data_3DD4 # _entry.id 3DD4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3DD4 pdb_00003dd4 10.2210/pdb3dd4/pdb RCSB RCSB047888 ? ? WWPDB D_1000047888 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3DD4 _pdbx_database_status.recvd_initial_deposition_date 2008-06-05 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chai, J.' 1 'Wang, H.' 2 'Wang, K.' 3 # _citation.id primary _citation.title 'Structural Insights into KChIP4a Modulation of Kv4.3 Inactivation.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 284 _citation.page_first 4960 _citation.page_last 4967 _citation.year 2009 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19109250 _citation.pdbx_database_id_DOI 10.1074/jbc.M807704200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liang, P.' 1 ? primary 'Wang, H.' 2 ? primary 'Chen, H.' 3 ? primary 'Cui, Y.' 4 ? primary 'Gu, L.' 5 ? primary 'Chai, J.' 6 ? primary 'Wang, K.' 7 ? # _cell.entry_id 3DD4 _cell.length_a 96.300 _cell.length_b 96.300 _cell.length_c 71.100 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3DD4 _symmetry.space_group_name_H-M 'I 41' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 80 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Kv channel-interacting protein 4' 26529.326 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 3 water nat water 18.015 19 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'KChIP4, A-type potassium channel modulatory protein 4, Potassium channel-interacting protein 4, Calsenilin-like protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNLEGLEMIAVLIVIVLFVKLLEQFGLIEAGLEDSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSG VVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEM LDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI ; _entity_poly.pdbx_seq_one_letter_code_can ;MNLEGLEMIAVLIVIVLFVKLLEQFGLIEAGLEDSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSG VVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEM LDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 LEU n 1 4 GLU n 1 5 GLY n 1 6 LEU n 1 7 GLU n 1 8 MET n 1 9 ILE n 1 10 ALA n 1 11 VAL n 1 12 LEU n 1 13 ILE n 1 14 VAL n 1 15 ILE n 1 16 VAL n 1 17 LEU n 1 18 PHE n 1 19 VAL n 1 20 LYS n 1 21 LEU n 1 22 LEU n 1 23 GLU n 1 24 GLN n 1 25 PHE n 1 26 GLY n 1 27 LEU n 1 28 ILE n 1 29 GLU n 1 30 ALA n 1 31 GLY n 1 32 LEU n 1 33 GLU n 1 34 ASP n 1 35 SER n 1 36 VAL n 1 37 GLU n 1 38 ASP n 1 39 GLU n 1 40 LEU n 1 41 GLU n 1 42 MET n 1 43 ALA n 1 44 THR n 1 45 VAL n 1 46 ARG n 1 47 HIS n 1 48 ARG n 1 49 PRO n 1 50 GLU n 1 51 ALA n 1 52 LEU n 1 53 GLU n 1 54 LEU n 1 55 LEU n 1 56 GLU n 1 57 ALA n 1 58 GLN n 1 59 SER n 1 60 LYS n 1 61 PHE n 1 62 THR n 1 63 LYS n 1 64 LYS n 1 65 GLU n 1 66 LEU n 1 67 GLN n 1 68 ILE n 1 69 LEU n 1 70 TYR n 1 71 ARG n 1 72 GLY n 1 73 PHE n 1 74 LYS n 1 75 ASN n 1 76 GLU n 1 77 CYS n 1 78 PRO n 1 79 SER n 1 80 GLY n 1 81 VAL n 1 82 VAL n 1 83 ASN n 1 84 GLU n 1 85 GLU n 1 86 THR n 1 87 PHE n 1 88 LYS n 1 89 GLU n 1 90 ILE n 1 91 TYR n 1 92 SER n 1 93 GLN n 1 94 PHE n 1 95 PHE n 1 96 PRO n 1 97 GLN n 1 98 GLY n 1 99 ASP n 1 100 SER n 1 101 THR n 1 102 THR n 1 103 TYR n 1 104 ALA n 1 105 HIS n 1 106 PHE n 1 107 LEU n 1 108 PHE n 1 109 ASN n 1 110 ALA n 1 111 PHE n 1 112 ASP n 1 113 THR n 1 114 ASP n 1 115 HIS n 1 116 ASN n 1 117 GLY n 1 118 ALA n 1 119 VAL n 1 120 SER n 1 121 PHE n 1 122 GLU n 1 123 ASP n 1 124 PHE n 1 125 ILE n 1 126 LYS n 1 127 GLY n 1 128 LEU n 1 129 SER n 1 130 ILE n 1 131 LEU n 1 132 LEU n 1 133 ARG n 1 134 GLY n 1 135 THR n 1 136 VAL n 1 137 GLN n 1 138 GLU n 1 139 LYS n 1 140 LEU n 1 141 ASN n 1 142 TRP n 1 143 ALA n 1 144 PHE n 1 145 ASN n 1 146 LEU n 1 147 TYR n 1 148 ASP n 1 149 ILE n 1 150 ASN n 1 151 LYS n 1 152 ASP n 1 153 GLY n 1 154 TYR n 1 155 ILE n 1 156 THR n 1 157 LYS n 1 158 GLU n 1 159 GLU n 1 160 MET n 1 161 LEU n 1 162 ASP n 1 163 ILE n 1 164 MET n 1 165 LYS n 1 166 ALA n 1 167 ILE n 1 168 TYR n 1 169 ASP n 1 170 MET n 1 171 MET n 1 172 GLY n 1 173 LYS n 1 174 CYS n 1 175 THR n 1 176 TYR n 1 177 PRO n 1 178 VAL n 1 179 LEU n 1 180 LYS n 1 181 GLU n 1 182 ASP n 1 183 ALA n 1 184 PRO n 1 185 ARG n 1 186 GLN n 1 187 HIS n 1 188 VAL n 1 189 GLU n 1 190 THR n 1 191 PHE n 1 192 PHE n 1 193 GLN n 1 194 LYS n 1 195 MET n 1 196 ASP n 1 197 LYS n 1 198 ASN n 1 199 LYS n 1 200 ASP n 1 201 GLY n 1 202 VAL n 1 203 VAL n 1 204 THR n 1 205 ILE n 1 206 ASP n 1 207 GLU n 1 208 PHE n 1 209 ILE n 1 210 GLU n 1 211 SER n 1 212 CYS n 1 213 GLN n 1 214 LYS n 1 215 ASP n 1 216 GLU n 1 217 ASN n 1 218 ILE n 1 219 MET n 1 220 ARG n 1 221 SER n 1 222 MET n 1 223 GLN n 1 224 LEU n 1 225 PHE n 1 226 GLU n 1 227 ASN n 1 228 VAL n 1 229 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Kcnip4, Calp, Kchip4' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pet28b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KCIP4_MOUSE _struct_ref.pdbx_db_accession Q6PHZ8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNLEGLEMIAVLIVIVLFVKLLEQFGLIEAGLEDSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSG VVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEM LDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3DD4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 229 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6PHZ8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 229 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 229 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3DD4 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.11 _exptl_crystal.density_percent_sol 60.41 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pdbx_details '1.6-1.8M Ammonium Sulfate, 4%(v/v) iso-Propanol, 0.1M DTT, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV' _diffrn_detector.pdbx_collection_date 2006-08-25 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU MICROMAX-007' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 3DD4 _reflns.observed_criterion_sigma_F 2 _reflns.observed_criterion_sigma_I 1 _reflns.d_resolution_high 3.0 _reflns.d_resolution_low 99 _reflns.number_all 6677 _reflns.number_obs 6650 _reflns.percent_possible_obs 99.6 _reflns.pdbx_Rmerge_I_obs 0.058 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 37.9 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 8 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 3.0 _reflns_shell.d_res_low 3.11 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.567 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 4.1 _reflns_shell.pdbx_redundancy 8.0 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 668 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3DD4 _refine.ls_d_res_high 3.00 _refine.ls_d_res_low 20 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_ls_sigma_I 0 _refine.ls_number_reflns_all 6567 _refine.ls_number_reflns_obs 6545 _refine.ls_number_reflns_R_free 6183 _refine.ls_percent_reflns_obs 94.2 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2392 _refine.ls_R_factor_R_work 0.2392 _refine.ls_R_factor_R_free 0.2988 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'KChIP1 (PDB code: 2NZ0)' _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model 'MAXIMUM LIKELIHOOD' _refine.B_iso_mean 52.9479 _refine.aniso_B[1][1] 16.874 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] 16.874 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] -33.748 _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1748 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 19 _refine_hist.number_atoms_total 1769 _refine_hist.d_res_high 3.00 _refine_hist.d_res_low 20 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.210 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.d_res_high 3.00 _refine_ls_shell.d_res_low 3.14 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.R_factor_R_work 0.406 _refine_ls_shell.percent_reflns_obs 100 _refine_ls_shell.R_factor_R_free 0.466 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 52 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 747 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3DD4 _struct.title 'Structural Basis of KChIP4a Modulation of Kv4.3 Slow Inactivation' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3DD4 _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' _struct_keywords.text ;EF-hands protein, Ion transport, Ionic channel, Membrane, Potassium, Potassium channel, Potassium transport, Transport, Voltage-gated channel, TRANSPORT PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 MET A 1 ? PHE A 25 ? MET A 1 PHE A 25 1 ? 25 HELX_P HELX_P2 2 SER A 35 ? GLU A 41 ? SER A 35 GLU A 41 1 ? 7 HELX_P HELX_P3 3 HIS A 47 ? ASN A 75 ? HIS A 47 ASN A 75 1 ? 29 HELX_P HELX_P4 4 ASN A 83 ? PHE A 95 ? ASN A 83 PHE A 95 1 ? 13 HELX_P HELX_P5 5 ASP A 99 ? ALA A 110 ? ASP A 99 ALA A 110 1 ? 12 HELX_P HELX_P6 6 SER A 120 ? GLY A 134 ? SER A 120 GLY A 134 1 ? 15 HELX_P HELX_P7 7 THR A 135 ? ASP A 148 ? THR A 135 ASP A 148 1 ? 14 HELX_P HELX_P8 8 THR A 156 ? MET A 171 ? THR A 156 MET A 171 1 ? 16 HELX_P HELX_P9 9 GLN A 186 ? ASP A 196 ? GLN A 186 ASP A 196 1 ? 11 HELX_P HELX_P10 10 THR A 204 ? LYS A 214 ? THR A 204 LYS A 214 1 ? 11 HELX_P HELX_P11 11 ASP A 215 ? GLU A 226 ? ASP A 215 GLU A 226 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 148 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 148 A CA 405 1_555 ? ? ? ? ? ? ? 2.558 ? ? metalc2 metalc ? ? A ASN 150 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 150 A CA 405 1_555 ? ? ? ? ? ? ? 2.323 ? ? metalc3 metalc ? ? A ASP 152 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 152 A CA 405 1_555 ? ? ? ? ? ? ? 2.895 ? ? metalc4 metalc ? ? A TYR 154 O ? ? ? 1_555 C CA . CA ? ? A TYR 154 A CA 405 1_555 ? ? ? ? ? ? ? 2.175 ? ? metalc5 metalc ? ? A GLU 159 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 159 A CA 405 1_555 ? ? ? ? ? ? ? 2.775 ? ? metalc6 metalc ? ? A GLU 159 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 159 A CA 405 1_555 ? ? ? ? ? ? ? 2.337 ? ? metalc7 metalc ? ? A ASP 196 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 196 A CA 404 1_555 ? ? ? ? ? ? ? 2.915 ? ? metalc8 metalc ? ? A ASN 198 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 198 A CA 404 1_555 ? ? ? ? ? ? ? 2.695 ? ? metalc9 metalc ? ? A ASN 198 ND2 ? ? ? 1_555 B CA . CA ? ? A ASN 198 A CA 404 1_555 ? ? ? ? ? ? ? 2.036 ? ? metalc10 metalc ? ? A ASP 200 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 200 A CA 404 1_555 ? ? ? ? ? ? ? 2.949 ? ? metalc11 metalc ? ? A ASP 200 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 200 A CA 404 1_555 ? ? ? ? ? ? ? 3.159 ? ? metalc12 metalc ? ? A VAL 202 O ? ? ? 1_555 B CA . CA ? ? A VAL 202 A CA 404 1_555 ? ? ? ? ? ? ? 2.187 ? ? metalc13 metalc ? ? A GLU 207 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 207 A CA 404 1_555 ? ? ? ? ? ? ? 2.356 ? ? metalc14 metalc ? ? A GLU 207 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 207 A CA 404 1_555 ? ? ? ? ? ? ? 3.161 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 404 ? 4 'BINDING SITE FOR RESIDUE CA A 404' AC2 Software A CA 405 ? 5 'BINDING SITE FOR RESIDUE CA A 405' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ASP A 196 ? ASP A 196 . ? 1_555 ? 2 AC1 4 ASN A 198 ? ASN A 198 . ? 1_555 ? 3 AC1 4 ASP A 200 ? ASP A 200 . ? 1_555 ? 4 AC1 4 GLU A 207 ? GLU A 207 . ? 1_555 ? 5 AC2 5 ASP A 148 ? ASP A 148 . ? 1_555 ? 6 AC2 5 ASN A 150 ? ASN A 150 . ? 1_555 ? 7 AC2 5 ASP A 152 ? ASP A 152 . ? 1_555 ? 8 AC2 5 TYR A 154 ? TYR A 154 . ? 1_555 ? 9 AC2 5 GLU A 159 ? GLU A 159 . ? 1_555 ? # _database_PDB_matrix.entry_id 3DD4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3DD4 _atom_sites.fract_transf_matrix[1][1] 0.010384 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010384 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014065 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 GLU 29 29 ? ? ? A . n A 1 30 ALA 30 30 ? ? ? A . n A 1 31 GLY 31 31 ? ? ? A . n A 1 32 LEU 32 32 ? ? ? A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 PHE 124 124 124 PHE PHE A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 TRP 142 142 142 TRP TRP A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 ASN 145 145 145 ASN ASN A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 TYR 147 147 147 TYR TYR A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 ASN 150 150 150 ASN ASN A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 TYR 154 154 154 TYR TYR A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 MET 160 160 160 MET MET A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 MET 164 164 164 MET MET A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 ILE 167 167 167 ILE ILE A . n A 1 168 TYR 168 168 168 TYR TYR A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 MET 170 170 170 MET MET A . n A 1 171 MET 171 171 171 MET MET A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 LYS 173 173 ? ? ? A . n A 1 174 CYS 174 174 ? ? ? A . n A 1 175 THR 175 175 ? ? ? A . n A 1 176 TYR 176 176 ? ? ? A . n A 1 177 PRO 177 177 ? ? ? A . n A 1 178 VAL 178 178 ? ? ? A . n A 1 179 LEU 179 179 ? ? ? A . n A 1 180 LYS 180 180 ? ? ? A . n A 1 181 GLU 181 181 ? ? ? A . n A 1 182 ASP 182 182 ? ? ? A . n A 1 183 ALA 183 183 ? ? ? A . n A 1 184 PRO 184 184 184 PRO PRO A . n A 1 185 ARG 185 185 185 ARG ARG A . n A 1 186 GLN 186 186 186 GLN GLN A . n A 1 187 HIS 187 187 187 HIS HIS A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 THR 190 190 190 THR THR A . n A 1 191 PHE 191 191 191 PHE PHE A . n A 1 192 PHE 192 192 192 PHE PHE A . n A 1 193 GLN 193 193 193 GLN GLN A . n A 1 194 LYS 194 194 194 LYS LYS A . n A 1 195 MET 195 195 195 MET MET A . n A 1 196 ASP 196 196 196 ASP ASP A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 ASN 198 198 198 ASN ASN A . n A 1 199 LYS 199 199 199 LYS LYS A . n A 1 200 ASP 200 200 200 ASP ASP A . n A 1 201 GLY 201 201 201 GLY GLY A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 THR 204 204 204 THR THR A . n A 1 205 ILE 205 205 205 ILE ILE A . n A 1 206 ASP 206 206 206 ASP ASP A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 PHE 208 208 208 PHE PHE A . n A 1 209 ILE 209 209 209 ILE ILE A . n A 1 210 GLU 210 210 210 GLU GLU A . n A 1 211 SER 211 211 211 SER SER A . n A 1 212 CYS 212 212 212 CYS CYS A . n A 1 213 GLN 213 213 213 GLN GLN A . n A 1 214 LYS 214 214 214 LYS LYS A . n A 1 215 ASP 215 215 215 ASP ASP A . n A 1 216 GLU 216 216 216 GLU GLU A . n A 1 217 ASN 217 217 217 ASN ASN A . n A 1 218 ILE 218 218 218 ILE ILE A . n A 1 219 MET 219 219 219 MET MET A . n A 1 220 ARG 220 220 220 ARG ARG A . n A 1 221 SER 221 221 221 SER SER A . n A 1 222 MET 222 222 222 MET MET A . n A 1 223 GLN 223 223 223 GLN GLN A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 PHE 225 225 225 PHE PHE A . n A 1 226 GLU 226 226 226 GLU GLU A . n A 1 227 ASN 227 227 227 ASN ASN A . n A 1 228 VAL 228 228 228 VAL VAL A . n A 1 229 ILE 229 229 229 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 404 404 CA CA2 A . C 2 CA 1 405 405 CA CA2 A . D 3 HOH 1 406 1 HOH TIP A . D 3 HOH 2 407 2 HOH TIP A . D 3 HOH 3 408 3 HOH TIP A . D 3 HOH 4 409 4 HOH TIP A . D 3 HOH 5 410 5 HOH TIP A . D 3 HOH 6 411 6 HOH TIP A . D 3 HOH 7 412 7 HOH TIP A . D 3 HOH 8 413 8 HOH TIP A . D 3 HOH 9 414 9 HOH TIP A . D 3 HOH 10 415 10 HOH TIP A . D 3 HOH 11 416 11 HOH TIP A . D 3 HOH 12 417 12 HOH TIP A . D 3 HOH 13 418 13 HOH TIP A . D 3 HOH 14 419 14 HOH TIP A . D 3 HOH 15 420 15 HOH TIP A . D 3 HOH 16 421 16 HOH TIP A . D 3 HOH 17 422 17 HOH TIP A . D 3 HOH 18 423 18 HOH TIP A . D 3 HOH 19 424 19 HOH TIP A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D 2 1,2 A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 4310 ? 2 MORE -90 ? 2 'SSA (A^2)' 18330 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 148 ? A ASP 148 ? 1_555 CA ? C CA . ? A CA 405 ? 1_555 OD1 ? A ASN 150 ? A ASN 150 ? 1_555 78.9 ? 2 OD1 ? A ASP 148 ? A ASP 148 ? 1_555 CA ? C CA . ? A CA 405 ? 1_555 OD1 ? A ASP 152 ? A ASP 152 ? 1_555 68.5 ? 3 OD1 ? A ASN 150 ? A ASN 150 ? 1_555 CA ? C CA . ? A CA 405 ? 1_555 OD1 ? A ASP 152 ? A ASP 152 ? 1_555 83.7 ? 4 OD1 ? A ASP 148 ? A ASP 148 ? 1_555 CA ? C CA . ? A CA 405 ? 1_555 O ? A TYR 154 ? A TYR 154 ? 1_555 65.9 ? 5 OD1 ? A ASN 150 ? A ASN 150 ? 1_555 CA ? C CA . ? A CA 405 ? 1_555 O ? A TYR 154 ? A TYR 154 ? 1_555 144.6 ? 6 OD1 ? A ASP 152 ? A ASP 152 ? 1_555 CA ? C CA . ? A CA 405 ? 1_555 O ? A TYR 154 ? A TYR 154 ? 1_555 80.1 ? 7 OD1 ? A ASP 148 ? A ASP 148 ? 1_555 CA ? C CA . ? A CA 405 ? 1_555 OE1 ? A GLU 159 ? A GLU 159 ? 1_555 124.9 ? 8 OD1 ? A ASN 150 ? A ASN 150 ? 1_555 CA ? C CA . ? A CA 405 ? 1_555 OE1 ? A GLU 159 ? A GLU 159 ? 1_555 56.9 ? 9 OD1 ? A ASP 152 ? A ASP 152 ? 1_555 CA ? C CA . ? A CA 405 ? 1_555 OE1 ? A GLU 159 ? A GLU 159 ? 1_555 128.6 ? 10 O ? A TYR 154 ? A TYR 154 ? 1_555 CA ? C CA . ? A CA 405 ? 1_555 OE1 ? A GLU 159 ? A GLU 159 ? 1_555 150.8 ? 11 OD1 ? A ASP 148 ? A ASP 148 ? 1_555 CA ? C CA . ? A CA 405 ? 1_555 OE2 ? A GLU 159 ? A GLU 159 ? 1_555 132.2 ? 12 OD1 ? A ASN 150 ? A ASN 150 ? 1_555 CA ? C CA . ? A CA 405 ? 1_555 OE2 ? A GLU 159 ? A GLU 159 ? 1_555 104.8 ? 13 OD1 ? A ASP 152 ? A ASP 152 ? 1_555 CA ? C CA . ? A CA 405 ? 1_555 OE2 ? A GLU 159 ? A GLU 159 ? 1_555 158.4 ? 14 O ? A TYR 154 ? A TYR 154 ? 1_555 CA ? C CA . ? A CA 405 ? 1_555 OE2 ? A GLU 159 ? A GLU 159 ? 1_555 101.7 ? 15 OE1 ? A GLU 159 ? A GLU 159 ? 1_555 CA ? C CA . ? A CA 405 ? 1_555 OE2 ? A GLU 159 ? A GLU 159 ? 1_555 49.8 ? 16 OD1 ? A ASP 196 ? A ASP 196 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OD1 ? A ASN 198 ? A ASN 198 ? 1_555 119.9 ? 17 OD1 ? A ASP 196 ? A ASP 196 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 ND2 ? A ASN 198 ? A ASN 198 ? 1_555 65.6 ? 18 OD1 ? A ASN 198 ? A ASN 198 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 ND2 ? A ASN 198 ? A ASN 198 ? 1_555 54.5 ? 19 OD1 ? A ASP 196 ? A ASP 196 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OD2 ? A ASP 200 ? A ASP 200 ? 1_555 98.5 ? 20 OD1 ? A ASN 198 ? A ASN 198 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OD2 ? A ASP 200 ? A ASP 200 ? 1_555 58.4 ? 21 ND2 ? A ASN 198 ? A ASN 198 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OD2 ? A ASP 200 ? A ASP 200 ? 1_555 61.4 ? 22 OD1 ? A ASP 196 ? A ASP 196 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OD1 ? A ASP 200 ? A ASP 200 ? 1_555 77.2 ? 23 OD1 ? A ASN 198 ? A ASN 198 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OD1 ? A ASP 200 ? A ASP 200 ? 1_555 100.4 ? 24 ND2 ? A ASN 198 ? A ASN 198 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OD1 ? A ASP 200 ? A ASP 200 ? 1_555 84.4 ? 25 OD2 ? A ASP 200 ? A ASP 200 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OD1 ? A ASP 200 ? A ASP 200 ? 1_555 42.0 ? 26 OD1 ? A ASP 196 ? A ASP 196 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 O ? A VAL 202 ? A VAL 202 ? 1_555 84.6 ? 27 OD1 ? A ASN 198 ? A ASN 198 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 O ? A VAL 202 ? A VAL 202 ? 1_555 150.0 ? 28 ND2 ? A ASN 198 ? A ASN 198 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 O ? A VAL 202 ? A VAL 202 ? 1_555 142.4 ? 29 OD2 ? A ASP 200 ? A ASP 200 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 O ? A VAL 202 ? A VAL 202 ? 1_555 103.9 ? 30 OD1 ? A ASP 200 ? A ASP 200 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 O ? A VAL 202 ? A VAL 202 ? 1_555 66.3 ? 31 OD1 ? A ASP 196 ? A ASP 196 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OE1 ? A GLU 207 ? A GLU 207 ? 1_555 116.6 ? 32 OD1 ? A ASN 198 ? A ASN 198 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OE1 ? A GLU 207 ? A GLU 207 ? 1_555 91.3 ? 33 ND2 ? A ASN 198 ? A ASN 198 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OE1 ? A GLU 207 ? A GLU 207 ? 1_555 120.7 ? 34 OD2 ? A ASP 200 ? A ASP 200 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OE1 ? A GLU 207 ? A GLU 207 ? 1_555 142.6 ? 35 OD1 ? A ASP 200 ? A ASP 200 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OE1 ? A GLU 207 ? A GLU 207 ? 1_555 154.3 ? 36 O ? A VAL 202 ? A VAL 202 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OE1 ? A GLU 207 ? A GLU 207 ? 1_555 92.4 ? 37 OD1 ? A ASP 196 ? A ASP 196 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OE2 ? A GLU 207 ? A GLU 207 ? 1_555 87.2 ? 38 OD1 ? A ASN 198 ? A ASN 198 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OE2 ? A GLU 207 ? A GLU 207 ? 1_555 77.9 ? 39 ND2 ? A ASN 198 ? A ASN 198 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OE2 ? A GLU 207 ? A GLU 207 ? 1_555 79.3 ? 40 OD2 ? A ASP 200 ? A ASP 200 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OE2 ? A GLU 207 ? A GLU 207 ? 1_555 132.6 ? 41 OD1 ? A ASP 200 ? A ASP 200 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OE2 ? A GLU 207 ? A GLU 207 ? 1_555 161.1 ? 42 O ? A VAL 202 ? A VAL 202 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OE2 ? A GLU 207 ? A GLU 207 ? 1_555 123.5 ? 43 OE1 ? A GLU 207 ? A GLU 207 ? 1_555 CA ? B CA . ? A CA 404 ? 1_555 OE2 ? A GLU 207 ? A GLU 207 ? 1_555 44.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-12-23 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2023-11-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Derived calculations' 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_initial_refinement_model 5 3 'Structure model' pdbx_struct_conn_angle 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.value' 14 3 'Structure model' '_struct_conn.pdbx_dist_value' 15 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 16 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 17 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 18 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 19 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 20 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 21 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 22 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CrystalClear 'data collection' . ? 1 AMoRE phasing . ? 2 CNS refinement 1.1 ? 3 DENZO 'data reduction' . ? 4 SCALEPACK 'data scaling' . ? 5 # _pdbx_entry_details.sequence_details ;THE CORRECT UNP ACCESSION CODE IS Q6PHZ8-4, IT IS ISOFORM 4. ; _pdbx_entry_details.entry_id 3DD4 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 CG2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 THR _pdbx_validate_symm_contact.auth_seq_id_1 44 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 CG2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 THR _pdbx_validate_symm_contact.auth_seq_id_2 44 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 6_555 _pdbx_validate_symm_contact.dist 1.69 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 14 ? ? -36.38 -35.49 2 1 ALA A 43 ? ? -72.09 -167.98 3 1 THR A 44 ? ? -123.79 -121.78 4 1 VAL A 45 ? ? -87.54 -104.61 5 1 ARG A 46 ? ? -65.86 25.68 6 1 LYS A 74 ? ? -55.40 -102.55 7 1 ASN A 75 ? ? -69.44 67.49 8 1 GLU A 76 ? ? -170.52 -17.57 9 1 CYS A 77 ? ? 169.95 61.88 10 1 SER A 79 ? ? -66.32 -107.56 11 1 VAL A 81 ? ? 161.60 12.69 12 1 PHE A 95 ? ? -118.39 70.08 13 1 PRO A 96 ? ? -66.26 -97.83 14 1 GLN A 97 ? ? 64.15 -140.29 15 1 ASP A 99 ? ? 48.07 14.75 16 1 SER A 100 ? ? -37.69 -29.67 17 1 ASN A 116 ? ? -50.86 -8.50 18 1 ALA A 118 ? ? -118.02 -135.05 19 1 ARG A 133 ? ? -157.94 -2.27 20 1 ILE A 149 ? ? -33.91 -73.27 21 1 LYS A 157 ? ? -41.38 -18.96 22 1 MET A 171 ? ? -66.61 -113.49 23 1 ARG A 185 ? ? -170.32 -38.77 24 1 ASN A 198 ? ? -59.50 9.72 25 1 LYS A 199 ? ? 33.43 70.82 26 1 GLU A 226 ? ? -103.97 64.70 27 1 ASN A 227 ? ? -151.88 -16.83 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 29 ? A GLU 29 2 1 Y 1 A ALA 30 ? A ALA 30 3 1 Y 1 A GLY 31 ? A GLY 31 4 1 Y 1 A LEU 32 ? A LEU 32 5 1 Y 1 A LYS 173 ? A LYS 173 6 1 Y 1 A CYS 174 ? A CYS 174 7 1 Y 1 A THR 175 ? A THR 175 8 1 Y 1 A TYR 176 ? A TYR 176 9 1 Y 1 A PRO 177 ? A PRO 177 10 1 Y 1 A VAL 178 ? A VAL 178 11 1 Y 1 A LEU 179 ? A LEU 179 12 1 Y 1 A LYS 180 ? A LYS 180 13 1 Y 1 A GLU 181 ? A GLU 181 14 1 Y 1 A ASP 182 ? A ASP 182 15 1 Y 1 A ALA 183 ? A ALA 183 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2NZ0 _pdbx_initial_refinement_model.details 'KChIP1 (PDB code: 2NZ0)' #