data_3E8S # _entry.id 3E8S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.365 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3E8S pdb_00003e8s 10.2210/pdb3e8s/pdb RCSB RCSB049018 ? ? WWPDB D_1000049018 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id 381657 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.SG_entry Y _pdbx_database_status.entry_id 3E8S _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-08-20 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Joint Center for Structural Genomics (JCSG)' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title ;Crystal structure of Putative SAM Dependent Methyltransferase in Complex with SAH (NP_744700.1) from PSEUDOMONAS PUTIDA KT2440 at 2.10 A resolution ; _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # _citation_author.citation_id primary _citation_author.name 'Joint Center for Structural Genomics (JCSG)' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # _cell.entry_id 3E8S _cell.length_a 130.433 _cell.length_b 130.433 _cell.length_c 54.431 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3E8S _symmetry.space_group_name_H-M 'P 64' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 172 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative SAM Dependent Methyltransferase' 25237.656 1 ? ? ? ? 2 non-polymer syn S-ADENOSYL-L-HOMOCYSTEINE 384.411 1 ? ? ? ? 3 water nat water 18.015 219 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;G(MSE)EPI(MSE)RNPEDALLDSWHQNAQAWIDAVRHGAIESRRQVTDQAILLAILGRQPERVLDLGCGEGWLLRALAD RGIEAVGVDGDRTLVDAARAAGAGEVHLASYAQLAEAKVPVGKDYDLICANFALLHQDIIELLSA(MSE)RTLLVPGGAL VIQTLHPWSVADGDYQDGWREESFAGFAGDWQP(MSE)PWYFRTLASWLNALD(MSE)AGLRLVSLQEPQHPQSAVPQSL L(MSE)VAERH ; _entity_poly.pdbx_seq_one_letter_code_can ;GMEPIMRNPEDALLDSWHQNAQAWIDAVRHGAIESRRQVTDQAILLAILGRQPERVLDLGCGEGWLLRALADRGIEAVGV DGDRTLVDAARAAGAGEVHLASYAQLAEAKVPVGKDYDLICANFALLHQDIIELLSAMRTLLVPGGALVIQTLHPWSVAD GDYQDGWREESFAGFAGDWQPMPWYFRTLASWLNALDMAGLRLVSLQEPQHPQSAVPQSLLMVAERH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier 381657 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MSE n 1 3 GLU n 1 4 PRO n 1 5 ILE n 1 6 MSE n 1 7 ARG n 1 8 ASN n 1 9 PRO n 1 10 GLU n 1 11 ASP n 1 12 ALA n 1 13 LEU n 1 14 LEU n 1 15 ASP n 1 16 SER n 1 17 TRP n 1 18 HIS n 1 19 GLN n 1 20 ASN n 1 21 ALA n 1 22 GLN n 1 23 ALA n 1 24 TRP n 1 25 ILE n 1 26 ASP n 1 27 ALA n 1 28 VAL n 1 29 ARG n 1 30 HIS n 1 31 GLY n 1 32 ALA n 1 33 ILE n 1 34 GLU n 1 35 SER n 1 36 ARG n 1 37 ARG n 1 38 GLN n 1 39 VAL n 1 40 THR n 1 41 ASP n 1 42 GLN n 1 43 ALA n 1 44 ILE n 1 45 LEU n 1 46 LEU n 1 47 ALA n 1 48 ILE n 1 49 LEU n 1 50 GLY n 1 51 ARG n 1 52 GLN n 1 53 PRO n 1 54 GLU n 1 55 ARG n 1 56 VAL n 1 57 LEU n 1 58 ASP n 1 59 LEU n 1 60 GLY n 1 61 CYS n 1 62 GLY n 1 63 GLU n 1 64 GLY n 1 65 TRP n 1 66 LEU n 1 67 LEU n 1 68 ARG n 1 69 ALA n 1 70 LEU n 1 71 ALA n 1 72 ASP n 1 73 ARG n 1 74 GLY n 1 75 ILE n 1 76 GLU n 1 77 ALA n 1 78 VAL n 1 79 GLY n 1 80 VAL n 1 81 ASP n 1 82 GLY n 1 83 ASP n 1 84 ARG n 1 85 THR n 1 86 LEU n 1 87 VAL n 1 88 ASP n 1 89 ALA n 1 90 ALA n 1 91 ARG n 1 92 ALA n 1 93 ALA n 1 94 GLY n 1 95 ALA n 1 96 GLY n 1 97 GLU n 1 98 VAL n 1 99 HIS n 1 100 LEU n 1 101 ALA n 1 102 SER n 1 103 TYR n 1 104 ALA n 1 105 GLN n 1 106 LEU n 1 107 ALA n 1 108 GLU n 1 109 ALA n 1 110 LYS n 1 111 VAL n 1 112 PRO n 1 113 VAL n 1 114 GLY n 1 115 LYS n 1 116 ASP n 1 117 TYR n 1 118 ASP n 1 119 LEU n 1 120 ILE n 1 121 CYS n 1 122 ALA n 1 123 ASN n 1 124 PHE n 1 125 ALA n 1 126 LEU n 1 127 LEU n 1 128 HIS n 1 129 GLN n 1 130 ASP n 1 131 ILE n 1 132 ILE n 1 133 GLU n 1 134 LEU n 1 135 LEU n 1 136 SER n 1 137 ALA n 1 138 MSE n 1 139 ARG n 1 140 THR n 1 141 LEU n 1 142 LEU n 1 143 VAL n 1 144 PRO n 1 145 GLY n 1 146 GLY n 1 147 ALA n 1 148 LEU n 1 149 VAL n 1 150 ILE n 1 151 GLN n 1 152 THR n 1 153 LEU n 1 154 HIS n 1 155 PRO n 1 156 TRP n 1 157 SER n 1 158 VAL n 1 159 ALA n 1 160 ASP n 1 161 GLY n 1 162 ASP n 1 163 TYR n 1 164 GLN n 1 165 ASP n 1 166 GLY n 1 167 TRP n 1 168 ARG n 1 169 GLU n 1 170 GLU n 1 171 SER n 1 172 PHE n 1 173 ALA n 1 174 GLY n 1 175 PHE n 1 176 ALA n 1 177 GLY n 1 178 ASP n 1 179 TRP n 1 180 GLN n 1 181 PRO n 1 182 MSE n 1 183 PRO n 1 184 TRP n 1 185 TYR n 1 186 PHE n 1 187 ARG n 1 188 THR n 1 189 LEU n 1 190 ALA n 1 191 SER n 1 192 TRP n 1 193 LEU n 1 194 ASN n 1 195 ALA n 1 196 LEU n 1 197 ASP n 1 198 MSE n 1 199 ALA n 1 200 GLY n 1 201 LEU n 1 202 ARG n 1 203 LEU n 1 204 VAL n 1 205 SER n 1 206 LEU n 1 207 GLN n 1 208 GLU n 1 209 PRO n 1 210 GLN n 1 211 HIS n 1 212 PRO n 1 213 GLN n 1 214 SER n 1 215 ALA n 1 216 VAL n 1 217 PRO n 1 218 GLN n 1 219 SER n 1 220 LEU n 1 221 LEU n 1 222 MSE n 1 223 VAL n 1 224 ALA n 1 225 GLU n 1 226 ARG n 1 227 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'NP_744700.1, PP2555, PP_2555' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas putida KT2440' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 160488 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia Coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain HK100 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name SpeedET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q88JU2_PSEPK _struct_ref.pdbx_db_accession Q88JU2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEPIMRNPEDALLDSWHQNAQAWIDAVRHGAIESRRQVTDQAILLAILGRQPERVLDLGCGEGWLLRALADRGIEAVGVD GDRTLVDAARAAGAGEVHLASYAQLAEAKVPVGKDYDLICANFALLHQDIIELLSAMRTLLVPGGALVIQTLHPWSVADG DYQDGWREESFAGFAGDWQPMPWYFRTLASWLNALDMAGLRLVSLQEPQHPQSAVPQSLLMVAERH ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3E8S _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 227 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q88JU2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 226 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 226 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 3E8S _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q88JU2 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SAH 'L-peptide linking' n S-ADENOSYL-L-HOMOCYSTEINE ? 'C14 H20 N6 O5 S' 384.411 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.method 'X-RAY DIFFRACTION' _exptl.entry_id 3E8S # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 5.30 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 76.77 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.pdbx_details ;3.6M sodium formate, 10.0% Glycerol, Additive 0.001 M S-adenosylmethionine (SAM), VAPOR DIFFUSION,SITTING DROP,NANODROP, temperature 277K, VAPOR DIFFUSION, SITTING DROP ; _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 325 mm CCD' _diffrn_detector.details 'Flat mirror (vertical focusing)' _diffrn_detector.pdbx_collection_date 2008-08-01 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Single crystal Si(111) bent monochromator (horizontal focusing)' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.91837 1.0 2 0.97920 1.0 3 0.97845 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.pdbx_synchrotron_beamline BL11-1 _diffrn_source.type 'SSRL BEAMLINE BL11-1' _diffrn_source.pdbx_wavelength_list 0.91837,0.97920,0.97845 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.entry_id 3E8S _reflns.d_resolution_high 2.10 _reflns.d_resolution_low 28.239 _reflns.number_obs 31089 _reflns.pdbx_Rmerge_I_obs 0.068 _reflns.pdbx_redundancy 5.600 _reflns.percent_possible_obs 99.900 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 8.039 _reflns.B_iso_Wilson_estimate 38.343 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.15 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.521 _reflns_shell.meanI_over_sigI_obs 1.5 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy 5.600 _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3E8S _refine.ls_d_res_high 2.100 _refine.ls_d_res_low 28.239 _refine.pdbx_ls_sigma_F 0.00 _refine.ls_percent_reflns_obs 99.880 _refine.ls_number_reflns_obs 31072 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ;1. HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. 2. ATOM RECORD CONTAINS RESIDUAL B FACTORS ONLY. 3. A MET-INHIBITION PROTOCOL WAS USED FOR SELENOMETHIONINE INCORPORATION DURING PROTEIN EXPRESSION. THE OCCUPANCY OF THE SE ATOMS IN THE MSE RESIDUES WAS REDUCED TO 0.75 FOR THE REDUCED SCATTERING POWER DUE TO PARTIAL S-MET INCORPORATION. 4. 0.001 M S-ADENOSYL-METHIONINE (SAM) WAS ADDED DURING CRYSTALLIZATION, BUT ELECTRON DENSITY AT THE PUTATIVE ACTIVE SITE SUPPORTS THE MODELING OF S-ADENOSYL-HOMOCYSTEINE (SAH). THIS COULD BE DUE TO DEMETHYLATION OF THE SAM OR CO-PURIFICATION OF NATIVE SAH. ; _refine.ls_R_factor_obs 0.159 _refine.ls_R_factor_R_work 0.158 _refine.ls_R_factor_R_free 0.176 _refine.ls_percent_reflns_R_free 5.000 _refine.ls_number_reflns_R_free 1568 _refine.B_iso_mean 46.049 _refine.aniso_B[1][1] -1.630 _refine.aniso_B[2][2] -1.630 _refine.aniso_B[3][3] 2.450 _refine.aniso_B[1][2] -0.820 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.970 _refine.correlation_coeff_Fo_to_Fc_free 0.963 _refine.pdbx_overall_ESU_R 0.103 _refine.pdbx_overall_ESU_R_Free 0.098 _refine.overall_SU_ML 0.066 _refine.overall_SU_B 4.465 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.B_iso_max 99.24 _refine.B_iso_min 16.19 _refine.occupancy_max 1.00 _refine.occupancy_min 0.50 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all ? _refine.ls_R_factor_all ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_starting_model ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1699 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 219 _refine_hist.number_atoms_total 1944 _refine_hist.d_res_high 2.100 _refine_hist.d_res_low 28.239 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 1824 0.017 0.021 ? 'X-RAY DIFFRACTION' ? r_bond_other_d 1185 0.002 0.020 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 2502 1.637 1.958 ? 'X-RAY DIFFRACTION' ? r_angle_other_deg 2882 1.000 3.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 233 3.779 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 87 38.910 24.023 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 272 10.759 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 14 18.651 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 273 0.099 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 2097 0.007 0.020 ? 'X-RAY DIFFRACTION' ? r_gen_planes_other 371 0.004 0.020 ? 'X-RAY DIFFRACTION' ? r_nbd_refined 325 0.218 0.200 ? 'X-RAY DIFFRACTION' ? r_nbd_other 1295 0.202 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 846 0.178 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_other 917 0.087 0.200 ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 160 0.178 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 8 0.235 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 26 0.323 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 14 0.175 0.200 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1233 2.364 3.000 ? 'X-RAY DIFFRACTION' ? r_mcbond_other 463 0.550 3.000 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1800 3.079 5.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 785 5.234 8.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 699 7.107 11.000 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 2.100 _refine_ls_shell.d_res_low 2.155 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 100.000 _refine_ls_shell.number_reflns_R_work 2180 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.219 _refine_ls_shell.R_factor_R_free 0.237 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 104 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 2284 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3E8S _struct.title ;Crystal structure of Putative SAM Dependent Methyltransferase in Complex with SAH (NP_744700.1) from PSEUDOMONAS PUTIDA KT2440 at 2.10 A resolution ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.text ;NP_744700.1, Putative SAM Dependent Methyltransferase in Complex with SAH, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, Methyltransferase domain, TRANSFERASE ; _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.entry_id 3E8S # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 8 ? HIS A 30 ? ASN A 7 HIS A 29 1 ? 23 HELX_P HELX_P2 2 ILE A 33 ? VAL A 39 ? ILE A 32 VAL A 38 1 ? 7 HELX_P HELX_P3 3 VAL A 39 ? ARG A 51 ? VAL A 38 ARG A 50 1 ? 13 HELX_P HELX_P4 4 GLY A 64 ? ASP A 72 ? GLY A 63 ASP A 71 1 ? 9 HELX_P HELX_P5 5 ASP A 83 ? ALA A 93 ? ASP A 82 ALA A 92 1 ? 11 HELX_P HELX_P6 6 SER A 102 ? GLU A 108 ? SER A 101 GLU A 107 1 ? 7 HELX_P HELX_P7 7 ILE A 131 ? LEU A 141 ? ILE A 130 LEU A 140 1 ? 11 HELX_P HELX_P8 8 THR A 188 ? ALA A 199 ? THR A 187 ALA A 198 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ALA 137 C ? ? ? 1_555 A MSE 138 N ? ? A ALA 136 A MSE 137 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale2 covale both ? A MSE 138 C ? ? ? 1_555 A ARG 139 N ? ? A MSE 137 A ARG 138 1_555 ? ? ? ? ? ? ? 1.320 ? ? covale3 covale both ? A PRO 181 C ? ? ? 1_555 A MSE 182 N ? ? A PRO 180 A MSE 181 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale4 covale both ? A MSE 182 C ? ? ? 1_555 A PRO 183 N ? ? A MSE 181 A PRO 182 1_555 ? ? ? ? ? ? ? 1.352 ? ? covale5 covale both ? A ASP 197 C ? ? ? 1_555 A MSE 198 N ? ? A ASP 196 A MSE 197 1_555 ? ? ? ? ? ? ? 1.319 ? ? covale6 covale both ? A MSE 198 C ? ? ? 1_555 A ALA 199 N ? ? A MSE 197 A ALA 198 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale7 covale both ? A LEU 221 C ? ? ? 1_555 A MSE 222 N ? ? A LEU 220 A MSE 221 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale8 covale both ? A MSE 222 C ? ? ? 1_555 A VAL 223 N ? ? A MSE 221 A VAL 222 1_555 ? ? ? ? ? ? ? 1.322 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 98 ? LEU A 100 ? VAL A 97 LEU A 99 A 2 GLU A 76 ? ASP A 81 ? GLU A 75 ASP A 80 A 3 ARG A 55 ? LEU A 59 ? ARG A 54 LEU A 58 A 4 TYR A 117 ? ASN A 123 ? TYR A 116 ASN A 122 A 5 LEU A 142 ? THR A 152 ? LEU A 141 THR A 151 A 6 LEU A 220 ? ARG A 226 ? LEU A 219 ARG A 225 A 7 LEU A 201 ? GLN A 207 ? LEU A 200 GLN A 206 B 1 GLY A 166 ? GLU A 170 ? GLY A 165 GLU A 169 B 2 MSE A 182 ? PHE A 186 ? MSE A 181 PHE A 185 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O HIS A 99 ? O HIS A 98 N GLY A 79 ? N GLY A 78 A 2 3 O VAL A 78 ? O VAL A 77 N VAL A 56 ? N VAL A 55 A 3 4 N LEU A 59 ? N LEU A 58 O CYS A 121 ? O CYS A 120 A 4 5 N ILE A 120 ? N ILE A 119 O VAL A 149 ? O VAL A 148 A 5 6 N LEU A 148 ? N LEU A 147 O ALA A 224 ? O ALA A 223 A 6 7 O LEU A 221 ? O LEU A 220 N GLN A 207 ? N GLN A 206 B 1 2 N GLU A 170 ? N GLU A 169 O MSE A 182 ? O MSE A 181 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id SAH _struct_site.pdbx_auth_seq_id 300 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 23 _struct_site.details 'BINDING SITE FOR RESIDUE SAH A 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 23 LEU A 14 ? LEU A 13 . ? 1_555 ? 2 AC1 23 TRP A 17 ? TRP A 16 . ? 1_555 ? 3 AC1 23 TRP A 24 ? TRP A 23 . ? 1_555 ? 4 AC1 23 ARG A 36 ? ARG A 35 . ? 1_555 ? 5 AC1 23 GLY A 60 ? GLY A 59 . ? 1_555 ? 6 AC1 23 CYS A 61 ? CYS A 60 . ? 1_555 ? 7 AC1 23 GLY A 62 ? GLY A 61 . ? 1_555 ? 8 AC1 23 TRP A 65 ? TRP A 64 . ? 1_555 ? 9 AC1 23 ASP A 81 ? ASP A 80 . ? 1_555 ? 10 AC1 23 GLY A 82 ? GLY A 81 . ? 1_555 ? 11 AC1 23 LEU A 86 ? LEU A 85 . ? 1_555 ? 12 AC1 23 ALA A 101 ? ALA A 100 . ? 1_555 ? 13 AC1 23 SER A 102 ? SER A 101 . ? 1_555 ? 14 AC1 23 TYR A 103 ? TYR A 102 . ? 1_555 ? 15 AC1 23 ASN A 123 ? ASN A 122 . ? 1_555 ? 16 AC1 23 PHE A 124 ? PHE A 123 . ? 1_555 ? 17 AC1 23 HOH C . ? HOH A 301 . ? 1_555 ? 18 AC1 23 HOH C . ? HOH A 302 . ? 1_555 ? 19 AC1 23 HOH C . ? HOH A 307 . ? 1_555 ? 20 AC1 23 HOH C . ? HOH A 308 . ? 1_555 ? 21 AC1 23 HOH C . ? HOH A 423 . ? 1_555 ? 22 AC1 23 HOH C . ? HOH A 500 . ? 1_555 ? 23 AC1 23 HOH C . ? HOH A 501 . ? 1_555 ? # _atom_sites.entry_id 3E8S _atom_sites.fract_transf_matrix[1][1] 0.007667 _atom_sites.fract_transf_matrix[1][2] 0.004426 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008853 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018372 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 MSE 2 1 ? ? ? A . n A 1 3 GLU 3 2 ? ? ? A . n A 1 4 PRO 4 3 ? ? ? A . n A 1 5 ILE 5 4 ? ? ? A . n A 1 6 MSE 6 5 ? ? ? A . n A 1 7 ARG 7 6 ? ? ? A . n A 1 8 ASN 8 7 7 ASN ASN A . n A 1 9 PRO 9 8 8 PRO PRO A . n A 1 10 GLU 10 9 9 GLU GLU A . n A 1 11 ASP 11 10 10 ASP ASP A . n A 1 12 ALA 12 11 11 ALA ALA A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 LEU 14 13 13 LEU LEU A . n A 1 15 ASP 15 14 14 ASP ASP A . n A 1 16 SER 16 15 15 SER SER A . n A 1 17 TRP 17 16 16 TRP TRP A . n A 1 18 HIS 18 17 17 HIS HIS A . n A 1 19 GLN 19 18 18 GLN GLN A . n A 1 20 ASN 20 19 19 ASN ASN A . n A 1 21 ALA 21 20 20 ALA ALA A . n A 1 22 GLN 22 21 21 GLN GLN A . n A 1 23 ALA 23 22 22 ALA ALA A . n A 1 24 TRP 24 23 23 TRP TRP A . n A 1 25 ILE 25 24 24 ILE ILE A . n A 1 26 ASP 26 25 25 ASP ASP A . n A 1 27 ALA 27 26 26 ALA ALA A . n A 1 28 VAL 28 27 27 VAL VAL A . n A 1 29 ARG 29 28 28 ARG ARG A . n A 1 30 HIS 30 29 29 HIS HIS A . n A 1 31 GLY 31 30 30 GLY GLY A . n A 1 32 ALA 32 31 31 ALA ALA A . n A 1 33 ILE 33 32 32 ILE ILE A . n A 1 34 GLU 34 33 33 GLU GLU A . n A 1 35 SER 35 34 34 SER SER A . n A 1 36 ARG 36 35 35 ARG ARG A . n A 1 37 ARG 37 36 36 ARG ARG A . n A 1 38 GLN 38 37 37 GLN GLN A . n A 1 39 VAL 39 38 38 VAL VAL A . n A 1 40 THR 40 39 39 THR THR A . n A 1 41 ASP 41 40 40 ASP ASP A . n A 1 42 GLN 42 41 41 GLN GLN A . n A 1 43 ALA 43 42 42 ALA ALA A . n A 1 44 ILE 44 43 43 ILE ILE A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 LEU 46 45 45 LEU LEU A . n A 1 47 ALA 47 46 46 ALA ALA A . n A 1 48 ILE 48 47 47 ILE ILE A . n A 1 49 LEU 49 48 48 LEU LEU A . n A 1 50 GLY 50 49 49 GLY GLY A . n A 1 51 ARG 51 50 50 ARG ARG A . n A 1 52 GLN 52 51 51 GLN GLN A . n A 1 53 PRO 53 52 52 PRO PRO A . n A 1 54 GLU 54 53 53 GLU GLU A . n A 1 55 ARG 55 54 54 ARG ARG A . n A 1 56 VAL 56 55 55 VAL VAL A . n A 1 57 LEU 57 56 56 LEU LEU A . n A 1 58 ASP 58 57 57 ASP ASP A . n A 1 59 LEU 59 58 58 LEU LEU A . n A 1 60 GLY 60 59 59 GLY GLY A . n A 1 61 CYS 61 60 60 CYS CYS A . n A 1 62 GLY 62 61 61 GLY GLY A . n A 1 63 GLU 63 62 62 GLU GLU A . n A 1 64 GLY 64 63 63 GLY GLY A . n A 1 65 TRP 65 64 64 TRP TRP A . n A 1 66 LEU 66 65 65 LEU LEU A . n A 1 67 LEU 67 66 66 LEU LEU A . n A 1 68 ARG 68 67 67 ARG ARG A . n A 1 69 ALA 69 68 68 ALA ALA A . n A 1 70 LEU 70 69 69 LEU LEU A . n A 1 71 ALA 71 70 70 ALA ALA A . n A 1 72 ASP 72 71 71 ASP ASP A . n A 1 73 ARG 73 72 72 ARG ARG A . n A 1 74 GLY 74 73 73 GLY GLY A . n A 1 75 ILE 75 74 74 ILE ILE A . n A 1 76 GLU 76 75 75 GLU GLU A . n A 1 77 ALA 77 76 76 ALA ALA A . n A 1 78 VAL 78 77 77 VAL VAL A . n A 1 79 GLY 79 78 78 GLY GLY A . n A 1 80 VAL 80 79 79 VAL VAL A . n A 1 81 ASP 81 80 80 ASP ASP A . n A 1 82 GLY 82 81 81 GLY GLY A . n A 1 83 ASP 83 82 82 ASP ASP A . n A 1 84 ARG 84 83 83 ARG ARG A . n A 1 85 THR 85 84 84 THR THR A . n A 1 86 LEU 86 85 85 LEU LEU A . n A 1 87 VAL 87 86 86 VAL VAL A . n A 1 88 ASP 88 87 87 ASP ASP A . n A 1 89 ALA 89 88 88 ALA ALA A . n A 1 90 ALA 90 89 89 ALA ALA A . n A 1 91 ARG 91 90 90 ARG ARG A . n A 1 92 ALA 92 91 91 ALA ALA A . n A 1 93 ALA 93 92 92 ALA ALA A . n A 1 94 GLY 94 93 93 GLY GLY A . n A 1 95 ALA 95 94 94 ALA ALA A . n A 1 96 GLY 96 95 95 GLY GLY A . n A 1 97 GLU 97 96 96 GLU GLU A . n A 1 98 VAL 98 97 97 VAL VAL A . n A 1 99 HIS 99 98 98 HIS HIS A . n A 1 100 LEU 100 99 99 LEU LEU A . n A 1 101 ALA 101 100 100 ALA ALA A . n A 1 102 SER 102 101 101 SER SER A . n A 1 103 TYR 103 102 102 TYR TYR A . n A 1 104 ALA 104 103 103 ALA ALA A . n A 1 105 GLN 105 104 104 GLN GLN A . n A 1 106 LEU 106 105 105 LEU LEU A . n A 1 107 ALA 107 106 106 ALA ALA A . n A 1 108 GLU 108 107 107 GLU GLU A . n A 1 109 ALA 109 108 108 ALA ALA A . n A 1 110 LYS 110 109 109 LYS LYS A . n A 1 111 VAL 111 110 110 VAL VAL A . n A 1 112 PRO 112 111 111 PRO PRO A . n A 1 113 VAL 113 112 112 VAL VAL A . n A 1 114 GLY 114 113 113 GLY GLY A . n A 1 115 LYS 115 114 114 LYS LYS A . n A 1 116 ASP 116 115 115 ASP ASP A . n A 1 117 TYR 117 116 116 TYR TYR A . n A 1 118 ASP 118 117 117 ASP ASP A . n A 1 119 LEU 119 118 118 LEU LEU A . n A 1 120 ILE 120 119 119 ILE ILE A . n A 1 121 CYS 121 120 120 CYS CYS A . n A 1 122 ALA 122 121 121 ALA ALA A . n A 1 123 ASN 123 122 122 ASN ASN A . n A 1 124 PHE 124 123 123 PHE PHE A . n A 1 125 ALA 125 124 124 ALA ALA A . n A 1 126 LEU 126 125 125 LEU LEU A . n A 1 127 LEU 127 126 126 LEU LEU A . n A 1 128 HIS 128 127 127 HIS HIS A . n A 1 129 GLN 129 128 128 GLN GLN A . n A 1 130 ASP 130 129 129 ASP ASP A . n A 1 131 ILE 131 130 130 ILE ILE A . n A 1 132 ILE 132 131 131 ILE ILE A . n A 1 133 GLU 133 132 132 GLU GLU A . n A 1 134 LEU 134 133 133 LEU LEU A . n A 1 135 LEU 135 134 134 LEU LEU A . n A 1 136 SER 136 135 135 SER SER A . n A 1 137 ALA 137 136 136 ALA ALA A . n A 1 138 MSE 138 137 137 MSE MSE A . n A 1 139 ARG 139 138 138 ARG ARG A . n A 1 140 THR 140 139 139 THR THR A . n A 1 141 LEU 141 140 140 LEU LEU A . n A 1 142 LEU 142 141 141 LEU LEU A . n A 1 143 VAL 143 142 142 VAL VAL A . n A 1 144 PRO 144 143 143 PRO PRO A . n A 1 145 GLY 145 144 144 GLY GLY A . n A 1 146 GLY 146 145 145 GLY GLY A . n A 1 147 ALA 147 146 146 ALA ALA A . n A 1 148 LEU 148 147 147 LEU LEU A . n A 1 149 VAL 149 148 148 VAL VAL A . n A 1 150 ILE 150 149 149 ILE ILE A . n A 1 151 GLN 151 150 150 GLN GLN A . n A 1 152 THR 152 151 151 THR THR A . n A 1 153 LEU 153 152 152 LEU LEU A . n A 1 154 HIS 154 153 153 HIS HIS A . n A 1 155 PRO 155 154 154 PRO PRO A . n A 1 156 TRP 156 155 155 TRP TRP A . n A 1 157 SER 157 156 156 SER SER A . n A 1 158 VAL 158 157 157 VAL VAL A . n A 1 159 ALA 159 158 158 ALA ALA A . n A 1 160 ASP 160 159 159 ASP ASP A . n A 1 161 GLY 161 160 160 GLY GLY A . n A 1 162 ASP 162 161 161 ASP ASP A . n A 1 163 TYR 163 162 162 TYR TYR A . n A 1 164 GLN 164 163 163 GLN GLN A . n A 1 165 ASP 165 164 164 ASP ASP A . n A 1 166 GLY 166 165 165 GLY GLY A . n A 1 167 TRP 167 166 166 TRP TRP A . n A 1 168 ARG 168 167 167 ARG ARG A . n A 1 169 GLU 169 168 168 GLU GLU A . n A 1 170 GLU 170 169 169 GLU GLU A . n A 1 171 SER 171 170 170 SER SER A . n A 1 172 PHE 172 171 171 PHE PHE A . n A 1 173 ALA 173 172 172 ALA ALA A . n A 1 174 GLY 174 173 173 GLY GLY A . n A 1 175 PHE 175 174 174 PHE PHE A . n A 1 176 ALA 176 175 175 ALA ALA A . n A 1 177 GLY 177 176 176 GLY GLY A . n A 1 178 ASP 178 177 177 ASP ASP A . n A 1 179 TRP 179 178 178 TRP TRP A . n A 1 180 GLN 180 179 179 GLN GLN A . n A 1 181 PRO 181 180 180 PRO PRO A . n A 1 182 MSE 182 181 181 MSE MSE A . n A 1 183 PRO 183 182 182 PRO PRO A . n A 1 184 TRP 184 183 183 TRP TRP A . n A 1 185 TYR 185 184 184 TYR TYR A . n A 1 186 PHE 186 185 185 PHE PHE A . n A 1 187 ARG 187 186 186 ARG ARG A . n A 1 188 THR 188 187 187 THR THR A . n A 1 189 LEU 189 188 188 LEU LEU A . n A 1 190 ALA 190 189 189 ALA ALA A . n A 1 191 SER 191 190 190 SER SER A . n A 1 192 TRP 192 191 191 TRP TRP A . n A 1 193 LEU 193 192 192 LEU LEU A . n A 1 194 ASN 194 193 193 ASN ASN A . n A 1 195 ALA 195 194 194 ALA ALA A . n A 1 196 LEU 196 195 195 LEU LEU A . n A 1 197 ASP 197 196 196 ASP ASP A . n A 1 198 MSE 198 197 197 MSE MSE A . n A 1 199 ALA 199 198 198 ALA ALA A . n A 1 200 GLY 200 199 199 GLY GLY A . n A 1 201 LEU 201 200 200 LEU LEU A . n A 1 202 ARG 202 201 201 ARG ARG A . n A 1 203 LEU 203 202 202 LEU LEU A . n A 1 204 VAL 204 203 203 VAL VAL A . n A 1 205 SER 205 204 204 SER SER A . n A 1 206 LEU 206 205 205 LEU LEU A . n A 1 207 GLN 207 206 206 GLN GLN A . n A 1 208 GLU 208 207 207 GLU GLU A . n A 1 209 PRO 209 208 208 PRO PRO A . n A 1 210 GLN 210 209 209 GLN GLN A . n A 1 211 HIS 211 210 210 HIS HIS A . n A 1 212 PRO 212 211 211 PRO PRO A . n A 1 213 GLN 213 212 212 GLN GLN A . n A 1 214 SER 214 213 213 SER SER A . n A 1 215 ALA 215 214 214 ALA ALA A . n A 1 216 VAL 216 215 215 VAL VAL A . n A 1 217 PRO 217 216 216 PRO PRO A . n A 1 218 GLN 218 217 217 GLN GLN A . n A 1 219 SER 219 218 218 SER SER A . n A 1 220 LEU 220 219 219 LEU LEU A . n A 1 221 LEU 221 220 220 LEU LEU A . n A 1 222 MSE 222 221 221 MSE MSE A . n A 1 223 VAL 223 222 222 VAL VAL A . n A 1 224 ALA 224 223 223 ALA ALA A . n A 1 225 GLU 225 224 224 GLU GLU A . n A 1 226 ARG 226 225 225 ARG ARG A . n A 1 227 HIS 227 226 226 HIS HIS A . n # _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Joint Center for Structural Genomics' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center JCSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SAH 1 300 300 SAH SAH A . C 3 HOH 1 301 1 HOH HOH A . C 3 HOH 2 302 2 HOH HOH A . C 3 HOH 3 303 3 HOH HOH A . C 3 HOH 4 304 4 HOH HOH A . C 3 HOH 5 305 5 HOH HOH A . C 3 HOH 6 306 6 HOH HOH A . C 3 HOH 7 307 7 HOH HOH A . C 3 HOH 8 308 8 HOH HOH A . C 3 HOH 9 309 9 HOH HOH A . C 3 HOH 10 310 10 HOH HOH A . C 3 HOH 11 311 11 HOH HOH A . C 3 HOH 12 312 12 HOH HOH A . C 3 HOH 13 313 13 HOH HOH A . C 3 HOH 14 314 14 HOH HOH A . C 3 HOH 15 315 15 HOH HOH A . C 3 HOH 16 316 16 HOH HOH A . C 3 HOH 17 317 17 HOH HOH A . C 3 HOH 18 318 18 HOH HOH A . C 3 HOH 19 319 19 HOH HOH A . C 3 HOH 20 320 20 HOH HOH A . C 3 HOH 21 321 21 HOH HOH A . C 3 HOH 22 322 22 HOH HOH A . C 3 HOH 23 323 23 HOH HOH A . C 3 HOH 24 324 24 HOH HOH A . C 3 HOH 25 325 25 HOH HOH A . C 3 HOH 26 326 26 HOH HOH A . C 3 HOH 27 327 27 HOH HOH A . C 3 HOH 28 328 28 HOH HOH A . C 3 HOH 29 329 29 HOH HOH A . C 3 HOH 30 330 30 HOH HOH A . C 3 HOH 31 331 31 HOH HOH A . C 3 HOH 32 332 32 HOH HOH A . C 3 HOH 33 333 33 HOH HOH A . C 3 HOH 34 334 34 HOH HOH A . C 3 HOH 35 335 35 HOH HOH A . C 3 HOH 36 336 36 HOH HOH A . C 3 HOH 37 337 37 HOH HOH A . C 3 HOH 38 338 38 HOH HOH A . C 3 HOH 39 339 39 HOH HOH A . C 3 HOH 40 340 40 HOH HOH A . C 3 HOH 41 341 41 HOH HOH A . C 3 HOH 42 342 42 HOH HOH A . C 3 HOH 43 343 43 HOH HOH A . C 3 HOH 44 344 44 HOH HOH A . C 3 HOH 45 345 45 HOH HOH A . C 3 HOH 46 346 46 HOH HOH A . C 3 HOH 47 347 47 HOH HOH A . C 3 HOH 48 348 48 HOH HOH A . C 3 HOH 49 349 49 HOH HOH A . C 3 HOH 50 350 50 HOH HOH A . C 3 HOH 51 351 51 HOH HOH A . C 3 HOH 52 352 52 HOH HOH A . C 3 HOH 53 353 53 HOH HOH A . C 3 HOH 54 354 54 HOH HOH A . C 3 HOH 55 355 55 HOH HOH A . C 3 HOH 56 356 56 HOH HOH A . C 3 HOH 57 357 57 HOH HOH A . C 3 HOH 58 358 58 HOH HOH A . C 3 HOH 59 359 59 HOH HOH A . C 3 HOH 60 360 60 HOH HOH A . C 3 HOH 61 361 61 HOH HOH A . C 3 HOH 62 362 62 HOH HOH A . C 3 HOH 63 363 63 HOH HOH A . C 3 HOH 64 364 64 HOH HOH A . C 3 HOH 65 365 65 HOH HOH A . C 3 HOH 66 366 66 HOH HOH A . C 3 HOH 67 367 67 HOH HOH A . C 3 HOH 68 368 68 HOH HOH A . C 3 HOH 69 369 69 HOH HOH A . C 3 HOH 70 370 70 HOH HOH A . C 3 HOH 71 371 71 HOH HOH A . C 3 HOH 72 372 72 HOH HOH A . C 3 HOH 73 373 73 HOH HOH A . C 3 HOH 74 374 74 HOH HOH A . C 3 HOH 75 375 75 HOH HOH A . C 3 HOH 76 376 76 HOH HOH A . C 3 HOH 77 377 77 HOH HOH A . C 3 HOH 78 378 78 HOH HOH A . C 3 HOH 79 379 79 HOH HOH A . C 3 HOH 80 380 80 HOH HOH A . C 3 HOH 81 381 81 HOH HOH A . C 3 HOH 82 382 82 HOH HOH A . C 3 HOH 83 383 83 HOH HOH A . C 3 HOH 84 384 84 HOH HOH A . C 3 HOH 85 385 85 HOH HOH A . C 3 HOH 86 386 86 HOH HOH A . C 3 HOH 87 387 87 HOH HOH A . C 3 HOH 88 388 88 HOH HOH A . C 3 HOH 89 389 89 HOH HOH A . C 3 HOH 90 390 90 HOH HOH A . C 3 HOH 91 391 91 HOH HOH A . C 3 HOH 92 392 92 HOH HOH A . C 3 HOH 93 393 93 HOH HOH A . C 3 HOH 94 394 94 HOH HOH A . C 3 HOH 95 395 95 HOH HOH A . C 3 HOH 96 396 96 HOH HOH A . C 3 HOH 97 397 97 HOH HOH A . C 3 HOH 98 398 98 HOH HOH A . C 3 HOH 99 399 99 HOH HOH A . C 3 HOH 100 400 100 HOH HOH A . C 3 HOH 101 401 101 HOH HOH A . C 3 HOH 102 402 102 HOH HOH A . C 3 HOH 103 403 103 HOH HOH A . C 3 HOH 104 404 104 HOH HOH A . C 3 HOH 105 405 105 HOH HOH A . C 3 HOH 106 406 106 HOH HOH A . C 3 HOH 107 407 107 HOH HOH A . C 3 HOH 108 408 108 HOH HOH A . C 3 HOH 109 409 109 HOH HOH A . C 3 HOH 110 410 110 HOH HOH A . C 3 HOH 111 411 111 HOH HOH A . C 3 HOH 112 412 112 HOH HOH A . C 3 HOH 113 413 113 HOH HOH A . C 3 HOH 114 414 114 HOH HOH A . C 3 HOH 115 415 115 HOH HOH A . C 3 HOH 116 416 116 HOH HOH A . C 3 HOH 117 417 117 HOH HOH A . C 3 HOH 118 418 118 HOH HOH A . C 3 HOH 119 419 119 HOH HOH A . C 3 HOH 120 420 120 HOH HOH A . C 3 HOH 121 421 121 HOH HOH A . C 3 HOH 122 422 122 HOH HOH A . C 3 HOH 123 423 123 HOH HOH A . C 3 HOH 124 424 124 HOH HOH A . C 3 HOH 125 425 125 HOH HOH A . C 3 HOH 126 426 126 HOH HOH A . C 3 HOH 127 427 127 HOH HOH A . C 3 HOH 128 428 128 HOH HOH A . C 3 HOH 129 429 129 HOH HOH A . C 3 HOH 130 430 130 HOH HOH A . C 3 HOH 131 431 131 HOH HOH A . C 3 HOH 132 432 132 HOH HOH A . C 3 HOH 133 433 133 HOH HOH A . C 3 HOH 134 434 134 HOH HOH A . C 3 HOH 135 435 135 HOH HOH A . C 3 HOH 136 436 136 HOH HOH A . C 3 HOH 137 437 137 HOH HOH A . C 3 HOH 138 438 138 HOH HOH A . C 3 HOH 139 439 139 HOH HOH A . C 3 HOH 140 440 140 HOH HOH A . C 3 HOH 141 441 141 HOH HOH A . C 3 HOH 142 442 142 HOH HOH A . C 3 HOH 143 443 143 HOH HOH A . C 3 HOH 144 444 144 HOH HOH A . C 3 HOH 145 445 145 HOH HOH A . C 3 HOH 146 446 146 HOH HOH A . C 3 HOH 147 447 147 HOH HOH A . C 3 HOH 148 448 148 HOH HOH A . C 3 HOH 149 449 149 HOH HOH A . C 3 HOH 150 450 150 HOH HOH A . C 3 HOH 151 451 151 HOH HOH A . C 3 HOH 152 452 152 HOH HOH A . C 3 HOH 153 453 153 HOH HOH A . C 3 HOH 154 454 154 HOH HOH A . C 3 HOH 155 455 155 HOH HOH A . C 3 HOH 156 456 156 HOH HOH A . C 3 HOH 157 457 157 HOH HOH A . C 3 HOH 158 458 158 HOH HOH A . C 3 HOH 159 459 159 HOH HOH A . C 3 HOH 160 460 160 HOH HOH A . C 3 HOH 161 461 161 HOH HOH A . C 3 HOH 162 462 162 HOH HOH A . C 3 HOH 163 463 163 HOH HOH A . C 3 HOH 164 464 164 HOH HOH A . C 3 HOH 165 465 165 HOH HOH A . C 3 HOH 166 466 166 HOH HOH A . C 3 HOH 167 467 167 HOH HOH A . C 3 HOH 168 468 168 HOH HOH A . C 3 HOH 169 469 169 HOH HOH A . C 3 HOH 170 470 170 HOH HOH A . C 3 HOH 171 471 171 HOH HOH A . C 3 HOH 172 472 172 HOH HOH A . C 3 HOH 173 473 173 HOH HOH A . C 3 HOH 174 474 174 HOH HOH A . C 3 HOH 175 475 175 HOH HOH A . C 3 HOH 176 476 176 HOH HOH A . C 3 HOH 177 477 177 HOH HOH A . C 3 HOH 178 478 178 HOH HOH A . C 3 HOH 179 479 179 HOH HOH A . C 3 HOH 180 480 180 HOH HOH A . C 3 HOH 181 481 181 HOH HOH A . C 3 HOH 182 482 182 HOH HOH A . C 3 HOH 183 483 183 HOH HOH A . C 3 HOH 184 484 184 HOH HOH A . C 3 HOH 185 485 185 HOH HOH A . C 3 HOH 186 486 186 HOH HOH A . C 3 HOH 187 487 187 HOH HOH A . C 3 HOH 188 488 188 HOH HOH A . C 3 HOH 189 489 189 HOH HOH A . C 3 HOH 190 490 190 HOH HOH A . C 3 HOH 191 491 191 HOH HOH A . C 3 HOH 192 492 192 HOH HOH A . C 3 HOH 193 493 193 HOH HOH A . C 3 HOH 194 494 194 HOH HOH A . C 3 HOH 195 495 195 HOH HOH A . C 3 HOH 196 496 196 HOH HOH A . C 3 HOH 197 497 197 HOH HOH A . C 3 HOH 198 498 198 HOH HOH A . C 3 HOH 199 499 199 HOH HOH A . C 3 HOH 200 500 200 HOH HOH A . C 3 HOH 201 501 201 HOH HOH A . C 3 HOH 202 502 202 HOH HOH A . C 3 HOH 203 503 203 HOH HOH A . C 3 HOH 204 504 204 HOH HOH A . C 3 HOH 205 505 205 HOH HOH A . C 3 HOH 206 506 206 HOH HOH A . C 3 HOH 207 507 207 HOH HOH A . C 3 HOH 208 508 208 HOH HOH A . C 3 HOH 209 509 209 HOH HOH A . C 3 HOH 210 510 210 HOH HOH A . C 3 HOH 211 511 211 HOH HOH A . C 3 HOH 212 512 212 HOH HOH A . C 3 HOH 213 513 213 HOH HOH A . C 3 HOH 214 514 214 HOH HOH A . C 3 HOH 215 515 215 HOH HOH A . C 3 HOH 216 516 216 HOH HOH A . C 3 HOH 217 517 217 HOH HOH A . C 3 HOH 218 518 218 HOH HOH A . C 3 HOH 219 519 219 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 138 A MSE 137 ? MET SELENOMETHIONINE 2 A MSE 182 A MSE 181 ? MET SELENOMETHIONINE 3 A MSE 198 A MSE 197 ? MET SELENOMETHIONINE 4 A MSE 222 A MSE 221 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1310 ? 1 MORE -12 ? 1 'SSA (A^2)' 19070 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 130.4330000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id TRP _pdbx_struct_special_symmetry.auth_seq_id 155 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id A _pdbx_struct_special_symmetry.label_comp_id TRP _pdbx_struct_special_symmetry.label_seq_id 156 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-09-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-10-25 4 'Structure model' 1 3 2019-07-24 5 'Structure model' 1 4 2023-02-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' software 3 4 'Structure model' struct_conn 4 5 'Structure model' database_2 5 5 'Structure model' struct_ref_seq_dif 6 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.classification' 2 3 'Structure model' '_software.name' 3 4 'Structure model' '_software.classification' 4 4 'Structure model' '_software.contact_author' 5 4 'Structure model' '_software.contact_author_email' 6 4 'Structure model' '_software.language' 7 4 'Structure model' '_software.location' 8 4 'Structure model' '_software.name' 9 4 'Structure model' '_software.type' 10 4 'Structure model' '_software.version' 11 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 12 5 'Structure model' '_database_2.pdbx_DOI' 13 5 'Structure model' '_database_2.pdbx_database_accession' 14 5 'Structure model' '_struct_ref_seq_dif.details' 15 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 16 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 17 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 66.0444 _pdbx_refine_tls.origin_y 17.9875 _pdbx_refine_tls.origin_z 11.4044 _pdbx_refine_tls.T[1][1] -0.1245 _pdbx_refine_tls.T[2][2] -0.1769 _pdbx_refine_tls.T[3][3] -0.1203 _pdbx_refine_tls.T[1][2] -0.0010 _pdbx_refine_tls.T[1][3] 0.0182 _pdbx_refine_tls.T[2][3] 0.0109 _pdbx_refine_tls.L[1][1] 0.9196 _pdbx_refine_tls.L[2][2] 3.2167 _pdbx_refine_tls.L[3][3] 1.3997 _pdbx_refine_tls.L[1][2] -0.2294 _pdbx_refine_tls.L[1][3] 0.0186 _pdbx_refine_tls.L[2][3] 0.0718 _pdbx_refine_tls.S[1][1] 0.0583 _pdbx_refine_tls.S[2][2] -0.1081 _pdbx_refine_tls.S[3][3] 0.0498 _pdbx_refine_tls.S[1][2] -0.0152 _pdbx_refine_tls.S[1][3] -0.1171 _pdbx_refine_tls.S[2][3] 0.0164 _pdbx_refine_tls.S[2][1] 0.0133 _pdbx_refine_tls.S[3][1] 0.1266 _pdbx_refine_tls.S[3][2] 0.0104 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 224 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.beg_auth_seq_id 8 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 9 _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 225 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.selection_details ? # _phasing.method MAD # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal REFMAC 5.2.0019 ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 1 PHENIX . ? package 'P.D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 2 SHELX . ? package 'George M. Sheldrick' gsheldr@shelx.uni-ac.gwdg.de phasing http://shelx.uni-ac.gwdg.de/SHELX/ Fortran_77 ? 3 MolProbity 3beta29 ? package 'D.C. & J.S. Richardson lab' molprobity@kinemage.biochem.duke.edu 'model building' http://kinemage.biochem.duke.edu/molprobity/ ? ? 4 SCALA 3.2.5 5/04/2004 other 'Phil R. Evans' pre@mrc-lmb.cam.ac.uk 'data scaling' http://www.ccp4.ac.uk/dist/html/scala.html Fortran_77 ? 5 PDB_EXTRACT 3.006 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 6 MOSFLM . ? ? ? ? 'data reduction' ? ? ? 7 autoSHARP . ? ? ? ? phasing ? ? ? 8 SHELXD . ? ? ? ? phasing ? ? ? 9 # _pdbx_entry_details.entry_id 3E8S _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THE CONSTRUCT WAS EXPRESSED WITH A PURIFICATION TAG MGSDKIHHHHHHENLYFQG. THE TAG WAS REMOVED WITH TEV PROTEASE LEAVING ONLY A GLYCINE (0) FOLLOWED BY THE TARGET SEQUENCE. ; _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLY _pdbx_validate_close_contact.auth_seq_id_1 93 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 A _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 499 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.05 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 186 ? ? CZ A ARG 186 ? ? NH1 A ARG 186 ? ? 123.60 120.30 3.30 0.50 N 2 1 NE A ARG 186 ? ? CZ A ARG 186 ? ? NH2 A ARG 186 ? ? 116.69 120.30 -3.61 0.50 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id VAL _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 38 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -142.87 _pdbx_validate_torsion.psi -52.53 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 109 ? CD ? A LYS 110 CD 2 1 Y 1 A LYS 109 ? CE ? A LYS 110 CE 3 1 Y 1 A LYS 109 ? NZ ? A LYS 110 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A MSE 1 ? A MSE 2 3 1 Y 1 A GLU 2 ? A GLU 3 4 1 Y 1 A PRO 3 ? A PRO 4 5 1 Y 1 A ILE 4 ? A ILE 5 6 1 Y 1 A MSE 5 ? A MSE 6 7 1 Y 1 A ARG 6 ? A ARG 7 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 S-ADENOSYL-L-HOMOCYSTEINE SAH 3 water HOH #