LYS X 26 . ? 1_555 ? 16 AC3 6 GLU A 32 ? GLU X 31 . ? 1_555 ? 17 AC3 6 HOH F . ? HOH X 105 . ? 1_555 ? 18 AC4 6 ASP A 62 ? ASP X 61 . ? 1_555 ? 19 AC4 6 ASP A 64 ? ASP X 63 . ? 1_555 ? 20 AC4 6 ASP A 66 ? ASP X 65 . ? 1_555 ? 21 AC4 6 GLU A 68 ? GLU X 67 . ? 1_555 ? 22 AC4 6 GLU A 73 ? GLU X 72 . ? 1_555 ? 23 AC4 6 HOH F . ? HOH X 112 . ? 1_555 ? # _atom_sites.entry_id 3CR4 _atom_sites.fract_transf_matrix[1][1] 0.015726 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015726 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020726 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET X . n A 1 2 SER 2 1 1 SER SER X . n A 1 3 GLU 3 2 2 GLU GLU X . n A 1 4 LEU 4 3 3 LEU LEU X . n A 1 5 GLU 5 4 4 GLU GLU X . n A 1 6 LYS 6 5 5 LYS LYS X . n A 1 7 ALA 7 6 6 ALA ALA X . n A 1 8 VAL 8 7 7 VAL VAL X . n A 1 9 VAL 9 8 8 VAL VAL X . n A 1 10 ALA 10 9 9 ALA ALA X . n A 1 11 LEU 11 10 10 LEU LEU X . n A 1 12 ILE 12 11 11 ILE ILE X . n A 1 13 ASP 13 12 12 ASP ASP X . n A 1 14 VAL 14 13 13 VAL VAL X . n A 1 15 PHE 15 14 14 PHE PHE X . n A 1 16 HIS 16 15 15 HIS HIS X . n A 1 17 GLN 17 16 16 GLN GLN X . n A 1 18 TYR 18 17 17 TYR TYR X . n A 1 19 SER 19 18 18 SER SER X . n A 1 20 GLY 20 19 19 GLY GLY X . n A 1 21 ARG 21 20 20 ARG ARG X . n A 1 22 GLU 22 21 21 GLU GLU X . n A 1 23 GLY 23 22 22 GLY GLY X . n A 1 24 ASP 24 23 23 ASP ASP X . n A 1 25 LYS 25 24 24 LYS LYS X . n A 1 26 HIS 26 25 25 HIS HIS X . n A 1 27 LYS 27 26 26 LYS LYS X . n A 1 28 LEU 28 27 27 LEU LEU X . n A 1 29 LYS 29 28 28 LYS LYS X . n A 1 30 LYS 30 29 29 LYS LYS X . n A 1 31 SER 31 30 30 SER SER X . n A 1 32 GLU 32 31 31 GLU GLU X . n A 1 33 LEU 33 32 32 LEU LEU X . n A 1 34 LYS 34 33 33 LYS LYS X . n A 1 35 GLU 35 34 34 GLU GLU X . n A 1 36 LEU 36 35 35 LEU LEU X . n A 1 37 ILE 37 36 36 ILE ILE X . n A 1 38 ASN 38 37 37 ASN ASN X . n A 1 39 ASN 39 38 38 ASN ASN X . n A 1 40 GLU 40 39 39 GLU GLU X . n A 1 41 LEU 41 40 40 LEU LEU X . n A 1 42 SER 42 41 41 SER SER X . n A 1 43 HIS 43 42 42 HIS HIS X . n A 1 44 PHE 44 43 43 PHE PHE X . n A 1 45 LEU 45 44 44 LEU LEU X . n A 1 46 GLU 46 45 45 GLU GLU X . n A 1 47 GLU 47 46 46 GLU GLU X . n A 1 48 ILE 48 47 47 ILE ILE X . n A 1 49 LYS 49 48 48 LYS LYS X . n A 1 50 GLU 50 49 49 GLU GLU X . n A 1 51 GLN 51 50 50 GLN GLN X . n A 1 52 GLU 52 51 51 GLU GLU X . n A 1 53 VAL 53 52 52 VAL VAL X . n A 1 54 VAL 54 53 53 VAL VAL X . n A 1 55 ASP 55 54 54 ASP ASP X . n A 1 56 LYS 56 55 55 LYS LYS X . n A 1 57 VAL 57 56 56 VAL VAL X . n A 1 58 MET 58 57 57 MET MET X . n A 1 59 GLU 59 58 58 GLU GLU X . n A 1 60 THR 60 59 59 THR THR X . n A 1 61 LEU 61 60 60 LEU LEU X . n A 1 62 ASP 62 61 61 ASP ASP X . n A 1 63 SER 63 62 62 SER SER X . n A 1 64 ASP 64 63 63 ASP ASP X . n A 1 65 GLY 65 64 64 GLY GLY X . n A 1 66 ASP 66 65 65 ASP ASP X . n A 1 67 GLY 67 66 66 GLY GLY X . n A 1 68 GLU 68 67 67 GLU GLU X . n A 1 69 CYS 69 68 68 CYS CYS X . n A 1 70 ASP 70 69 69 ASP ASP X . n A 1 71 PHE 71 70 70 PHE PHE X . n A 1 72 GLN 72 71 71 GLN GLN X . n A 1 73 GLU 73 72 72 GLU GLU X . n A 1 74 PHE 74 73 73 PHE PHE X . n A 1 75 MET 75 74 74 MET MET X . n A 1 76 ALA 76 75 75 ALA ALA X . n A 1 77 PHE 77 76 76 PHE PHE X . n A 1 78 VAL 78 77 77 VAL VAL X . n A 1 79 ALA 79 78 78 ALA ALA X . n A 1 80 MET 80 79 79 MET MET X . n A 1 81 ILE 81 80 80 ILE ILE X . n A 1 82 THR 82 81 81 THR THR X . n A 1 83 THR 83 82 82 THR THR X . n A 1 84 ALA 84 83 83 ALA ALA X . n A 1 85 CYS 85 84 84 CYS CYS X . n A 1 86 HIS 86 85 85 HIS HIS X . n A 1 87 GLU 87 86 86 GLU GLU X . n A 1 88 PHE 88 87 87 PHE PHE X . n A 1 89 PHE 89 88 88 PHE PHE X . n A 1 90 GLU 90 89 89 GLU GLU X . n A 1 91 HIS 91 90 ? ? ? X . n A 1 92 GLU 92 91 ? ? ? X . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PNT 1 101 101 PNT PNT X . C 2 PNT 1 102 101 PNT PNT X . D 3 CA 1 103 90 CA CA X . E 3 CA 1 104 91 CA CA X . F 4 HOH 1 105 1 HOH HOH X . F 4 HOH 2 106 2 HOH HOH X . F 4 HOH 3 107 3 HOH HOH X . F 4 HOH 4 108 4 HOH HOH X . F 4 HOH 5 109 5 HOH HOH X . F 4 HOH 6 110 6 HOH HOH X . F 4 HOH 7 111 7 HOH HOH X . F 4 HOH 8 112 8 HOH HOH X . F 4 HOH 9 113 9 HOH HOH X . F 4 HOH 10 114 10 HOH HOH X . F 4 HOH 11 115 11 HOH HOH X . F 4 HOH 12 116 12 HOH HOH X . F 4 HOH 13 117 13 HOH HOH X . F 4 HOH 14 118 14 HOH HOH X . F 4 HOH 15 119 15 HOH HOH X . F 4 HOH 16 120 16 HOH HOH X . F 4 HOH 17 121 17 HOH HOH X . F 4 HOH 18 122 18 HOH HOH X . F 4 HOH 19 123 19 HOH HOH X . F 4 HOH 20 124 20 HOH HOH X . F 4 HOH 21 125 21 HOH HOH X . F 4 HOH 22 126 22 HOH HOH X . F 4 HOH 23 127 23 HOH HOH X . F 4 HOH 24 128 24 HOH HOH X . F 4 HOH 25 129 25 HOH HOH X . F 4 HOH 26 130 26 HOH HOH X . F 4 HOH 27 131 27 HOH HOH X . F 4 HOH 28 132 28 HOH HOH X . F 4 HOH 29 133 29 HOH HOH X . F 4 HOH 30 134 30 HOH HOH X . F 4 HOH 31 135 31 HOH HOH X . F 4 HOH 32 136 32 HOH HOH X . F 4 HOH 33 137 33 HOH HOH X . F 4 HOH 34 138 34 HOH HOH X . F 4 HOH 35 139 35 HOH HOH X . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4190 ? 1 MORE -63.9 ? 1 'SSA (A^2)' 10880 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 -y,-x,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 24.1240000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A SER 19 ? X SER 18 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O ? A GLU 22 ? X GLU 21 ? 1_555 98.7 ? 2 O ? A SER 19 ? X SER 18 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O ? A ASP 24 ? X ASP 23 ? 1_555 85.1 ? 3 O ? A GLU 22 ? X GLU 21 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O ? A ASP 24 ? X ASP 23 ? 1_555 86.1 ? 4 O ? A SER 19 ? X SER 18 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O ? A LYS 27 ? X LYS 26 ? 1_555 88.6 ? 5 O ? A GLU 22 ? X GLU 21 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O ? A LYS 27 ? X LYS 26 ? 1_555 167.2 ? 6 O ? A ASP 24 ? X ASP 23 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O ? A LYS 27 ? X LYS 26 ? 1_555 84.1 ? 7 O ? A SER 19 ? X SER 18 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 OE1 ? A GLU 32 ? X GLU 31 ? 1_555 96.6 ? 8 O ? A GLU 22 ? X GLU 21 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 OE1 ? A GLU 32 ? X GLU 31 ? 1_555 115.3 ? 9 O ? A ASP 24 ? X ASP 23 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 OE1 ? A GLU 32 ? X GLU 31 ? 1_555 157.8 ? 10 O ? A LYS 27 ? X LYS 26 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 OE1 ? A GLU 32 ? X GLU 31 ? 1_555 73.9 ? 11 O ? A SER 19 ? X SER 18 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 OE2 ? A GLU 32 ? X GLU 31 ? 1_555 73.7 ? 12 O ? A GLU 22 ? X GLU 21 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 OE2 ? A GLU 32 ? X GLU 31 ? 1_555 74.5 ? 13 O ? A ASP 24 ? X ASP 23 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 OE2 ? A GLU 32 ? X GLU 31 ? 1_555 148.4 ? 14 O ? A LYS 27 ? X LYS 26 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 OE2 ? A GLU 32 ? X GLU 31 ? 1_555 117.9 ? 15 OE1 ? A GLU 32 ? X GLU 31 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 OE2 ? A GLU 32 ? X GLU 31 ? 1_555 50.9 ? 16 O ? A SER 19 ? X SER 18 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O ? F HOH . ? X HOH 105 ? 1_555 170.1 ? 17 O ? A GLU 22 ? X GLU 21 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O ? F HOH . ? X HOH 105 ? 1_555 88.6 ? 18 O ? A ASP 24 ? X ASP 23 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O ? F HOH . ? X HOH 105 ? 1_555 88.8 ? 19 O ? A LYS 27 ? X LYS 26 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O ? F HOH . ? X HOH 105 ? 1_555 83.0 ? 20 OE1 ? A GLU 32 ? X GLU 31 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O ? F HOH . ? X HOH 105 ? 1_555 86.2 ? 21 OE2 ? A GLU 32 ? X GLU 31 ? 1_555 CA ? D CA . ? X CA 103 ? 1_555 O ? F HOH . ? X HOH 105 ? 1_555 115.0 ? 22 OD1 ? A ASP 62 ? X ASP 61 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OD1 ? A ASP 64 ? X ASP 63 ? 1_555 81.8 ? 23 OD1 ? A ASP 62 ? X ASP 61 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OD1 ? A ASP 66 ? X ASP 65 ? 1_555 85.0 ? 24 OD1 ? A ASP 64 ? X ASP 63 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OD1 ? A ASP 66 ? X ASP 65 ? 1_555 81.4 ? 25 OD1 ? A ASP 62 ? X ASP 61 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 O ? A GLU 68 ? X GLU 67 ? 1_555 87.7 ? 26 OD1 ? A ASP 64 ? X ASP 63 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 O ? A GLU 68 ? X GLU 67 ? 1_555 160.2 ? 27 OD1 ? A ASP 66 ? X ASP 65 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 O ? A GLU 68 ? X GLU 67 ? 1_555 80.9 ? 28 OD1 ? A ASP 62 ? X ASP 61 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OE1 ? A GLU 73 ? X GLU 72 ? 1_555 116.1 ? 29 OD1 ? A ASP 64 ? X ASP 63 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OE1 ? A GLU 73 ? X GLU 72 ? 1_555 124.1 ? 30 OD1 ? A ASP 66 ? X ASP 65 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OE1 ? A GLU 73 ? X GLU 72 ? 1_555 147.3 ? 31 O ? A GLU 68 ? X GLU 67 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OE1 ? A GLU 73 ? X GLU 72 ? 1_555 75.6 ? 32 OD1 ? A ASP 62 ? X ASP 61 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OE2 ? A GLU 73 ? X GLU 72 ? 1_555 89.1 ? 33 OD1 ? A ASP 64 ? X ASP 63 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OE2 ? A GLU 73 ? X GLU 72 ? 1_555 79.5 ? 34 OD1 ? A ASP 66 ? X ASP 65 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OE2 ? A GLU 73 ? X GLU 72 ? 1_555 160.7 ? 35 O ? A GLU 68 ? X GLU 67 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OE2 ? A GLU 73 ? X GLU 72 ? 1_555 117.3 ? 36 OE1 ? A GLU 73 ? X GLU 72 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 OE2 ? A GLU 73 ? X GLU 72 ? 1_555 50.8 ? 37 OD1 ? A ASP 62 ? X ASP 61 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 O ? F HOH . ? X HOH 112 ? 1_555 160.8 ? 38 OD1 ? A ASP 64 ? X ASP 63 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 O ? F HOH . ? X HOH 112 ? 1_555 89.9 ? 39 OD1 ? A ASP 66 ? X ASP 65 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 O ? F HOH . ? X HOH 112 ? 1_555 76.6 ? 40 O ? A GLU 68 ? X GLU 67 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 O ? F HOH . ? X HOH 112 ? 1_555 94.7 ? 41 OE1 ? A GLU 73 ? X GLU 72 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 O ? F HOH . ? X HOH 112 ? 1_555 82.9 ? 42 OE2 ? A GLU 73 ? X GLU 72 ? 1_555 CA ? E CA . ? X CA 104 ? 1_555 O ? F HOH . ? X HOH 112 ? 1_555 106.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-08-05 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 3 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 13.8196 _pdbx_refine_tls.origin_y 1.0811 _pdbx_refine_tls.origin_z 9.9934 _pdbx_refine_tls.T[1][1] -0.0758 _pdbx_refine_tls.T[2][2] -0.1203 _pdbx_refine_tls.T[3][3] -0.0789 _pdbx_refine_tls.T[1][2] 0.0231 _pdbx_refine_tls.T[1][3] -0.0427 _pdbx_refine_tls.T[2][3] 0.0641 _pdbx_refine_tls.L[1][1] 4.7768 _pdbx_refine_tls.L[2][2] 3.3515 _pdbx_refine_tls.L[3][3] 2.7285 _pdbx_refine_tls.L[1][2] 0.3722 _pdbx_refine_tls.L[1][3] -1.6573 _pdbx_refine_tls.L[2][3] -0.6051 _pdbx_refine_tls.S[1][1] 0.0054 _pdbx_refine_tls.S[1][2] -0.0311 _pdbx_refine_tls.S[1][3] 0.2702 _pdbx_refine_tls.S[2][1] 0.3327 _pdbx_refine_tls.S[2][2] -0.1041 _pdbx_refine_tls.S[2][3] -0.3580 _pdbx_refine_tls.S[3][1] -0.2390 _pdbx_refine_tls.S[3][2] 0.1208 _pdbx_refine_tls.S[3][3] 0.0987 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.selection_details 1 1 X 0 A 1 X 89 A 90 ? 'X-RAY DIFFRACTION' ? 2 1 X 101 B . X 101 B . ? 'X-RAY DIFFRACTION' ? 3 1 X 105 F . X 139 F . ? 'X-RAY DIFFRACTION' ? 4 1 X 102 C . X 102 C . ? 'X-RAY DIFFRACTION' ? # _pdbx_phasing_MR.entry_id 3CR4 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 2.530 _pdbx_phasing_MR.d_res_low_rotation 38.440 _pdbx_phasing_MR.d_res_high_translation 2.530 _pdbx_phasing_MR.d_res_low_translation 38.440 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal DENZO . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data reduction' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 1 SCALEPACK . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data scaling' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 2 MOLREP . ? other 'A. Vagin' alexei@ysbl.york.ac.uk phasing http://www.ccp4.ac.uk/dist/html/molrep.html Fortran_77 ? 3 REFMAC . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran_77 ? 4 PDB_EXTRACT 3.005 'September 10, 2007' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 5 CrystalClear . ? ? ? ? 'data collection' ? ? ? 6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 X HIS 90 ? A HIS 91 2 1 Y 1 X GLU 91 ? A GLU 92 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1,5-BIS(4-AMIDINOPHENOXY)PENTANE' PNT 3 'CALCIUM ION' CA 4 water HOH #