data_3ELI # _entry.id 3ELI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3ELI RCSB RCSB049472 WWPDB D_1000049472 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id SiR160 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3ELI _pdbx_database_status.recvd_initial_deposition_date 2008-09-22 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Forouhar, F.' 1 'Su, M.' 2 'Seetharaman, J.' 3 'Janjua, H.' 4 'Xiao, R.' 5 'Ciccosanti, C.' 6 'Foote, E.L.' 7 'Wang, D.' 8 'Tong, S.' 9 'Everett, J.K.' 10 'Acton, T.B.' 11 'Montelione, G.T.' 12 'Hunt, J.F.' 13 'Tong, L.' 14 'Northeast Structural Genomics Consortium (NESG)' 15 # _citation.id primary _citation.title 'Crystal structure of the AHSA1 (SPO3351) protein from Silicibacter pomeroyi, Northeast Structural Genomics Consortium Target SiR160' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Forouhar, F.' 1 primary 'Su, M.' 2 primary 'Seetharaman, J.' 3 primary 'Janjua, H.' 4 primary 'Xiao, R.' 5 primary 'Ciccosanti, C.' 6 primary 'Foote, E.L.' 7 primary 'Wang, D.' 8 primary 'Tong, S.' 9 primary 'Everett, J.K.' 10 primary 'Acton, T.B.' 11 primary 'Montelione, G.T.' 12 primary 'Hunt, J.F.' 13 primary 'Tong, L.' 14 # _cell.entry_id 3ELI _cell.length_a 73.348 _cell.length_b 73.348 _cell.length_c 91.891 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3ELI _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Aha1 domain protein' 17585.045 1 ? ? ? ? 2 water nat water 18.015 10 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name AHSA1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)ADLRLEREFAVAPEALFAWVSDGAKLLQWWGPEGLHVPADQHDLDFTRLGPWFSV(MSE)VNGEGQRYKVSGQVT HVKPPQSVGFTWGWHDDDDRRGAESHV(MSE)FIVEPCAKGARLILDHRELGDDE(MSE)SLRHEEGWTSSLRKLAAELA LEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MADLRLEREFAVAPEALFAWVSDGAKLLQWWGPEGLHVPADQHDLDFTRLGPWFSVMVNGEGQRYKVSGQVTHVKPPQSV GFTWGWHDDDDRRGAESHVMFIVEPCAKGARLILDHRELGDDEMSLRHEEGWTSSLRKLAAELALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SiR160 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ALA n 1 3 ASP n 1 4 LEU n 1 5 ARG n 1 6 LEU n 1 7 GLU n 1 8 ARG n 1 9 GLU n 1 10 PHE n 1 11 ALA n 1 12 VAL n 1 13 ALA n 1 14 PRO n 1 15 GLU n 1 16 ALA n 1 17 LEU n 1 18 PHE n 1 19 ALA n 1 20 TRP n 1 21 VAL n 1 22 SER n 1 23 ASP n 1 24 GLY n 1 25 ALA n 1 26 LYS n 1 27 LEU n 1 28 LEU n 1 29 GLN n 1 30 TRP n 1 31 TRP n 1 32 GLY n 1 33 PRO n 1 34 GLU n 1 35 GLY n 1 36 LEU n 1 37 HIS n 1 38 VAL n 1 39 PRO n 1 40 ALA n 1 41 ASP n 1 42 GLN n 1 43 HIS n 1 44 ASP n 1 45 LEU n 1 46 ASP n 1 47 PHE n 1 48 THR n 1 49 ARG n 1 50 LEU n 1 51 GLY n 1 52 PRO n 1 53 TRP n 1 54 PHE n 1 55 SER n 1 56 VAL n 1 57 MSE n 1 58 VAL n 1 59 ASN n 1 60 GLY n 1 61 GLU n 1 62 GLY n 1 63 GLN n 1 64 ARG n 1 65 TYR n 1 66 LYS n 1 67 VAL n 1 68 SER n 1 69 GLY n 1 70 GLN n 1 71 VAL n 1 72 THR n 1 73 HIS n 1 74 VAL n 1 75 LYS n 1 76 PRO n 1 77 PRO n 1 78 GLN n 1 79 SER n 1 80 VAL n 1 81 GLY n 1 82 PHE n 1 83 THR n 1 84 TRP n 1 85 GLY n 1 86 TRP n 1 87 HIS n 1 88 ASP n 1 89 ASP n 1 90 ASP n 1 91 ASP n 1 92 ARG n 1 93 ARG n 1 94 GLY n 1 95 ALA n 1 96 GLU n 1 97 SER n 1 98 HIS n 1 99 VAL n 1 100 MSE n 1 101 PHE n 1 102 ILE n 1 103 VAL n 1 104 GLU n 1 105 PRO n 1 106 CYS n 1 107 ALA n 1 108 LYS n 1 109 GLY n 1 110 ALA n 1 111 ARG n 1 112 LEU n 1 113 ILE n 1 114 LEU n 1 115 ASP n 1 116 HIS n 1 117 ARG n 1 118 GLU n 1 119 LEU n 1 120 GLY n 1 121 ASP n 1 122 ASP n 1 123 GLU n 1 124 MSE n 1 125 SER n 1 126 LEU n 1 127 ARG n 1 128 HIS n 1 129 GLU n 1 130 GLU n 1 131 GLY n 1 132 TRP n 1 133 THR n 1 134 SER n 1 135 SER n 1 136 LEU n 1 137 ARG n 1 138 LYS n 1 139 LEU n 1 140 ALA n 1 141 ALA n 1 142 GLU n 1 143 LEU n 1 144 ALA n 1 145 LEU n 1 146 GLU n 1 147 HIS n 1 148 HIS n 1 149 HIS n 1 150 HIS n 1 151 HIS n 1 152 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SPO3351 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain DSS-3 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Silicibacter pomeroyi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 89184 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5LN61_SILPO _struct_ref.pdbx_db_accession Q5LN61 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MADLRLEREFAVAPEALFAWVSDGAKLLQWWGPEGLHVPADQHDLDFTRLGPWFSVMVNGEGQRYKVSGQVTHVKPPQSV GFTWGWHDDDDRRGAESHVMFIVEPCAKGARLILDHRELGDDEMSLRHEEGWTSSLRKLAAELA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3ELI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 144 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5LN61 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 144 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 144 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3ELI LEU A 145 ? UNP Q5LN61 ? ? 'expression tag' 145 1 1 3ELI GLU A 146 ? UNP Q5LN61 ? ? 'expression tag' 146 2 1 3ELI HIS A 147 ? UNP Q5LN61 ? ? 'expression tag' 147 3 1 3ELI HIS A 148 ? UNP Q5LN61 ? ? 'expression tag' 148 4 1 3ELI HIS A 149 ? UNP Q5LN61 ? ? 'expression tag' 149 5 1 3ELI HIS A 150 ? UNP Q5LN61 ? ? 'expression tag' 150 6 1 3ELI HIS A 151 ? UNP Q5LN61 ? ? 'expression tag' 151 7 1 3ELI HIS A 152 ? UNP Q5LN61 ? ? 'expression tag' 152 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3ELI _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.51 _exptl_crystal.density_percent_sol 65.00 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details ;Protein solution: 10 mM Tris (pH 7.5), 100 mM sodium chloride, and 5 mM DTT. Reservoir solution: 100 mM TAPS (pH 9) and 8.64 M potassium acetate. VAPOR DIFFUSION, HANGING DROP. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MAR CCD 165 mm' _diffrn_detector.pdbx_collection_date 2008-08-19 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97845 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4C' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4C _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97845 # _reflns.entry_id 3ELI _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 30 _reflns.d_resolution_high 2.8 _reflns.number_obs 11776 _reflns.number_all 11787 _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.147 _reflns.pdbx_Rsym_value 0.117 _reflns.pdbx_netI_over_sigmaI 21.7 _reflns.B_iso_Wilson_estimate 53.0 _reflns.pdbx_redundancy 13.8 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.8 _reflns_shell.d_res_low 2.9 _reflns_shell.percent_possible_all 99.1 _reflns_shell.Rmerge_I_obs 0.581 _reflns_shell.pdbx_Rsym_value 0.368 _reflns_shell.meanI_over_sigI_obs 2.2 _reflns_shell.pdbx_redundancy 8.2 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1164 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3ELI _refine.ls_number_reflns_obs 9335 _refine.ls_number_reflns_all 11756 _refine.pdbx_ls_sigma_I 2.0 _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 192372.42 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.86 _refine.ls_d_res_high 2.80 _refine.ls_percent_reflns_obs 79.4 _refine.ls_R_factor_obs 0.217 _refine.ls_R_factor_all 0.218 _refine.ls_R_factor_R_work 0.217 _refine.ls_R_factor_R_free 0.265 _refine.ls_R_factor_R_free_error 0.012 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.2 _refine.ls_number_reflns_R_free 484 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 63.6 _refine.aniso_B[1][1] 15.48 _refine.aniso_B[2][2] 15.48 _refine.aniso_B[3][3] -30.95 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.4 _refine.solvent_model_param_bsol 51.6233 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3ELI _refine_analyze.Luzzati_coordinate_error_obs 0.33 _refine_analyze.Luzzati_sigma_a_obs 0.41 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.46 _refine_analyze.Luzzati_sigma_a_free 0.52 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1156 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 1166 _refine_hist.d_res_high 2.80 _refine_hist.d_res_low 19.86 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.3 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 25.4 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 1.00 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.d_res_high 2.80 _refine_ls_shell.d_res_low 2.90 _refine_ls_shell.number_reflns_R_work 443 _refine_ls_shell.R_factor_R_work 0.277 _refine_ls_shell.percent_reflns_obs 40.3 _refine_ls_shell.R_factor_R_free 0.353 _refine_ls_shell.R_factor_R_free_error 0.066 _refine_ls_shell.percent_reflns_R_free 6.1 _refine_ls_shell.number_reflns_R_free 29 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 443 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3ELI _struct.title 'Crystal structure of the AHSA1 (SPO3351) protein from Silicibacter pomeroyi, Northeast Structural Genomics Consortium Target SiR160' _struct.pdbx_descriptor 'Aha1 domain protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3ELI _struct_keywords.pdbx_keywords 'structural genomics, unknown function' _struct_keywords.text ;alpha-beta protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, unknown function ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 13 ? VAL A 21 ? ALA A 13 VAL A 21 1 ? 9 HELX_P HELX_P2 2 ASP A 23 ? TRP A 31 ? ASP A 23 TRP A 31 1 ? 9 HELX_P HELX_P3 3 ASP A 121 ? LEU A 145 ? ASP A 121 LEU A 145 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A VAL 56 C ? ? ? 1_555 A MSE 57 N ? ? A VAL 56 A MSE 57 1_555 ? ? ? ? ? ? ? 1.321 ? covale2 covale ? ? A MSE 57 C ? ? ? 1_555 A VAL 58 N ? ? A MSE 57 A VAL 58 1_555 ? ? ? ? ? ? ? 1.321 ? covale3 covale ? ? A VAL 99 C ? ? ? 1_555 A MSE 100 N ? ? A VAL 99 A MSE 100 1_555 ? ? ? ? ? ? ? 1.328 ? covale4 covale ? ? A MSE 100 C ? ? ? 1_555 A PHE 101 N ? ? A MSE 100 A PHE 101 1_555 ? ? ? ? ? ? ? 1.328 ? covale5 covale ? ? A GLU 123 C ? ? ? 1_555 A MSE 124 N ? ? A GLU 123 A MSE 124 1_555 ? ? ? ? ? ? ? 1.330 ? covale6 covale ? ? A MSE 124 C ? ? ? 1_555 A SER 125 N ? ? A MSE 124 A SER 125 1_555 ? ? ? ? ? ? ? 1.333 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASP A 3 ? PHE A 10 ? ASP A 3 PHE A 10 A 2 ALA A 110 ? ARG A 117 ? ALA A 110 ARG A 117 A 3 ARG A 93 ? ILE A 102 ? ARG A 93 ILE A 102 A 4 SER A 79 ? HIS A 87 ? SER A 79 HIS A 87 A 5 ARG A 64 ? LYS A 75 ? ARG A 64 LYS A 75 A 6 GLY A 51 ? VAL A 58 ? GLY A 51 VAL A 58 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 6 ? N LEU A 6 O LEU A 114 ? O LEU A 114 A 2 3 O ILE A 113 ? O ILE A 113 N ILE A 102 ? N ILE A 102 A 3 4 O VAL A 99 ? O VAL A 99 N PHE A 82 ? N PHE A 82 A 4 5 O GLY A 85 ? O GLY A 85 N SER A 68 ? N SER A 68 A 5 6 O TYR A 65 ? O TYR A 65 N MSE A 57 ? N MSE A 57 # _database_PDB_matrix.entry_id 3ELI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3ELI _atom_sites.fract_transf_matrix[1][1] 0.013634 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013634 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010882 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 TRP 53 53 53 TRP TRP A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 MSE 57 57 57 MSE MSE A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 TRP 84 84 84 TRP TRP A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 TRP 86 86 86 TRP TRP A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 MSE 100 100 100 MSE MSE A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 CYS 106 106 106 CYS CYS A . n A 1 107 ALA 107 107 ? ? ? A . n A 1 108 LYS 108 108 ? ? ? A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 MSE 124 124 124 MSE MSE A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 TRP 132 132 132 TRP TRP A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 SER 135 135 135 SER SER A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 HIS 148 148 ? ? ? A . n A 1 149 HIS 149 149 ? ? ? A . n A 1 150 HIS 150 150 ? ? ? A . n A 1 151 HIS 151 151 ? ? ? A . n A 1 152 HIS 152 152 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 153 1 HOH HOH A . B 2 HOH 2 154 2 HOH HOH A . B 2 HOH 3 155 3 HOH HOH A . B 2 HOH 4 156 4 HOH HOH A . B 2 HOH 5 157 5 HOH HOH A . B 2 HOH 6 158 6 HOH HOH A . B 2 HOH 7 159 7 HOH HOH A . B 2 HOH 8 160 8 HOH HOH A . B 2 HOH 9 161 9 HOH HOH A . B 2 HOH 10 162 10 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 57 A MSE 57 ? MET SELENOMETHIONINE 2 A MSE 100 A MSE 100 ? MET SELENOMETHIONINE 3 A MSE 124 A MSE 124 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-09-30 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal ADSC 'data collection' Quantum ? 1 SHELX 'model building' 'then SOLVE/RESOLVE' ? 2 CNS refinement '1.2 & XtalView' ? 3 HKL-2000 'data reduction' . ? 4 SCALEPACK 'data scaling' . ? 5 SHELX phasing 'then SOLVE/RESOLVE' ? 6 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 11 ? ? -79.62 44.57 2 1 SER A 22 ? ? -133.23 -32.52 3 1 LEU A 28 ? ? -60.40 0.19 4 1 ASP A 44 ? ? -149.21 50.67 5 1 ASP A 46 ? ? -169.96 116.84 6 1 SER A 55 ? ? -173.28 125.02 7 1 PRO A 76 ? ? -8.12 -59.48 8 1 GLN A 78 ? ? -63.79 -77.74 9 1 ASP A 88 ? ? -67.23 -177.17 10 1 VAL A 103 ? ? -88.31 -107.60 11 1 GLU A 104 ? ? 90.70 106.93 12 1 PRO A 105 ? ? -69.31 -178.90 13 1 ALA A 110 ? ? -174.07 142.21 14 1 ASP A 121 ? ? -171.29 -152.49 15 1 LEU A 126 ? ? -90.18 -60.92 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A ALA 107 ? A ALA 107 3 1 Y 1 A LYS 108 ? A LYS 108 4 1 Y 1 A HIS 148 ? A HIS 148 5 1 Y 1 A HIS 149 ? A HIS 149 6 1 Y 1 A HIS 150 ? A HIS 150 7 1 Y 1 A HIS 151 ? A HIS 151 8 1 Y 1 A HIS 152 ? A HIS 152 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #