data_3CTV # _entry.id 3CTV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.313 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3CTV RCSB RCSB047202 WWPDB D_1000047202 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type TargetDB APC7539 . unspecified PDB 3HDH 'PIG HEART SHORT CHAIN L-3-HYDROXYACYL COA DEHYDROGENASE' unspecified # _pdbx_database_status.entry_id 3CTV _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-04-14 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Osipiuk, J.' 1 'Evdokimova, E.' 2 'Kudritska, M.' 3 'Savchenko, A.' 4 'Edwards, A.M.' 5 'Joachimiak, A.' 6 'Midwest Center for Structural Genomics (MCSG)' 7 # _citation.id primary _citation.title 'X-ray crystal structure of central domain of 3-hydroxyacyl-CoA dehydrogenase from Archaeoglobus fulgidus.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Osipiuk, J.' 1 ? primary 'Evdokimova, E.' 2 ? primary 'Kudritska, M.' 3 ? primary 'Savchenko, A.' 4 ? primary 'Edwards, A.M.' 5 ? primary 'Joachimiak, A.' 6 ? # _cell.length_a 101.464 _cell.length_b 101.464 _cell.length_c 101.464 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 3CTV _cell.pdbx_unique_axis ? _cell.Z_PDB 24 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'I 21 3' _symmetry.entry_id 3CTV _symmetry.Int_Tables_number 199 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '3-hydroxyacyl-CoA dehydrogenase' 12168.692 1 ? ? 'Central domain: Residues 295-400' ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 water nat water 18.015 3 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Hbd-10 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GHSKGRPQIDSSKATDKINP(MSE)DFTFVEINEAVKLVE(MSE)GVATPQDIDTAIKLGLNRPFGPFELAKQFGAEQIA KRLEELAKQFGKKIFEPAKTLKEGKLEELLKAGKAEGS ; _entity_poly.pdbx_seq_one_letter_code_can ;GHSKGRPQIDSSKATDKINPMDFTFVEINEAVKLVEMGVATPQDIDTAIKLGLNRPFGPFELAKQFGAEQIAKRLEELAK QFGKKIFEPAKTLKEGKLEELLKAGKAEGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier APC7539 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 SER n 1 4 LYS n 1 5 GLY n 1 6 ARG n 1 7 PRO n 1 8 GLN n 1 9 ILE n 1 10 ASP n 1 11 SER n 1 12 SER n 1 13 LYS n 1 14 ALA n 1 15 THR n 1 16 ASP n 1 17 LYS n 1 18 ILE n 1 19 ASN n 1 20 PRO n 1 21 MSE n 1 22 ASP n 1 23 PHE n 1 24 THR n 1 25 PHE n 1 26 VAL n 1 27 GLU n 1 28 ILE n 1 29 ASN n 1 30 GLU n 1 31 ALA n 1 32 VAL n 1 33 LYS n 1 34 LEU n 1 35 VAL n 1 36 GLU n 1 37 MSE n 1 38 GLY n 1 39 VAL n 1 40 ALA n 1 41 THR n 1 42 PRO n 1 43 GLN n 1 44 ASP n 1 45 ILE n 1 46 ASP n 1 47 THR n 1 48 ALA n 1 49 ILE n 1 50 LYS n 1 51 LEU n 1 52 GLY n 1 53 LEU n 1 54 ASN n 1 55 ARG n 1 56 PRO n 1 57 PHE n 1 58 GLY n 1 59 PRO n 1 60 PHE n 1 61 GLU n 1 62 LEU n 1 63 ALA n 1 64 LYS n 1 65 GLN n 1 66 PHE n 1 67 GLY n 1 68 ALA n 1 69 GLU n 1 70 GLN n 1 71 ILE n 1 72 ALA n 1 73 LYS n 1 74 ARG n 1 75 LEU n 1 76 GLU n 1 77 GLU n 1 78 LEU n 1 79 ALA n 1 80 LYS n 1 81 GLN n 1 82 PHE n 1 83 GLY n 1 84 LYS n 1 85 LYS n 1 86 ILE n 1 87 PHE n 1 88 GLU n 1 89 PRO n 1 90 ALA n 1 91 LYS n 1 92 THR n 1 93 LEU n 1 94 LYS n 1 95 GLU n 1 96 GLY n 1 97 LYS n 1 98 LEU n 1 99 GLU n 1 100 GLU n 1 101 LEU n 1 102 LEU n 1 103 LYS n 1 104 ALA n 1 105 GLY n 1 106 LYS n 1 107 ALA n 1 108 GLU n 1 109 GLY n 1 110 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Archaeoglobus _entity_src_gen.pdbx_gene_src_gene AF_2273 _entity_src_gen.gene_src_species 'Archaeoglobus fulgidus' _entity_src_gen.gene_src_strain 'DSM 4304 / VC-16 / JCM 9628 / NBRC 100126' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Archaeoglobus fulgidus DSM 4304' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224325 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 49558 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'Modified pET15b' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O28011_ARCFU _struct_ref.pdbx_db_accession O28011 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SKGRPQIDSSKATDKINPMDFTFVEINEAVKLVEMGVATPQDIDTAIKLGLNRPFGPFELAKQFGAEQIAKRLEELAKQF GKKIFEPAKTLKEGKLEELLKAGKAE ; _struct_ref.pdbx_align_begin 295 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3CTV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 108 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O28011 _struct_ref_seq.db_align_beg 295 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 400 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 106 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3CTV GLY A 1 ? UNP O28011 ? ? 'EXPRESSION TAG' -1 1 1 3CTV HIS A 2 ? UNP O28011 ? ? 'EXPRESSION TAG' 0 2 1 3CTV GLY A 109 ? UNP O28011 ? ? 'EXPRESSION TAG' 107 3 1 3CTV SER A 110 ? UNP O28011 ? ? 'EXPRESSION TAG' 108 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 3CTV _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 3.58 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 65.61 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.temp 294 _exptl_crystal_grow.pdbx_details '2.5 M Ammonium sulfate, 0.1 M Tris buffer, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 294K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type SBC-3 _diffrn_detector.pdbx_collection_date 2007-10-30 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Double crystal' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97920 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-BM' _diffrn_source.pdbx_wavelength_list 0.97920 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-BM # _reflns.entry_id 3CTV _reflns.d_resolution_high 2.45 _reflns.d_resolution_low 32.1 _reflns.number_obs 6516 _reflns.pdbx_Rmerge_I_obs 0.077 _reflns.pdbx_netI_over_sigmaI 12.400 _reflns.pdbx_chi_squared 1.325 _reflns.pdbx_redundancy 14.600 _reflns.percent_possible_obs 99.900 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.number_all 6516 _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate 73 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.45 _reflns_shell.d_res_low 2.52 _reflns_shell.number_measured_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_unique_obs ? _reflns_shell.Rmerge_I_obs 0.852 _reflns_shell.meanI_over_sigI_obs 2.49 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared 0.936 _reflns_shell.pdbx_redundancy 10.40 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 541 _reflns_shell.percent_possible_all 100.00 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3CTV _refine.B_iso_mean 73.624 _refine.pdbx_method_to_determine_struct SAD _refine.ls_d_res_high 2.46 _refine.ls_d_res_low 32.1 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_ls_sigma_I 0 _refine.ls_number_reflns_all 6097 _refine.ls_number_reflns_obs 6097 _refine.ls_number_reflns_R_free 299 _refine.ls_percent_reflns_obs 98.11 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_work 0.1935 _refine.ls_R_factor_R_free 0.2475 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details Random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.details 'ANALYSIS OF THE DIFFRACTION DATA INDICATED HEMIHEDERAL TWINNING WITH A TWIN FRACTION OF 0.317 AND WITH A TWIN LAW OF K,H,-L.' _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 721 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 3 _refine_hist.number_atoms_total 729 _refine_hist.d_res_high 2.46 _refine_hist.d_res_low 32.1 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? f_angle_deg 1.308 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 3CTV _struct.title 'Crystal structure of central domain of 3-hydroxyacyl-CoA dehydrogenase from Archaeoglobus fulgidus' _struct.pdbx_descriptor '3-hydroxyacyl-CoA dehydrogenase' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3CTV _struct_keywords.text ;structural genomics, APC7539, 3-hydroxyacyl-CoA dehydrogenase, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Fatty acid metabolism, Lipid metabolism, Lyase, Multifunctional enzyme, NAD, Oxidoreductase ; _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 19 ? MSE A 37 ? ASN A 17 MSE A 35 1 ? 19 HELX_P HELX_P2 2 THR A 41 ? LEU A 53 ? THR A 39 LEU A 51 1 ? 13 HELX_P HELX_P3 3 GLY A 58 ? GLY A 67 ? GLY A 56 GLY A 65 1 ? 10 HELX_P HELX_P4 4 GLY A 67 ? GLY A 83 ? GLY A 65 GLY A 81 1 ? 17 HELX_P HELX_P5 5 LYS A 84 ? GLU A 88 ? LYS A 82 GLU A 86 5 ? 5 HELX_P HELX_P6 6 ALA A 90 ? GLU A 95 ? ALA A 88 GLU A 93 1 ? 6 HELX_P HELX_P7 7 LYS A 97 ? GLU A 108 ? LYS A 95 GLU A 106 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A PRO 20 C ? ? ? 1_555 A MSE 21 N ? ? A PRO 18 A MSE 19 1_555 ? ? ? ? ? ? ? 1.328 ? covale2 covale both ? A MSE 21 C ? ? ? 1_555 A ASP 22 N ? ? A MSE 19 A ASP 20 1_555 ? ? ? ? ? ? ? 1.323 ? covale3 covale both ? A GLU 36 C ? ? ? 1_555 A MSE 37 N ? ? A GLU 34 A MSE 35 1_555 ? ? ? ? ? ? ? 1.334 ? covale4 covale both ? A MSE 37 C ? ? ? 1_555 A GLY 38 N ? ? A MSE 35 A GLY 36 1_555 ? ? ? ? ? ? ? 1.332 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE SO4 A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ASN A 54 ? ASN A 52 . ? 23_566 ? 2 AC1 3 LYS A 84 ? LYS A 82 . ? 1_555 ? 3 AC1 3 LYS A 85 ? LYS A 83 . ? 1_555 ? # _atom_sites.entry_id 3CTV _atom_sites.fract_transf_matrix[1][1] 0.009856 _atom_sites.fract_transf_matrix[1][2] -0.000000 _atom_sites.fract_transf_matrix[1][3] -0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009856 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009856 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 HIS 2 0 ? ? ? A . n A 1 3 SER 3 1 ? ? ? A . n A 1 4 LYS 4 2 ? ? ? A . n A 1 5 GLY 5 3 ? ? ? A . n A 1 6 ARG 6 4 ? ? ? A . n A 1 7 PRO 7 5 ? ? ? A . n A 1 8 GLN 8 6 ? ? ? A . n A 1 9 ILE 9 7 ? ? ? A . n A 1 10 ASP 10 8 ? ? ? A . n A 1 11 SER 11 9 ? ? ? A . n A 1 12 SER 12 10 ? ? ? A . n A 1 13 LYS 13 11 ? ? ? A . n A 1 14 ALA 14 12 ? ? ? A . n A 1 15 THR 15 13 ? ? ? A . n A 1 16 ASP 16 14 ? ? ? A . n A 1 17 LYS 17 15 15 LYS LYS A . n A 1 18 ILE 18 16 16 ILE ILE A . n A 1 19 ASN 19 17 17 ASN ASN A . n A 1 20 PRO 20 18 18 PRO PRO A . n A 1 21 MSE 21 19 19 MSE MSE A . n A 1 22 ASP 22 20 20 ASP ASP A . n A 1 23 PHE 23 21 21 PHE PHE A . n A 1 24 THR 24 22 22 THR THR A . n A 1 25 PHE 25 23 23 PHE PHE A . n A 1 26 VAL 26 24 24 VAL VAL A . n A 1 27 GLU 27 25 25 GLU GLU A . n A 1 28 ILE 28 26 26 ILE ILE A . n A 1 29 ASN 29 27 27 ASN ASN A . n A 1 30 GLU 30 28 28 GLU GLU A . n A 1 31 ALA 31 29 29 ALA ALA A . n A 1 32 VAL 32 30 30 VAL VAL A . n A 1 33 LYS 33 31 31 LYS LYS A . n A 1 34 LEU 34 32 32 LEU LEU A . n A 1 35 VAL 35 33 33 VAL VAL A . n A 1 36 GLU 36 34 34 GLU GLU A . n A 1 37 MSE 37 35 35 MSE MSE A . n A 1 38 GLY 38 36 36 GLY GLY A . n A 1 39 VAL 39 37 37 VAL VAL A . n A 1 40 ALA 40 38 38 ALA ALA A . n A 1 41 THR 41 39 39 THR THR A . n A 1 42 PRO 42 40 40 PRO PRO A . n A 1 43 GLN 43 41 41 GLN GLN A . n A 1 44 ASP 44 42 42 ASP ASP A . n A 1 45 ILE 45 43 43 ILE ILE A . n A 1 46 ASP 46 44 44 ASP ASP A . n A 1 47 THR 47 45 45 THR THR A . n A 1 48 ALA 48 46 46 ALA ALA A . n A 1 49 ILE 49 47 47 ILE ILE A . n A 1 50 LYS 50 48 48 LYS LYS A . n A 1 51 LEU 51 49 49 LEU LEU A . n A 1 52 GLY 52 50 50 GLY GLY A . n A 1 53 LEU 53 51 51 LEU LEU A . n A 1 54 ASN 54 52 52 ASN ASN A . n A 1 55 ARG 55 53 53 ARG ARG A . n A 1 56 PRO 56 54 54 PRO PRO A . n A 1 57 PHE 57 55 55 PHE PHE A . n A 1 58 GLY 58 56 56 GLY GLY A . n A 1 59 PRO 59 57 57 PRO PRO A . n A 1 60 PHE 60 58 58 PHE PHE A . n A 1 61 GLU 61 59 59 GLU GLU A . n A 1 62 LEU 62 60 60 LEU LEU A . n A 1 63 ALA 63 61 61 ALA ALA A . n A 1 64 LYS 64 62 62 LYS LYS A . n A 1 65 GLN 65 63 63 GLN GLN A . n A 1 66 PHE 66 64 64 PHE PHE A . n A 1 67 GLY 67 65 65 GLY GLY A . n A 1 68 ALA 68 66 66 ALA ALA A . n A 1 69 GLU 69 67 67 GLU GLU A . n A 1 70 GLN 70 68 68 GLN GLN A . n A 1 71 ILE 71 69 69 ILE ILE A . n A 1 72 ALA 72 70 70 ALA ALA A . n A 1 73 LYS 73 71 71 LYS LYS A . n A 1 74 ARG 74 72 72 ARG ARG A . n A 1 75 LEU 75 73 73 LEU LEU A . n A 1 76 GLU 76 74 74 GLU GLU A . n A 1 77 GLU 77 75 75 GLU GLU A . n A 1 78 LEU 78 76 76 LEU LEU A . n A 1 79 ALA 79 77 77 ALA ALA A . n A 1 80 LYS 80 78 78 LYS LYS A . n A 1 81 GLN 81 79 79 GLN GLN A . n A 1 82 PHE 82 80 80 PHE PHE A . n A 1 83 GLY 83 81 81 GLY GLY A . n A 1 84 LYS 84 82 82 LYS LYS A . n A 1 85 LYS 85 83 83 LYS LYS A . n A 1 86 ILE 86 84 84 ILE ILE A . n A 1 87 PHE 87 85 85 PHE PHE A . n A 1 88 GLU 88 86 86 GLU GLU A . n A 1 89 PRO 89 87 87 PRO PRO A . n A 1 90 ALA 90 88 88 ALA ALA A . n A 1 91 LYS 91 89 89 LYS LYS A . n A 1 92 THR 92 90 90 THR THR A . n A 1 93 LEU 93 91 91 LEU LEU A . n A 1 94 LYS 94 92 92 LYS LYS A . n A 1 95 GLU 95 93 93 GLU GLU A . n A 1 96 GLY 96 94 94 GLY GLY A . n A 1 97 LYS 97 95 95 LYS LYS A . n A 1 98 LEU 98 96 96 LEU LEU A . n A 1 99 GLU 99 97 97 GLU GLU A . n A 1 100 GLU 100 98 98 GLU GLU A . n A 1 101 LEU 101 99 99 LEU LEU A . n A 1 102 LEU 102 100 100 LEU LEU A . n A 1 103 LYS 103 101 101 LYS LYS A . n A 1 104 ALA 104 102 102 ALA ALA A . n A 1 105 GLY 105 103 103 GLY GLY A . n A 1 106 LYS 106 104 104 LYS LYS A . n A 1 107 ALA 107 105 105 ALA ALA A . n A 1 108 GLU 108 106 106 GLU GLU A . n A 1 109 GLY 109 107 ? ? ? A . n A 1 110 SER 110 108 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 201 201 SO4 SO4 A . C 3 HOH 1 202 202 HOH HOH A . C 3 HOH 2 203 203 HOH HOH A . C 3 HOH 3 204 204 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 21 A MSE 19 ? MET SELENOMETHIONINE 2 A MSE 37 A MSE 35 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2030 ? 1 MORE -19.6 ? 1 'SSA (A^2)' 9730 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 15_656 -x+3/2,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 152.1960000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 101.4640000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-29 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-10-25 4 'Structure model' 1 3 2019-07-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' software 3 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_software.classification' 2 4 'Structure model' '_software.contact_author' 3 4 'Structure model' '_software.contact_author_email' 4 4 'Structure model' '_software.location' 5 4 'Structure model' '_software.name' 6 4 'Structure model' '_software.type' 7 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal PHENIX . ? ? ? ? refinement ? ? ? 1 SCALEPACK . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data scaling' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 2 REFMAC . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran_77 ? 3 PDB_EXTRACT 3.005 'September 10, 2007' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 4 SBC-Collect . ? ? ? ? 'data collection' ? ? ? 5 HKL-3000 . ? ? ? ? 'data reduction' ? ? ? 6 HKL-3000 . ? ? ? ? 'data scaling' ? ? ? 7 PHENIX . ? ? ? ? phasing ? ? ? 8 DENZO . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data reduction' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 9 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 92 ? ? -44.60 -8.98 2 1 LYS A 95 ? ? -71.59 26.00 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A HIS 0 ? A HIS 2 3 1 Y 1 A SER 1 ? A SER 3 4 1 Y 1 A LYS 2 ? A LYS 4 5 1 Y 1 A GLY 3 ? A GLY 5 6 1 Y 1 A ARG 4 ? A ARG 6 7 1 Y 1 A PRO 5 ? A PRO 7 8 1 Y 1 A GLN 6 ? A GLN 8 9 1 Y 1 A ILE 7 ? A ILE 9 10 1 Y 1 A ASP 8 ? A ASP 10 11 1 Y 1 A SER 9 ? A SER 11 12 1 Y 1 A SER 10 ? A SER 12 13 1 Y 1 A LYS 11 ? A LYS 13 14 1 Y 1 A ALA 12 ? A ALA 14 15 1 Y 1 A THR 13 ? A THR 15 16 1 Y 1 A ASP 14 ? A ASP 16 17 1 Y 1 A GLY 107 ? A GLY 109 18 1 Y 1 A SER 108 ? A SER 110 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH #