data_3E9V # _entry.id 3E9V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3E9V pdb_00003e9v 10.2210/pdb3e9v/pdb RCSB RCSB049057 ? ? WWPDB D_1000049057 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-10-14 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2018-11-14 4 'Structure model' 1 3 2021-02-10 5 'Structure model' 1 4 2023-08-30 6 'Structure model' 1 5 2023-11-15 7 'Structure model' 1 6 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Structure summary' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Structure summary' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Refinement description' 9 6 'Structure model' 'Data collection' 10 7 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' audit_author 2 4 'Structure model' audit_author 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_site 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_initial_refinement_model 9 6 'Structure model' chem_comp_atom 10 6 'Structure model' chem_comp_bond 11 7 'Structure model' pdbx_entry_details 12 7 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_audit_author.identifier_ORCID' 2 4 'Structure model' '_audit_author.identifier_ORCID' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 4 'Structure model' '_struct_site.pdbx_auth_seq_id' 7 5 'Structure model' '_database_2.pdbx_DOI' 8 5 'Structure model' '_database_2.pdbx_database_accession' 9 6 'Structure model' '_chem_comp_atom.atom_id' 10 6 'Structure model' '_chem_comp_bond.atom_id_2' # _pdbx_database_status.entry_id 3E9V _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-08-23 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id NYSGXRC-13011a _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sampathkumar, P.' 1 ? 'Romero, R.' 2 ? 'Wasserman, S.' 3 ? 'Hu, S.' 4 ? 'Maletic, M.' 5 ? 'Freeman, J.' 6 ? 'Tarun, G.' 7 ? 'Atwell, S.' 8 ? 'Sauder, J.M.' 9 0000-0002-0254-4955 'Burley, S.K.' 10 0000-0002-2487-9713 'New York SGX Research Center for Structural Genomics (NYSGXRC)' 11 ? # _citation.id primary _citation.title 'Crystal structure of human B-cell Translocation Gene 2 (BTG2)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # _citation_author.citation_id primary _citation_author.name 'Sampathkumar, P.' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein BTG2' 13647.295 1 ? ? ? ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 2 ? ? ? ? 3 water nat water 18.015 66 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'B-cell Translocation Gene 2, BTG family member 2, NGF-inducible anti-proliferative protein PC3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;D(MSE)LPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHK(MSE)DPIIS RVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAP ; _entity_poly.pdbx_seq_one_letter_code_can ;DMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGL SQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGXRC-13011a # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 MSE n 1 3 LEU n 1 4 PRO n 1 5 GLU n 1 6 ILE n 1 7 ALA n 1 8 ALA n 1 9 ALA n 1 10 VAL n 1 11 GLY n 1 12 PHE n 1 13 LEU n 1 14 SER n 1 15 SER n 1 16 LEU n 1 17 LEU n 1 18 ARG n 1 19 THR n 1 20 ARG n 1 21 GLY n 1 22 CYS n 1 23 VAL n 1 24 SER n 1 25 GLU n 1 26 GLN n 1 27 ARG n 1 28 LEU n 1 29 LYS n 1 30 VAL n 1 31 PHE n 1 32 SER n 1 33 GLY n 1 34 ALA n 1 35 LEU n 1 36 GLN n 1 37 GLU n 1 38 ALA n 1 39 LEU n 1 40 THR n 1 41 GLU n 1 42 HIS n 1 43 TYR n 1 44 LYS n 1 45 HIS n 1 46 HIS n 1 47 TRP n 1 48 PHE n 1 49 PRO n 1 50 GLU n 1 51 LYS n 1 52 PRO n 1 53 SER n 1 54 LYS n 1 55 GLY n 1 56 SER n 1 57 GLY n 1 58 TYR n 1 59 ARG n 1 60 CYS n 1 61 ILE n 1 62 ARG n 1 63 ILE n 1 64 ASN n 1 65 HIS n 1 66 LYS n 1 67 MSE n 1 68 ASP n 1 69 PRO n 1 70 ILE n 1 71 ILE n 1 72 SER n 1 73 ARG n 1 74 VAL n 1 75 ALA n 1 76 SER n 1 77 GLN n 1 78 ILE n 1 79 GLY n 1 80 LEU n 1 81 SER n 1 82 GLN n 1 83 PRO n 1 84 GLN n 1 85 LEU n 1 86 HIS n 1 87 GLN n 1 88 LEU n 1 89 LEU n 1 90 PRO n 1 91 SER n 1 92 GLU n 1 93 LEU n 1 94 THR n 1 95 LEU n 1 96 TRP n 1 97 VAL n 1 98 ASP n 1 99 PRO n 1 100 TYR n 1 101 GLU n 1 102 VAL n 1 103 SER n 1 104 TYR n 1 105 ARG n 1 106 ILE n 1 107 GLY n 1 108 GLU n 1 109 ASP n 1 110 GLY n 1 111 SER n 1 112 ILE n 1 113 CYS n 1 114 VAL n 1 115 LEU n 1 116 TYR n 1 117 GLU n 1 118 GLU n 1 119 ALA n 1 120 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BTG2, PC3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)-Codon+RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'BS-pSGX4(BS); modified pET26b' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 9 9 ASP ASP A . n A 1 2 MSE 2 10 10 MSE MSE A . n A 1 3 LEU 3 11 11 LEU LEU A . n A 1 4 PRO 4 12 12 PRO PRO A . n A 1 5 GLU 5 13 13 GLU GLU A . n A 1 6 ILE 6 14 14 ILE ILE A . n A 1 7 ALA 7 15 15 ALA ALA A . n A 1 8 ALA 8 16 16 ALA ALA A . n A 1 9 ALA 9 17 17 ALA ALA A . n A 1 10 VAL 10 18 18 VAL VAL A . n A 1 11 GLY 11 19 19 GLY GLY A . n A 1 12 PHE 12 20 20 PHE PHE A . n A 1 13 LEU 13 21 21 LEU LEU A . n A 1 14 SER 14 22 22 SER SER A . n A 1 15 SER 15 23 23 SER SER A . n A 1 16 LEU 16 24 24 LEU LEU A . n A 1 17 LEU 17 25 25 LEU LEU A . n A 1 18 ARG 18 26 26 ARG ARG A . n A 1 19 THR 19 27 27 THR THR A . n A 1 20 ARG 20 28 28 ARG ARG A . n A 1 21 GLY 21 29 29 GLY GLY A . n A 1 22 CYS 22 30 30 CYS CYS A . n A 1 23 VAL 23 31 31 VAL VAL A . n A 1 24 SER 24 32 32 SER SER A . n A 1 25 GLU 25 33 33 GLU GLU A . n A 1 26 GLN 26 34 34 GLN GLN A . n A 1 27 ARG 27 35 35 ARG ARG A . n A 1 28 LEU 28 36 36 LEU LEU A . n A 1 29 LYS 29 37 37 LYS LYS A . n A 1 30 VAL 30 38 38 VAL VAL A . n A 1 31 PHE 31 39 39 PHE PHE A . n A 1 32 SER 32 40 40 SER SER A . n A 1 33 GLY 33 41 41 GLY GLY A . n A 1 34 ALA 34 42 42 ALA ALA A . n A 1 35 LEU 35 43 43 LEU LEU A . n A 1 36 GLN 36 44 44 GLN GLN A . n A 1 37 GLU 37 45 45 GLU GLU A . n A 1 38 ALA 38 46 46 ALA ALA A . n A 1 39 LEU 39 47 47 LEU LEU A . n A 1 40 THR 40 48 48 THR THR A . n A 1 41 GLU 41 49 49 GLU GLU A . n A 1 42 HIS 42 50 50 HIS HIS A . n A 1 43 TYR 43 51 51 TYR TYR A . n A 1 44 LYS 44 52 52 LYS LYS A . n A 1 45 HIS 45 53 53 HIS HIS A . n A 1 46 HIS 46 54 54 HIS HIS A . n A 1 47 TRP 47 55 55 TRP TRP A . n A 1 48 PHE 48 56 56 PHE PHE A . n A 1 49 PRO 49 57 57 PRO PRO A . n A 1 50 GLU 50 58 58 GLU GLU A . n A 1 51 LYS 51 59 59 LYS LYS A . n A 1 52 PRO 52 60 60 PRO PRO A . n A 1 53 SER 53 61 61 SER SER A . n A 1 54 LYS 54 62 62 LYS LYS A . n A 1 55 GLY 55 63 63 GLY GLY A . n A 1 56 SER 56 64 64 SER SER A . n A 1 57 GLY 57 65 65 GLY GLY A . n A 1 58 TYR 58 66 66 TYR TYR A . n A 1 59 ARG 59 67 67 ARG ARG A . n A 1 60 CYS 60 68 68 CYS CYS A . n A 1 61 ILE 61 69 69 ILE ILE A . n A 1 62 ARG 62 70 70 ARG ARG A . n A 1 63 ILE 63 71 71 ILE ILE A . n A 1 64 ASN 64 72 72 ASN ASN A . n A 1 65 HIS 65 73 73 HIS HIS A . n A 1 66 LYS 66 74 74 LYS LYS A . n A 1 67 MSE 67 75 75 MSE MSE A . n A 1 68 ASP 68 76 76 ASP ASP A . n A 1 69 PRO 69 77 77 PRO PRO A . n A 1 70 ILE 70 78 78 ILE ILE A . n A 1 71 ILE 71 79 79 ILE ILE A . n A 1 72 SER 72 80 80 SER SER A . n A 1 73 ARG 73 81 81 ARG ARG A . n A 1 74 VAL 74 82 82 VAL VAL A . n A 1 75 ALA 75 83 83 ALA ALA A . n A 1 76 SER 76 84 84 SER SER A . n A 1 77 GLN 77 85 85 GLN GLN A . n A 1 78 ILE 78 86 86 ILE ILE A . n A 1 79 GLY 79 87 87 GLY GLY A . n A 1 80 LEU 80 88 88 LEU LEU A . n A 1 81 SER 81 89 89 SER SER A . n A 1 82 GLN 82 90 90 GLN GLN A . n A 1 83 PRO 83 91 91 PRO PRO A . n A 1 84 GLN 84 92 92 GLN GLN A . n A 1 85 LEU 85 93 93 LEU LEU A . n A 1 86 HIS 86 94 94 HIS HIS A . n A 1 87 GLN 87 95 95 GLN GLN A . n A 1 88 LEU 88 96 96 LEU LEU A . n A 1 89 LEU 89 97 97 LEU LEU A . n A 1 90 PRO 90 98 98 PRO PRO A . n A 1 91 SER 91 99 99 SER SER A . n A 1 92 GLU 92 100 100 GLU GLU A . n A 1 93 LEU 93 101 101 LEU LEU A . n A 1 94 THR 94 102 102 THR THR A . n A 1 95 LEU 95 103 103 LEU LEU A . n A 1 96 TRP 96 104 104 TRP TRP A . n A 1 97 VAL 97 105 105 VAL VAL A . n A 1 98 ASP 98 106 106 ASP ASP A . n A 1 99 PRO 99 107 107 PRO PRO A . n A 1 100 TYR 100 108 108 TYR TYR A . n A 1 101 GLU 101 109 109 GLU GLU A . n A 1 102 VAL 102 110 110 VAL VAL A . n A 1 103 SER 103 111 111 SER SER A . n A 1 104 TYR 104 112 112 TYR TYR A . n A 1 105 ARG 105 113 113 ARG ARG A . n A 1 106 ILE 106 114 114 ILE ILE A . n A 1 107 GLY 107 115 115 GLY GLY A . n A 1 108 GLU 108 116 116 GLU GLU A . n A 1 109 ASP 109 117 117 ASP ASP A . n A 1 110 GLY 110 118 118 GLY GLY A . n A 1 111 SER 111 119 119 SER SER A . n A 1 112 ILE 112 120 120 ILE ILE A . n A 1 113 CYS 113 121 121 CYS CYS A . n A 1 114 VAL 114 122 122 VAL VAL A . n A 1 115 LEU 115 123 123 LEU LEU A . n A 1 116 TYR 116 124 124 TYR TYR A . n A 1 117 GLU 117 125 125 GLU GLU A . n A 1 118 GLU 118 126 126 GLU GLU A . n A 1 119 ALA 119 127 127 ALA ALA A . n A 1 120 PRO 120 128 128 PRO PRO A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 1 1 EDO EDO A . C 2 EDO 1 2 2 EDO EDO A . D 3 HOH 1 129 1 HOH HOH A . D 3 HOH 2 130 2 HOH HOH A . D 3 HOH 3 131 3 HOH HOH A . D 3 HOH 4 132 4 HOH HOH A . D 3 HOH 5 133 5 HOH HOH A . D 3 HOH 6 134 6 HOH HOH A . D 3 HOH 7 135 7 HOH HOH A . D 3 HOH 8 136 8 HOH HOH A . D 3 HOH 9 137 9 HOH HOH A . D 3 HOH 10 138 10 HOH HOH A . D 3 HOH 11 139 11 HOH HOH A . D 3 HOH 12 140 12 HOH HOH A . D 3 HOH 13 141 13 HOH HOH A . D 3 HOH 14 142 14 HOH HOH A . D 3 HOH 15 143 15 HOH HOH A . D 3 HOH 16 144 16 HOH HOH A . D 3 HOH 17 145 17 HOH HOH A . D 3 HOH 18 146 18 HOH HOH A . D 3 HOH 19 147 19 HOH HOH A . D 3 HOH 20 148 20 HOH HOH A . D 3 HOH 21 149 21 HOH HOH A . D 3 HOH 22 150 22 HOH HOH A . D 3 HOH 23 151 23 HOH HOH A . D 3 HOH 24 152 24 HOH HOH A . D 3 HOH 25 153 25 HOH HOH A . D 3 HOH 26 154 26 HOH HOH A . D 3 HOH 27 155 27 HOH HOH A . D 3 HOH 28 156 28 HOH HOH A . D 3 HOH 29 157 29 HOH HOH A . D 3 HOH 30 158 30 HOH HOH A . D 3 HOH 31 159 31 HOH HOH A . D 3 HOH 32 160 32 HOH HOH A . D 3 HOH 33 161 33 HOH HOH A . D 3 HOH 34 162 34 HOH HOH A . D 3 HOH 35 163 35 HOH HOH A . D 3 HOH 36 164 36 HOH HOH A . D 3 HOH 37 165 37 HOH HOH A . D 3 HOH 38 166 38 HOH HOH A . D 3 HOH 39 167 39 HOH HOH A . D 3 HOH 40 168 40 HOH HOH A . D 3 HOH 41 169 41 HOH HOH A . D 3 HOH 42 170 42 HOH HOH A . D 3 HOH 43 171 43 HOH HOH A . D 3 HOH 44 172 44 HOH HOH A . D 3 HOH 45 173 45 HOH HOH A . D 3 HOH 46 174 46 HOH HOH A . D 3 HOH 47 175 47 HOH HOH A . D 3 HOH 48 176 48 HOH HOH A . D 3 HOH 49 177 49 HOH HOH A . D 3 HOH 50 178 50 HOH HOH A . D 3 HOH 51 179 51 HOH HOH A . D 3 HOH 52 180 52 HOH HOH A . D 3 HOH 53 181 53 HOH HOH A . D 3 HOH 54 182 54 HOH HOH A . D 3 HOH 55 183 55 HOH HOH A . D 3 HOH 56 184 56 HOH HOH A . D 3 HOH 57 185 57 HOH HOH A . D 3 HOH 58 186 58 HOH HOH A . D 3 HOH 59 187 59 HOH HOH A . D 3 HOH 60 188 60 HOH HOH A . D 3 HOH 61 189 61 HOH HOH A . D 3 HOH 62 190 62 HOH HOH A . D 3 HOH 63 191 63 HOH HOH A . D 3 HOH 64 192 64 HOH HOH A . D 3 HOH 65 193 65 HOH HOH A . D 3 HOH 66 194 66 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 28 ? CG ? A ARG 20 CG 2 1 Y 1 A ARG 28 ? CD ? A ARG 20 CD 3 1 Y 1 A ARG 28 ? NE ? A ARG 20 NE 4 1 Y 1 A ARG 28 ? CZ ? A ARG 20 CZ 5 1 Y 1 A ARG 28 ? NH1 ? A ARG 20 NH1 6 1 Y 1 A ARG 28 ? NH2 ? A ARG 20 NH2 7 1 Y 1 A CYS 30 ? SG ? A CYS 22 SG 8 1 Y 1 A LYS 37 ? CG ? A LYS 29 CG 9 1 Y 1 A LYS 37 ? CD ? A LYS 29 CD 10 1 Y 1 A LYS 37 ? CE ? A LYS 29 CE 11 1 Y 1 A LYS 37 ? NZ ? A LYS 29 NZ 12 1 Y 1 A GLU 45 ? CG ? A GLU 37 CG 13 1 Y 1 A GLU 45 ? CD ? A GLU 37 CD 14 1 Y 1 A GLU 45 ? OE1 ? A GLU 37 OE1 15 1 Y 1 A GLU 45 ? OE2 ? A GLU 37 OE2 16 1 Y 1 A GLU 49 ? CG ? A GLU 41 CG 17 1 Y 1 A GLU 49 ? CD ? A GLU 41 CD 18 1 Y 1 A GLU 49 ? OE1 ? A GLU 41 OE1 19 1 Y 1 A GLU 49 ? OE2 ? A GLU 41 OE2 20 1 Y 1 A ASN 72 ? CG ? A ASN 64 CG 21 1 Y 1 A ASN 72 ? OD1 ? A ASN 64 OD1 22 1 Y 1 A ASN 72 ? ND2 ? A ASN 64 ND2 23 1 Y 1 A HIS 73 ? CG ? A HIS 65 CG 24 1 Y 1 A HIS 73 ? ND1 ? A HIS 65 ND1 25 1 Y 1 A HIS 73 ? CD2 ? A HIS 65 CD2 26 1 Y 1 A HIS 73 ? CE1 ? A HIS 65 CE1 27 1 Y 1 A HIS 73 ? NE2 ? A HIS 65 NE2 28 1 Y 1 A LYS 74 ? CG ? A LYS 66 CG 29 1 Y 1 A LYS 74 ? CD ? A LYS 66 CD 30 1 Y 1 A LYS 74 ? CE ? A LYS 66 CE 31 1 Y 1 A LYS 74 ? NZ ? A LYS 66 NZ 32 1 Y 1 A GLU 100 ? CG ? A GLU 92 CG 33 1 Y 1 A GLU 100 ? CD ? A GLU 92 CD 34 1 Y 1 A GLU 100 ? OE1 ? A GLU 92 OE1 35 1 Y 1 A GLU 100 ? OE2 ? A GLU 92 OE2 36 1 Y 1 A GLU 125 ? CG ? A GLU 117 CG 37 1 Y 1 A GLU 125 ? CD ? A GLU 117 CD 38 1 Y 1 A GLU 125 ? OE1 ? A GLU 117 OE1 39 1 Y 1 A GLU 125 ? OE2 ? A GLU 117 OE2 # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal MOSFLM . ? package 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk 'data reduction' http://www.mrc-lmb.cam.ac.uk/harry/mosflm/ ? ? 1 SCALA 3.2.21 7/4/2006 other 'Phil R. Evans' pre@mrc-lmb.cam.ac.uk 'data scaling' http://www.ccp4.ac.uk/dist/html/scala.html Fortran_77 ? 2 REFMAC . ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 3 PDB_EXTRACT 3.006 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 4 PHASER . ? ? ? ? phasing ? ? ? 5 # _cell.length_a 39.535 _cell.length_b 41.023 _cell.length_c 68.652 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 3E9V _cell.pdbx_unique_axis ? _cell.Z_PDB 4 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.entry_id 3E9V _symmetry.Int_Tables_number 19 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # _exptl.crystals_number 1 _exptl.entry_id 3E9V _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 1.84 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 33.31 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.temp 294 _exptl_crystal_grow.pdbx_details '100mM Bis-Tris pH 6.5, 0.2M Magnesium Chloride, 25% PEG 3350, Vapor diffusion, sitting drop, temperature 294K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MAR CCD 165 mm' _diffrn_detector.pdbx_collection_date 2008-07-10 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator diamond _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 31-ID' _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 31-ID # _reflns.entry_id 3E9V _reflns.d_resolution_high 1.700 _reflns.d_resolution_low 41.030 _reflns.number_all ? _reflns.number_obs 12646 _reflns.pdbx_Rmerge_I_obs 0.071 _reflns.pdbx_netI_over_sigmaI 6.69 _reflns.pdbx_Rsym_value 0.071 _reflns.pdbx_redundancy 13.800 _reflns.percent_possible_obs 98.700 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.B_iso_Wilson_estimate 25.8 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal 1.70 1.79 ? 23988 ? 0.457 1.5 0.457 ? 13.40 ? 1785 97.60 ? 1 1.79 1.90 ? 23581 ? 0.318 2.1 0.318 ? 13.70 ? 1722 98.30 ? 2 1.90 2.03 ? 22028 ? 0.209 3.3 0.209 ? 13.80 ? 1594 98.80 ? 3 2.03 2.19 ? 21032 ? 0.142 4.8 0.142 ? 14.00 ? 1502 98.30 ? 4 2.19 2.40 ? 19955 ? 0.100 6.8 0.100 ? 14.20 ? 1406 99.40 ? 5 2.40 2.69 ? 18290 ? 0.079 8.3 0.079 ? 14.40 ? 1270 99.20 ? 6 2.69 3.10 ? 16328 ? 0.064 10.4 0.064 ? 14.30 ? 1138 99.60 ? 7 3.10 3.80 ? 14087 ? 0.053 11.3 0.053 ? 14.10 ? 999 99.80 ? 8 3.80 5.38 ? 10453 ? 0.047 12.6 0.047 ? 13.60 ? 771 99.70 ? 9 5.38 41.03 ? 5388 ? 0.046 12.7 0.046 ? 11.70 ? 459 97.30 ? 10 # _refine.entry_id 3E9V _refine.ls_d_res_high 1.700 _refine.ls_d_res_low 35.220 _refine.pdbx_ls_sigma_F 0.00 _refine.ls_percent_reflns_obs 98.410 _refine.ls_number_reflns_obs 12613 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.ls_R_factor_obs 0.213 _refine.ls_R_factor_R_work 0.211 _refine.ls_wR_factor_R_work 0.211 _refine.ls_R_factor_R_free 0.248 _refine.ls_wR_factor_R_free 0.248 _refine.ls_percent_reflns_R_free 5.000 _refine.ls_number_reflns_R_free 632 _refine.B_iso_mean 24.514 _refine.aniso_B[1][1] 0.000 _refine.aniso_B[2][2] 0.000 _refine.aniso_B[3][3] 0.000 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.949 _refine.correlation_coeff_Fo_to_Fc_free 0.931 _refine.overall_SU_R_Cruickshank_DPI 0.132 _refine.overall_SU_R_free 0.125 _refine.pdbx_overall_ESU_R 0.132 _refine.pdbx_overall_ESU_R_Free 0.126 _refine.overall_SU_ML 0.084 _refine.overall_SU_B 2.499 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.pdbx_solvent_vdw_probe_radii 1.400 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.overall_FOM_work_R_set 0.830 _refine.B_iso_max 52.76 _refine.B_iso_min 12.34 _refine.occupancy_max 1.00 _refine.occupancy_min 0.30 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all ? _refine.ls_R_factor_all ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_starting_model 2D5R _refine.pdbx_stereochem_target_val_spec_case ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 945 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.number_atoms_solvent 66 _refine_hist.number_atoms_total 1019 _refine_hist.d_res_high 1.700 _refine_hist.d_res_low 35.220 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 982 0.012 0.022 ? 'X-RAY DIFFRACTION' ? r_bond_other_d 667 0.001 0.020 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1347 1.431 1.983 ? 'X-RAY DIFFRACTION' ? r_angle_other_deg 1641 0.868 3.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 133 5.210 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 36 40.243 22.778 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 158 10.931 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 6 17.658 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 156 0.080 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 1096 0.005 0.020 ? 'X-RAY DIFFRACTION' ? r_gen_planes_other 196 0.001 0.020 ? 'X-RAY DIFFRACTION' ? r_nbd_refined 201 0.232 0.200 ? 'X-RAY DIFFRACTION' ? r_nbd_other 646 0.189 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 474 0.181 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_other 502 0.084 0.200 ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 42 0.148 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 5 0.121 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 43 0.241 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 5 0.094 0.200 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 673 1.150 1.500 ? 'X-RAY DIFFRACTION' ? r_mcbond_other 247 0.271 1.500 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1010 1.501 2.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 394 2.369 3.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 329 3.161 4.500 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 1.700 _refine_ls_shell.d_res_low 1.744 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 97.830 _refine_ls_shell.number_reflns_R_work 854 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.302 _refine_ls_shell.R_factor_R_free 0.311 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 48 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 902 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3E9V _struct.title 'Crystal structure of human B-cell Translocation Gene 2 (BTG2)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3E9V _struct_keywords.text ;B-cell Translocation Gene 2, BTG2, STRUCTURAL GENOMICS, PSI-2, PROTEIN STRUCTURE INITIATIVE, NEW YORK STRUCTURAL GENOMIX RESEARCH CONSORTIUM, NYSGXRC, Transcription, Transcription regulation, New York SGX Research Center for Structural Genomics, transcription regulator, ANTIPROLIFERATIVE PROTEIN, TUMOUR SUPRESSOR ; _struct_keywords.pdbx_keywords 'transcription regulator' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BTG2_HUMAN _struct_ref.pdbx_db_accession P78543 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGL SQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAP ; _struct_ref.pdbx_align_begin 8 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3E9V _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 120 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P78543 _struct_ref_seq.db_align_beg 8 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 127 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 9 _struct_ref_seq.pdbx_auth_seq_align_end 128 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 MSE A 2 ? GLY A 21 ? MSE A 10 GLY A 29 1 ? 20 HELX_P HELX_P2 2 SER A 24 ? LYS A 44 ? SER A 32 LYS A 52 1 ? 21 HELX_P HELX_P3 3 GLY A 55 ? CYS A 60 ? GLY A 63 CYS A 68 1 ? 6 HELX_P HELX_P4 4 ASP A 68 ? ILE A 78 ? ASP A 76 ILE A 86 1 ? 11 HELX_P HELX_P5 5 SER A 81 ? LEU A 89 ? SER A 89 LEU A 97 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASP 1 C ? ? ? 1_555 A MSE 2 N ? ? A ASP 9 A MSE 10 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale2 covale both ? A MSE 2 C ? ? ? 1_555 A LEU 3 N ? ? A MSE 10 A LEU 11 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale3 covale both ? A LYS 66 C ? ? ? 1_555 A MSE 67 N ? ? A LYS 74 A MSE 75 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale4 covale both ? A MSE 67 C ? ? ? 1_555 A ASP 68 N ? ? A MSE 75 A ASP 76 1_555 ? ? ? ? ? ? ? 1.332 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 2 ? . . . . MSE A 10 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 67 ? . . . . MSE A 75 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 61 ? ARG A 62 ? ILE A 69 ARG A 70 A 2 LEU A 93 ? ASP A 98 ? LEU A 101 ASP A 106 A 3 GLU A 101 ? ILE A 106 ? GLU A 109 ILE A 114 A 4 ILE A 112 ? GLU A 117 ? ILE A 120 GLU A 125 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 61 ? N ILE A 69 O LEU A 95 ? O LEU A 103 A 2 3 N TRP A 96 ? N TRP A 104 O SER A 103 ? O SER A 111 A 3 4 N TYR A 104 ? N TYR A 112 O CYS A 113 ? O CYS A 121 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A EDO 1 ? 7 'BINDING SITE FOR RESIDUE EDO A 1' AC2 Software A EDO 2 ? 4 'BINDING SITE FOR RESIDUE EDO A 2' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 HIS A 42 ? HIS A 50 . ? 1_555 ? 2 AC1 7 TYR A 58 ? TYR A 66 . ? 1_555 ? 3 AC1 7 ARG A 59 ? ARG A 67 . ? 1_555 ? 4 AC1 7 CYS A 60 ? CYS A 68 . ? 1_555 ? 5 AC1 7 ASP A 68 ? ASP A 76 . ? 1_555 ? 6 AC1 7 ILE A 70 ? ILE A 78 . ? 1_555 ? 7 AC1 7 HOH D . ? HOH A 190 . ? 1_555 ? 8 AC2 4 GLY A 33 ? GLY A 41 . ? 1_555 ? 9 AC2 4 GLU A 37 ? GLU A 45 . ? 1_555 ? 10 AC2 4 LYS A 51 ? LYS A 59 . ? 4_555 ? 11 AC2 4 HOH D . ? HOH A 185 . ? 1_555 ? # _pdbx_entry_details.entry_id 3E9V _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 58 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 173 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MSE A 10 ? ? 80.06 -29.15 2 1 ASN A 72 ? ? -129.34 -133.89 3 1 TYR A 108 ? ? 77.29 -0.78 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'New York SGX Research Center for Structural Genomics' _pdbx_SG_project.initial_of_center NYSGXRC # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 2 A MSE 10 ? MET SELENOMETHIONINE 2 A MSE 67 A MSE 75 ? MET SELENOMETHIONINE # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MSE N N N N 240 MSE CA C N S 241 MSE C C N N 242 MSE O O N N 243 MSE OXT O N N 244 MSE CB C N N 245 MSE CG C N N 246 MSE SE SE N N 247 MSE CE C N N 248 MSE H H N N 249 MSE H2 H N N 250 MSE HA H N N 251 MSE HXT H N N 252 MSE HB2 H N N 253 MSE HB3 H N N 254 MSE HG2 H N N 255 MSE HG3 H N N 256 MSE HE1 H N N 257 MSE HE2 H N N 258 MSE HE3 H N N 259 PHE N N N N 260 PHE CA C N S 261 PHE C C N N 262 PHE O O N N 263 PHE CB C N N 264 PHE CG C Y N 265 PHE CD1 C Y N 266 PHE CD2 C Y N 267 PHE CE1 C Y N 268 PHE CE2 C Y N 269 PHE CZ C Y N 270 PHE OXT O N N 271 PHE H H N N 272 PHE H2 H N N 273 PHE HA H N N 274 PHE HB2 H N N 275 PHE HB3 H N N 276 PHE HD1 H N N 277 PHE HD2 H N N 278 PHE HE1 H N N 279 PHE HE2 H N N 280 PHE HZ H N N 281 PHE HXT H N N 282 PRO N N N N 283 PRO CA C N S 284 PRO C C N N 285 PRO O O N N 286 PRO CB C N N 287 PRO CG C N N 288 PRO CD C N N 289 PRO OXT O N N 290 PRO H H N N 291 PRO HA H N N 292 PRO HB2 H N N 293 PRO HB3 H N N 294 PRO HG2 H N N 295 PRO HG3 H N N 296 PRO HD2 H N N 297 PRO HD3 H N N 298 PRO HXT H N N 299 SER N N N N 300 SER CA C N S 301 SER C C N N 302 SER O O N N 303 SER CB C N N 304 SER OG O N N 305 SER OXT O N N 306 SER H H N N 307 SER H2 H N N 308 SER HA H N N 309 SER HB2 H N N 310 SER HB3 H N N 311 SER HG H N N 312 SER HXT H N N 313 THR N N N N 314 THR CA C N S 315 THR C C N N 316 THR O O N N 317 THR CB C N R 318 THR OG1 O N N 319 THR CG2 C N N 320 THR OXT O N N 321 THR H H N N 322 THR H2 H N N 323 THR HA H N N 324 THR HB H N N 325 THR HG1 H N N 326 THR HG21 H N N 327 THR HG22 H N N 328 THR HG23 H N N 329 THR HXT H N N 330 TRP N N N N 331 TRP CA C N S 332 TRP C C N N 333 TRP O O N N 334 TRP CB C N N 335 TRP CG C Y N 336 TRP CD1 C Y N 337 TRP CD2 C Y N 338 TRP NE1 N Y N 339 TRP CE2 C Y N 340 TRP CE3 C Y N 341 TRP CZ2 C Y N 342 TRP CZ3 C Y N 343 TRP CH2 C Y N 344 TRP OXT O N N 345 TRP H H N N 346 TRP H2 H N N 347 TRP HA H N N 348 TRP HB2 H N N 349 TRP HB3 H N N 350 TRP HD1 H N N 351 TRP HE1 H N N 352 TRP HE3 H N N 353 TRP HZ2 H N N 354 TRP HZ3 H N N 355 TRP HH2 H N N 356 TRP HXT H N N 357 TYR N N N N 358 TYR CA C N S 359 TYR C C N N 360 TYR O O N N 361 TYR CB C N N 362 TYR CG C Y N 363 TYR CD1 C Y N 364 TYR CD2 C Y N 365 TYR CE1 C Y N 366 TYR CE2 C Y N 367 TYR CZ C Y N 368 TYR OH O N N 369 TYR OXT O N N 370 TYR H H N N 371 TYR H2 H N N 372 TYR HA H N N 373 TYR HB2 H N N 374 TYR HB3 H N N 375 TYR HD1 H N N 376 TYR HD2 H N N 377 TYR HE1 H N N 378 TYR HE2 H N N 379 TYR HH H N N 380 TYR HXT H N N 381 VAL N N N N 382 VAL CA C N S 383 VAL C C N N 384 VAL O O N N 385 VAL CB C N N 386 VAL CG1 C N N 387 VAL CG2 C N N 388 VAL OXT O N N 389 VAL H H N N 390 VAL H2 H N N 391 VAL HA H N N 392 VAL HB H N N 393 VAL HG11 H N N 394 VAL HG12 H N N 395 VAL HG13 H N N 396 VAL HG21 H N N 397 VAL HG22 H N N 398 VAL HG23 H N N 399 VAL HXT H N N 400 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MSE N CA sing N N 227 MSE N H sing N N 228 MSE N H2 sing N N 229 MSE CA C sing N N 230 MSE CA CB sing N N 231 MSE CA HA sing N N 232 MSE C O doub N N 233 MSE C OXT sing N N 234 MSE OXT HXT sing N N 235 MSE CB CG sing N N 236 MSE CB HB2 sing N N 237 MSE CB HB3 sing N N 238 MSE CG SE sing N N 239 MSE CG HG2 sing N N 240 MSE CG HG3 sing N N 241 MSE SE CE sing N N 242 MSE CE HE1 sing N N 243 MSE CE HE2 sing N N 244 MSE CE HE3 sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 SER N CA sing N N 286 SER N H sing N N 287 SER N H2 sing N N 288 SER CA C sing N N 289 SER CA CB sing N N 290 SER CA HA sing N N 291 SER C O doub N N 292 SER C OXT sing N N 293 SER CB OG sing N N 294 SER CB HB2 sing N N 295 SER CB HB3 sing N N 296 SER OG HG sing N N 297 SER OXT HXT sing N N 298 THR N CA sing N N 299 THR N H sing N N 300 THR N H2 sing N N 301 THR CA C sing N N 302 THR CA CB sing N N 303 THR CA HA sing N N 304 THR C O doub N N 305 THR C OXT sing N N 306 THR CB OG1 sing N N 307 THR CB CG2 sing N N 308 THR CB HB sing N N 309 THR OG1 HG1 sing N N 310 THR CG2 HG21 sing N N 311 THR CG2 HG22 sing N N 312 THR CG2 HG23 sing N N 313 THR OXT HXT sing N N 314 TRP N CA sing N N 315 TRP N H sing N N 316 TRP N H2 sing N N 317 TRP CA C sing N N 318 TRP CA CB sing N N 319 TRP CA HA sing N N 320 TRP C O doub N N 321 TRP C OXT sing N N 322 TRP CB CG sing N N 323 TRP CB HB2 sing N N 324 TRP CB HB3 sing N N 325 TRP CG CD1 doub Y N 326 TRP CG CD2 sing Y N 327 TRP CD1 NE1 sing Y N 328 TRP CD1 HD1 sing N N 329 TRP CD2 CE2 doub Y N 330 TRP CD2 CE3 sing Y N 331 TRP NE1 CE2 sing Y N 332 TRP NE1 HE1 sing N N 333 TRP CE2 CZ2 sing Y N 334 TRP CE3 CZ3 doub Y N 335 TRP CE3 HE3 sing N N 336 TRP CZ2 CH2 doub Y N 337 TRP CZ2 HZ2 sing N N 338 TRP CZ3 CH2 sing Y N 339 TRP CZ3 HZ3 sing N N 340 TRP CH2 HH2 sing N N 341 TRP OXT HXT sing N N 342 TYR N CA sing N N 343 TYR N H sing N N 344 TYR N H2 sing N N 345 TYR CA C sing N N 346 TYR CA CB sing N N 347 TYR CA HA sing N N 348 TYR C O doub N N 349 TYR C OXT sing N N 350 TYR CB CG sing N N 351 TYR CB HB2 sing N N 352 TYR CB HB3 sing N N 353 TYR CG CD1 doub Y N 354 TYR CG CD2 sing Y N 355 TYR CD1 CE1 sing Y N 356 TYR CD1 HD1 sing N N 357 TYR CD2 CE2 doub Y N 358 TYR CD2 HD2 sing N N 359 TYR CE1 CZ doub Y N 360 TYR CE1 HE1 sing N N 361 TYR CE2 CZ sing Y N 362 TYR CE2 HE2 sing N N 363 TYR CZ OH sing N N 364 TYR OH HH sing N N 365 TYR OXT HXT sing N N 366 VAL N CA sing N N 367 VAL N H sing N N 368 VAL N H2 sing N N 369 VAL CA C sing N N 370 VAL CA CB sing N N 371 VAL CA HA sing N N 372 VAL C O doub N N 373 VAL C OXT sing N N 374 VAL CB CG1 sing N N 375 VAL CB CG2 sing N N 376 VAL CB HB sing N N 377 VAL CG1 HG11 sing N N 378 VAL CG1 HG12 sing N N 379 VAL CG1 HG13 sing N N 380 VAL CG2 HG21 sing N N 381 VAL CG2 HG22 sing N N 382 VAL CG2 HG23 sing N N 383 VAL OXT HXT sing N N 384 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2D5R _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 3E9V _atom_sites.fract_transf_matrix[1][1] 0.025294 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.024377 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014566 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S SE # loop_ #