data_3CYO # _entry.id 3CYO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.377 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3CYO pdb_00003cyo 10.2210/pdb3cyo/pdb RCSB RCSB047374 ? ? WWPDB D_1000047374 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3CP1 _pdbx_database_related.details 'Structure of a longer thermalstable core domain of HIV-1 GP41 containing the enfuvirtide resistance mutation N43D' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3CYO _pdbx_database_status.recvd_initial_deposition_date 2008-04-25 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, Z.M.' 1 'Dwyer, J.J.' 2 # _citation.id primary _citation.title ;Impact of the enfuvirtide resistance mutation N43D and the associated baseline polymorphism E137K on peptide sensitivity and six-helix bundle structure. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 47 _citation.page_first 6662 _citation.page_last 6670 _citation.year 2008 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18507398 _citation.pdbx_database_id_DOI 10.1021/bi702509d # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bai, X.' 1 ? primary 'Wilson, K.L.' 2 ? primary 'Seedorff, J.E.' 3 ? primary 'Ahrens, D.' 4 ? primary 'Green, J.' 5 ? primary 'Davison, D.K.' 6 ? primary 'Jin, L.' 7 ? primary 'Stanfield-Oakley, S.A.' 8 ? primary 'Mosier, S.M.' 9 ? primary 'Melby, T.E.' 10 ? primary 'Cammack, N.' 11 ? primary 'Wang, Z.' 12 ? primary 'Greenberg, M.L.' 13 ? primary 'Dwyer, J.J.' 14 ? # _cell.entry_id 3CYO _cell.length_a 59.290 _cell.length_b 59.290 _cell.length_c 59.290 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3CYO _symmetry.space_group_name_H-M 'P 21 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 198 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transmembrane protein' 9975.190 1 ? N554D,E648K 'FUSION PROTEIN OF UNP RESIDUES 536-579, LINKER, AND UNP RESIDUES 628-663' ? 2 water nat water 18.015 27 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TM, GLYCOPROTEIN41, GP41' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TLTVQARQLLSGIVQQQNDLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEKSQNQQEKNE QELLEL ; _entity_poly.pdbx_seq_one_letter_code_can ;TLTVQARQLLSGIVQQQNDLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEKSQNQQEKNE QELLEL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 LEU n 1 3 THR n 1 4 VAL n 1 5 GLN n 1 6 ALA n 1 7 ARG n 1 8 GLN n 1 9 LEU n 1 10 LEU n 1 11 SER n 1 12 GLY n 1 13 ILE n 1 14 VAL n 1 15 GLN n 1 16 GLN n 1 17 GLN n 1 18 ASN n 1 19 ASP n 1 20 LEU n 1 21 LEU n 1 22 ARG n 1 23 ALA n 1 24 ILE n 1 25 GLU n 1 26 ALA n 1 27 GLN n 1 28 GLN n 1 29 HIS n 1 30 LEU n 1 31 LEU n 1 32 GLN n 1 33 LEU n 1 34 THR n 1 35 VAL n 1 36 TRP n 1 37 GLY n 1 38 ILE n 1 39 LYS n 1 40 GLN n 1 41 LEU n 1 42 GLN n 1 43 ALA n 1 44 ARG n 1 45 SER n 1 46 GLY n 1 47 GLY n 1 48 ARG n 1 49 GLY n 1 50 GLY n 1 51 TRP n 1 52 MET n 1 53 GLU n 1 54 TRP n 1 55 ASP n 1 56 ARG n 1 57 GLU n 1 58 ILE n 1 59 ASN n 1 60 ASN n 1 61 TYR n 1 62 THR n 1 63 SER n 1 64 LEU n 1 65 ILE n 1 66 HIS n 1 67 SER n 1 68 LEU n 1 69 ILE n 1 70 GLU n 1 71 LYS n 1 72 SER n 1 73 GLN n 1 74 ASN n 1 75 GLN n 1 76 GLN n 1 77 GLU n 1 78 LYS n 1 79 ASN n 1 80 GLU n 1 81 GLN n 1 82 GLU n 1 83 LEU n 1 84 LEU n 1 85 GLU n 1 86 LEU n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? 1 44 ? ? env ? ? ? ? ? ? 'Human immunodeficiency virus type 1' ? ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3)PLYSS' ? ? ? ? ? ? ? PLASMID ? ? ? PET41A ? ? 1 2 sample ? 51 86 ? ? env ? ? ? ? ? ? 'Human immunodeficiency virus type 1' ? ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3)PLYSS' ? ? ? ? ? ? ? PLASMID ? ? ? PET41A ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP ENV_HV1LW Q70626 1 TLTVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQAR 536 ? 2 UNP ENV_HV1LW Q70626 1 WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEL 628 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 3CYO A 1 ? 44 ? Q70626 536 ? 579 ? 1 44 2 2 3CYO A 51 ? 86 ? Q70626 628 ? 663 ? 51 86 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3CYO ASP A 19 ? UNP Q70626 ASN 554 'engineered mutation' 19 1 1 3CYO SER A 45 ? UNP Q70626 ? ? linker 45 2 1 3CYO GLY A 46 ? UNP Q70626 ? ? linker 46 3 1 3CYO GLY A 47 ? UNP Q70626 ? ? linker 47 4 1 3CYO ARG A 48 ? UNP Q70626 ? ? linker 48 5 1 3CYO GLY A 49 ? UNP Q70626 ? ? linker 49 6 1 3CYO GLY A 50 ? UNP Q70626 ? ? linker 50 7 2 3CYO LYS A 71 ? UNP Q70626 GLU 648 'engineered mutation' 71 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3CYO _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.74 _exptl_crystal.density_percent_sol 29.35 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.50 _exptl_crystal_grow.pdbx_details '25-40% ETHYLENE GLYCOL, 0.2 M MGCL2 AND 0.1 M HEPES PH 7.5, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 295K, pH 7.50' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV' _diffrn_detector.pdbx_collection_date 2007-11-01 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator GRAPHITE _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 3CYO _reflns.observed_criterion_sigma_I 0.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.1 _reflns.number_obs 4263 _reflns.number_all ? _reflns.percent_possible_obs 98.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.096 _reflns.pdbx_netI_over_sigmaI 9.3 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.18 _reflns_shell.percent_possible_all 88.3 _reflns_shell.Rmerge_I_obs 0.879 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3CYO _refine.ls_number_reflns_obs 3876 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50 _refine.ls_d_res_high 2.10 _refine.ls_percent_reflns_obs 91.8 _refine.ls_R_factor_obs 0.242 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.242 _refine.ls_R_factor_R_free 0.332 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 396 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] 0.00000 _refine.aniso_B[2][2] 0.00000 _refine.aniso_B[3][3] 0.00000 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1ENV' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ANISOTROPIC _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 605 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 27 _refine_hist.number_atoms_total 632 _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 50 # _struct.entry_id 3CYO _struct.title ;Structure of a longer thermalstable core domain of HIV-1 GP41 containing the enfuvirtide resistance mutation N43D and complementary mutation E137K ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3CYO _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text ;HIV-1 ENVELOPE GLYCOPROTEIN, 6-HELIX BUNDLE, GP41, N43D, E137K, AIDS, APOPTOSIS, COILED COIL, ENVELOPE PROTEIN, FUSION PROTEIN, HOST-VIRUS INTERACTION, MEMBRANE, TRANSMEMBRANE, VIRION, VIRAL PROTEIN, Cleavage on pair of basic residues, Lipoprotein, Palmitate, Viral immunoevasion ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 3 ? LEU A 41 ? THR A 3 LEU A 41 1 ? 39 HELX_P HELX_P2 2 GLU A 53 ? LEU A 84 ? GLU A 53 LEU A 84 1 ? 32 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 3CYO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3CYO _atom_sites.fract_transf_matrix[1][1] 0.016866 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016866 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016866 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 ? ? ? A . n A 1 2 LEU 2 2 ? ? ? A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLN 42 42 ? ? ? A . n A 1 43 ALA 43 43 ? ? ? A . n A 1 44 ARG 44 44 ? ? ? A . n A 1 45 SER 45 45 ? ? ? A . n A 1 46 GLY 46 46 ? ? ? A . n A 1 47 GLY 47 47 ? ? ? A . n A 1 48 ARG 48 48 ? ? ? A . n A 1 49 GLY 49 49 ? ? ? A . n A 1 50 GLY 50 50 ? ? ? A . n A 1 51 TRP 51 51 ? ? ? A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 LEU 86 86 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 101 101 HOH HOH A . B 2 HOH 2 102 102 HOH HOH A . B 2 HOH 3 103 103 HOH HOH A . B 2 HOH 4 104 104 HOH HOH A . B 2 HOH 5 105 105 HOH HOH A . B 2 HOH 6 106 106 HOH HOH A . B 2 HOH 7 107 107 HOH HOH A . B 2 HOH 8 108 108 HOH HOH A . B 2 HOH 9 109 109 HOH HOH A . B 2 HOH 10 110 110 HOH HOH A . B 2 HOH 11 111 111 HOH HOH A . B 2 HOH 12 112 112 HOH HOH A . B 2 HOH 13 113 113 HOH HOH A . B 2 HOH 14 114 114 HOH HOH A . B 2 HOH 15 115 115 HOH HOH A . B 2 HOH 16 116 116 HOH HOH A . B 2 HOH 17 117 117 HOH HOH A . B 2 HOH 18 118 118 HOH HOH A . B 2 HOH 19 119 119 HOH HOH A . B 2 HOH 20 120 120 HOH HOH A . B 2 HOH 21 121 121 HOH HOH A . B 2 HOH 22 122 122 HOH HOH A . B 2 HOH 23 123 123 HOH HOH A . B 2 HOH 24 124 124 HOH HOH A . B 2 HOH 25 125 125 HOH HOH A . B 2 HOH 26 126 126 HOH HOH A . B 2 HOH 27 127 127 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7410 ? 1 MORE -63.7 ? 1 'SSA (A^2)' 11280 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 101 ? B HOH . 2 1 A HOH 102 ? B HOH . 3 1 A HOH 103 ? B HOH . 4 1 A HOH 104 ? B HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-06-17 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-08-16 4 'Structure model' 1 3 2021-10-20 5 'Structure model' 1 4 2023-08-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' 3 3 'Structure model' 'Source and taxonomy' 4 4 'Structure model' 'Database references' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' entity_src_gen 2 3 'Structure model' software 3 4 'Structure model' database_2 4 4 'Structure model' struct_ref_seq_dif 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement . ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 CNS phasing . ? 4 # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag Y _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id THR _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 3 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id OG1 _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id A _pdbx_unobs_or_zero_occ_atoms.label_comp_id THR _pdbx_unobs_or_zero_occ_atoms.label_seq_id 3 _pdbx_unobs_or_zero_occ_atoms.label_atom_id OG1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 1 ? A THR 1 2 1 Y 1 A LEU 2 ? A LEU 2 3 1 Y 1 A GLN 42 ? A GLN 42 4 1 Y 1 A ALA 43 ? A ALA 43 5 1 Y 1 A ARG 44 ? A ARG 44 6 1 Y 1 A SER 45 ? A SER 45 7 1 Y 1 A GLY 46 ? A GLY 46 8 1 Y 1 A GLY 47 ? A GLY 47 9 1 Y 1 A ARG 48 ? A ARG 48 10 1 Y 1 A GLY 49 ? A GLY 49 11 1 Y 1 A GLY 50 ? A GLY 50 12 1 Y 1 A TRP 51 ? A TRP 51 13 1 Y 1 A LEU 86 ? A LEU 86 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 SER N N N N 236 SER CA C N S 237 SER C C N N 238 SER O O N N 239 SER CB C N N 240 SER OG O N N 241 SER OXT O N N 242 SER H H N N 243 SER H2 H N N 244 SER HA H N N 245 SER HB2 H N N 246 SER HB3 H N N 247 SER HG H N N 248 SER HXT H N N 249 THR N N N N 250 THR CA C N S 251 THR C C N N 252 THR O O N N 253 THR CB C N R 254 THR OG1 O N N 255 THR CG2 C N N 256 THR OXT O N N 257 THR H H N N 258 THR H2 H N N 259 THR HA H N N 260 THR HB H N N 261 THR HG1 H N N 262 THR HG21 H N N 263 THR HG22 H N N 264 THR HG23 H N N 265 THR HXT H N N 266 TRP N N N N 267 TRP CA C N S 268 TRP C C N N 269 TRP O O N N 270 TRP CB C N N 271 TRP CG C Y N 272 TRP CD1 C Y N 273 TRP CD2 C Y N 274 TRP NE1 N Y N 275 TRP CE2 C Y N 276 TRP CE3 C Y N 277 TRP CZ2 C Y N 278 TRP CZ3 C Y N 279 TRP CH2 C Y N 280 TRP OXT O N N 281 TRP H H N N 282 TRP H2 H N N 283 TRP HA H N N 284 TRP HB2 H N N 285 TRP HB3 H N N 286 TRP HD1 H N N 287 TRP HE1 H N N 288 TRP HE3 H N N 289 TRP HZ2 H N N 290 TRP HZ3 H N N 291 TRP HH2 H N N 292 TRP HXT H N N 293 TYR N N N N 294 TYR CA C N S 295 TYR C C N N 296 TYR O O N N 297 TYR CB C N N 298 TYR CG C Y N 299 TYR CD1 C Y N 300 TYR CD2 C Y N 301 TYR CE1 C Y N 302 TYR CE2 C Y N 303 TYR CZ C Y N 304 TYR OH O N N 305 TYR OXT O N N 306 TYR H H N N 307 TYR H2 H N N 308 TYR HA H N N 309 TYR HB2 H N N 310 TYR HB3 H N N 311 TYR HD1 H N N 312 TYR HD2 H N N 313 TYR HE1 H N N 314 TYR HE2 H N N 315 TYR HH H N N 316 TYR HXT H N N 317 VAL N N N N 318 VAL CA C N S 319 VAL C C N N 320 VAL O O N N 321 VAL CB C N N 322 VAL CG1 C N N 323 VAL CG2 C N N 324 VAL OXT O N N 325 VAL H H N N 326 VAL H2 H N N 327 VAL HA H N N 328 VAL HB H N N 329 VAL HG11 H N N 330 VAL HG12 H N N 331 VAL HG13 H N N 332 VAL HG21 H N N 333 VAL HG22 H N N 334 VAL HG23 H N N 335 VAL HXT H N N 336 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 SER N CA sing N N 224 SER N H sing N N 225 SER N H2 sing N N 226 SER CA C sing N N 227 SER CA CB sing N N 228 SER CA HA sing N N 229 SER C O doub N N 230 SER C OXT sing N N 231 SER CB OG sing N N 232 SER CB HB2 sing N N 233 SER CB HB3 sing N N 234 SER OG HG sing N N 235 SER OXT HXT sing N N 236 THR N CA sing N N 237 THR N H sing N N 238 THR N H2 sing N N 239 THR CA C sing N N 240 THR CA CB sing N N 241 THR CA HA sing N N 242 THR C O doub N N 243 THR C OXT sing N N 244 THR CB OG1 sing N N 245 THR CB CG2 sing N N 246 THR CB HB sing N N 247 THR OG1 HG1 sing N N 248 THR CG2 HG21 sing N N 249 THR CG2 HG22 sing N N 250 THR CG2 HG23 sing N N 251 THR OXT HXT sing N N 252 TRP N CA sing N N 253 TRP N H sing N N 254 TRP N H2 sing N N 255 TRP CA C sing N N 256 TRP CA CB sing N N 257 TRP CA HA sing N N 258 TRP C O doub N N 259 TRP C OXT sing N N 260 TRP CB CG sing N N 261 TRP CB HB2 sing N N 262 TRP CB HB3 sing N N 263 TRP CG CD1 doub Y N 264 TRP CG CD2 sing Y N 265 TRP CD1 NE1 sing Y N 266 TRP CD1 HD1 sing N N 267 TRP CD2 CE2 doub Y N 268 TRP CD2 CE3 sing Y N 269 TRP NE1 CE2 sing Y N 270 TRP NE1 HE1 sing N N 271 TRP CE2 CZ2 sing Y N 272 TRP CE3 CZ3 doub Y N 273 TRP CE3 HE3 sing N N 274 TRP CZ2 CH2 doub Y N 275 TRP CZ2 HZ2 sing N N 276 TRP CZ3 CH2 sing Y N 277 TRP CZ3 HZ3 sing N N 278 TRP CH2 HH2 sing N N 279 TRP OXT HXT sing N N 280 TYR N CA sing N N 281 TYR N H sing N N 282 TYR N H2 sing N N 283 TYR CA C sing N N 284 TYR CA CB sing N N 285 TYR CA HA sing N N 286 TYR C O doub N N 287 TYR C OXT sing N N 288 TYR CB CG sing N N 289 TYR CB HB2 sing N N 290 TYR CB HB3 sing N N 291 TYR CG CD1 doub Y N 292 TYR CG CD2 sing Y N 293 TYR CD1 CE1 sing Y N 294 TYR CD1 HD1 sing N N 295 TYR CD2 CE2 doub Y N 296 TYR CD2 HD2 sing N N 297 TYR CE1 CZ doub Y N 298 TYR CE1 HE1 sing N N 299 TYR CE2 CZ sing Y N 300 TYR CE2 HE2 sing N N 301 TYR CZ OH sing N N 302 TYR OH HH sing N N 303 TYR OXT HXT sing N N 304 VAL N CA sing N N 305 VAL N H sing N N 306 VAL N H2 sing N N 307 VAL CA C sing N N 308 VAL CA CB sing N N 309 VAL CA HA sing N N 310 VAL C O doub N N 311 VAL C OXT sing N N 312 VAL CB CG1 sing N N 313 VAL CB CG2 sing N N 314 VAL CB HB sing N N 315 VAL CG1 HG11 sing N N 316 VAL CG1 HG12 sing N N 317 VAL CG1 HG13 sing N N 318 VAL CG2 HG21 sing N N 319 VAL CG2 HG22 sing N N 320 VAL CG2 HG23 sing N N 321 VAL OXT HXT sing N N 322 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1ENV _pdbx_initial_refinement_model.details 'PDB ENTRY 1ENV' #