data_3FF4 # _entry.id 3FF4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3FF4 RCSB RCSB050512 WWPDB D_1000050512 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id APC62842 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3FF4 _pdbx_database_status.recvd_initial_deposition_date 2008-12-01 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chang, C.' 1 'Volkart, L.' 2 'Buck, K.' 3 'Joachimiak, A.' 4 'Midwest Center for Structural Genomics (MCSG)' 5 # _citation.id primary _citation.title 'Crystal structure of uncharacterized protein CHU_1412' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Chang, C.' 1 primary 'Volkart, L.' 2 primary 'Buck, K.' 3 primary 'Joachimiak, A.' 4 # _cell.entry_id 3FF4 _cell.length_a 73.535 _cell.length_b 73.535 _cell.length_c 59.433 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3FF4 _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'uncharacterized protein' 13654.319 1 ? ? ? ? 2 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 1 ? ? ? ? 3 water nat water 18.015 65 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SNA(MSE)KKTLILGATPETNRYAYLAAERLKSHGHEFIPVGRKKGEVLGKTIINERPVIEGVDTVTLYINPQNQLSEYN YILSLKPKRVIFNPGTENEELEEILSENGIEPVIGCTLV(MSE)LSAGTF ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAMKKTLILGATPETNRYAYLAAERLKSHGHEFIPVGRKKGEVLGKTIINERPVIEGVDTVTLYINPQNQLSEYNYILS LKPKRVIFNPGTENEELEEILSENGIEPVIGCTLVMLSAGTF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier APC62842 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 MSE n 1 5 LYS n 1 6 LYS n 1 7 THR n 1 8 LEU n 1 9 ILE n 1 10 LEU n 1 11 GLY n 1 12 ALA n 1 13 THR n 1 14 PRO n 1 15 GLU n 1 16 THR n 1 17 ASN n 1 18 ARG n 1 19 TYR n 1 20 ALA n 1 21 TYR n 1 22 LEU n 1 23 ALA n 1 24 ALA n 1 25 GLU n 1 26 ARG n 1 27 LEU n 1 28 LYS n 1 29 SER n 1 30 HIS n 1 31 GLY n 1 32 HIS n 1 33 GLU n 1 34 PHE n 1 35 ILE n 1 36 PRO n 1 37 VAL n 1 38 GLY n 1 39 ARG n 1 40 LYS n 1 41 LYS n 1 42 GLY n 1 43 GLU n 1 44 VAL n 1 45 LEU n 1 46 GLY n 1 47 LYS n 1 48 THR n 1 49 ILE n 1 50 ILE n 1 51 ASN n 1 52 GLU n 1 53 ARG n 1 54 PRO n 1 55 VAL n 1 56 ILE n 1 57 GLU n 1 58 GLY n 1 59 VAL n 1 60 ASP n 1 61 THR n 1 62 VAL n 1 63 THR n 1 64 LEU n 1 65 TYR n 1 66 ILE n 1 67 ASN n 1 68 PRO n 1 69 GLN n 1 70 ASN n 1 71 GLN n 1 72 LEU n 1 73 SER n 1 74 GLU n 1 75 TYR n 1 76 ASN n 1 77 TYR n 1 78 ILE n 1 79 LEU n 1 80 SER n 1 81 LEU n 1 82 LYS n 1 83 PRO n 1 84 LYS n 1 85 ARG n 1 86 VAL n 1 87 ILE n 1 88 PHE n 1 89 ASN n 1 90 PRO n 1 91 GLY n 1 92 THR n 1 93 GLU n 1 94 ASN n 1 95 GLU n 1 96 GLU n 1 97 LEU n 1 98 GLU n 1 99 GLU n 1 100 ILE n 1 101 LEU n 1 102 SER n 1 103 GLU n 1 104 ASN n 1 105 GLY n 1 106 ILE n 1 107 GLU n 1 108 PRO n 1 109 VAL n 1 110 ILE n 1 111 GLY n 1 112 CYS n 1 113 THR n 1 114 LEU n 1 115 VAL n 1 116 MSE n 1 117 LEU n 1 118 SER n 1 119 ALA n 1 120 GLY n 1 121 THR n 1 122 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CHU_1412 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Cytophaga hutchinsonii ATCC 33406' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 269798 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 33406 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMCSG7 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q11V83_CYTH3 _struct_ref.pdbx_db_accession Q11V83 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKKTLILGATPETNRYAYLAAERLKSHGHEFIPVGRKKGEVLGKTIINERPVIEGVDTVTLYINPQNQLSEYNYILSLKP KRVIFNPGTENEELEEILSENGIEPVIGCTLVMLSAGTF ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3FF4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 122 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q11V83 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 119 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 119 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3FF4 SER A 1 ? UNP Q11V83 ? ? 'expression tag' -2 1 1 3FF4 ASN A 2 ? UNP Q11V83 ? ? 'expression tag' -1 2 1 3FF4 ALA A 3 ? UNP Q11V83 ? ? 'expression tag' 0 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3FF4 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.40 _exptl_crystal.density_percent_sol 63.79 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details '20% PEG 8K, 0.1 M HEPES pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2008-11-26 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'double crystal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97924 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97924 # _reflns.entry_id 3FF4 _reflns.observed_criterion_sigma_I -3 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.1 _reflns.number_obs 10728 _reflns.number_all 10737 _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.082 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 49.64 _reflns.B_iso_Wilson_estimate 40.966 _reflns.pdbx_redundancy 14.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.1 _reflns_shell.d_res_low 2.12 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.920 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.38 _reflns_shell.pdbx_redundancy 15.0 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 262 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3FF4 _refine.ls_number_reflns_obs 10584 _refine.ls_number_reflns_all 10584 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50 _refine.ls_d_res_high 2.10 _refine.ls_percent_reflns_obs 98.79 _refine.ls_R_factor_obs 0.18003 _refine.ls_R_factor_all 0.18003 _refine.ls_R_factor_R_work 0.17909 _refine.ls_R_factor_R_free 0.19826 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 505 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.965 _refine.correlation_coeff_Fo_to_Fc_free 0.965 _refine.B_iso_mean 31.107 _refine.aniso_B[1][1] -0.08 _refine.aniso_B[2][2] -0.08 _refine.aniso_B[3][3] 0.12 _refine.aniso_B[1][2] -0.04 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.165 _refine.pdbx_overall_ESU_R_Free 0.139 _refine.overall_SU_ML 0.108 _refine.overall_SU_B 9.053 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 947 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.number_atoms_solvent 65 _refine_hist.number_atoms_total 1019 _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 50 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.015 0.022 ? 1028 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.404 1.995 ? 1398 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.443 5.000 ? 132 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 39.235 25.217 ? 46 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 16.198 15.000 ? 188 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 18.691 15.000 ? 6 'X-RAY DIFFRACTION' ? r_chiral_restr 0.089 0.200 ? 158 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.021 ? 783 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.718 1.500 ? 638 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.264 2.000 ? 1046 'X-RAY DIFFRACTION' ? r_scbond_it 2.036 3.000 ? 390 'X-RAY DIFFRACTION' ? r_scangle_it 3.082 4.500 ? 352 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.103 _refine_ls_shell.d_res_low 2.158 _refine_ls_shell.number_reflns_R_work 742 _refine_ls_shell.R_factor_R_work 0.179 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.R_factor_R_free 0.258 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 47 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 789 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3FF4 _struct.title 'Crystal structure of uncharacterized protein CHU_1412' _struct.pdbx_descriptor 'uncharacterized protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3FF4 _struct_keywords.pdbx_keywords 'structural genomics, unknown function' _struct_keywords.text ;structural genomics, Cytophaga hutchinsonii ATCC 33406, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 18 ? GLY A 31 ? ARG A 15 GLY A 28 1 ? 14 HELX_P HELX_P2 2 ASN A 67 ? LEU A 72 ? ASN A 64 LEU A 69 1 ? 6 HELX_P HELX_P3 3 GLU A 74 ? LYS A 82 ? GLU A 71 LYS A 79 1 ? 9 HELX_P HELX_P4 4 ASN A 94 ? ASN A 104 ? ASN A 91 ASN A 101 1 ? 11 HELX_P HELX_P5 5 CYS A 112 ? ALA A 119 ? CYS A 109 ALA A 116 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ALA 3 C ? ? ? 1_555 A MSE 4 N ? ? A ALA 0 A MSE 1 1_555 ? ? ? ? ? ? ? 1.335 ? covale2 covale ? ? A MSE 4 C ? ? ? 1_555 A LYS 5 N ? ? A MSE 1 A LYS 2 1_555 ? ? ? ? ? ? ? 1.329 ? covale3 covale ? ? A VAL 115 C ? ? ? 1_555 A MSE 116 N ? ? A VAL 112 A MSE 113 1_555 ? ? ? ? ? ? ? 1.332 ? covale4 covale ? ? A MSE 116 C ? ? ? 1_555 A LEU 117 N ? ? A MSE 113 A LEU 114 1_555 ? ? ? ? ? ? ? 1.330 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 34 ? VAL A 37 ? PHE A 31 VAL A 34 A 2 THR A 7 ? LEU A 10 ? THR A 4 LEU A 7 A 3 THR A 61 ? LEU A 64 ? THR A 58 LEU A 61 A 4 ARG A 85 ? PHE A 88 ? ARG A 82 PHE A 85 A 5 GLU A 107 ? ILE A 110 ? GLU A 104 ILE A 107 B 1 GLU A 43 ? VAL A 44 ? GLU A 40 VAL A 41 B 2 LYS A 47 ? THR A 48 ? LYS A 44 THR A 45 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 37 ? O VAL A 34 N ILE A 9 ? N ILE A 6 A 2 3 N LEU A 8 ? N LEU A 5 O THR A 63 ? O THR A 60 A 3 4 N VAL A 62 ? N VAL A 59 O ILE A 87 ? O ILE A 84 A 4 5 N PHE A 88 ? N PHE A 85 O VAL A 109 ? O VAL A 106 B 1 2 N VAL A 44 ? N VAL A 41 O LYS A 47 ? O LYS A 44 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 7 _struct_site.details 'BINDING SITE FOR RESIDUE PEG A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 GLY A 111 ? GLY A 108 . ? 1_555 ? 2 AC1 7 CYS A 112 ? CYS A 109 . ? 1_555 ? 3 AC1 7 VAL A 115 ? VAL A 112 . ? 1_555 ? 4 AC1 7 MSE A 116 ? MSE A 113 . ? 1_555 ? 5 AC1 7 ALA A 119 ? ALA A 116 . ? 1_555 ? 6 AC1 7 THR A 121 ? THR A 118 . ? 1_555 ? 7 AC1 7 HOH C . ? HOH A 133 . ? 1_555 ? # _database_PDB_matrix.entry_id 3FF4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3FF4 _atom_sites.fract_transf_matrix[1][1] 0.013599 _atom_sites.fract_transf_matrix[1][2] 0.007851 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015703 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016826 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 ? ? ? A . n A 1 2 ASN 2 -1 -1 ASN ASN A . n A 1 3 ALA 3 0 0 ALA ALA A . n A 1 4 MSE 4 1 1 MSE MSE A . n A 1 5 LYS 5 2 2 LYS LYS A . n A 1 6 LYS 6 3 3 LYS LYS A . n A 1 7 THR 7 4 4 THR THR A . n A 1 8 LEU 8 5 5 LEU LEU A . n A 1 9 ILE 9 6 6 ILE ILE A . n A 1 10 LEU 10 7 7 LEU LEU A . n A 1 11 GLY 11 8 8 GLY GLY A . n A 1 12 ALA 12 9 9 ALA ALA A . n A 1 13 THR 13 10 10 THR THR A . n A 1 14 PRO 14 11 11 PRO PRO A . n A 1 15 GLU 15 12 12 GLU GLU A . n A 1 16 THR 16 13 13 THR THR A . n A 1 17 ASN 17 14 14 ASN ASN A . n A 1 18 ARG 18 15 15 ARG ARG A . n A 1 19 TYR 19 16 16 TYR TYR A . n A 1 20 ALA 20 17 17 ALA ALA A . n A 1 21 TYR 21 18 18 TYR TYR A . n A 1 22 LEU 22 19 19 LEU LEU A . n A 1 23 ALA 23 20 20 ALA ALA A . n A 1 24 ALA 24 21 21 ALA ALA A . n A 1 25 GLU 25 22 22 GLU GLU A . n A 1 26 ARG 26 23 23 ARG ARG A . n A 1 27 LEU 27 24 24 LEU LEU A . n A 1 28 LYS 28 25 25 LYS LYS A . n A 1 29 SER 29 26 26 SER SER A . n A 1 30 HIS 30 27 27 HIS HIS A . n A 1 31 GLY 31 28 28 GLY GLY A . n A 1 32 HIS 32 29 29 HIS HIS A . n A 1 33 GLU 33 30 30 GLU GLU A . n A 1 34 PHE 34 31 31 PHE PHE A . n A 1 35 ILE 35 32 32 ILE ILE A . n A 1 36 PRO 36 33 33 PRO PRO A . n A 1 37 VAL 37 34 34 VAL VAL A . n A 1 38 GLY 38 35 35 GLY GLY A . n A 1 39 ARG 39 36 36 ARG ARG A . n A 1 40 LYS 40 37 37 LYS LYS A . n A 1 41 LYS 41 38 38 LYS LYS A . n A 1 42 GLY 42 39 39 GLY GLY A . n A 1 43 GLU 43 40 40 GLU GLU A . n A 1 44 VAL 44 41 41 VAL VAL A . n A 1 45 LEU 45 42 42 LEU LEU A . n A 1 46 GLY 46 43 43 GLY GLY A . n A 1 47 LYS 47 44 44 LYS LYS A . n A 1 48 THR 48 45 45 THR THR A . n A 1 49 ILE 49 46 46 ILE ILE A . n A 1 50 ILE 50 47 47 ILE ILE A . n A 1 51 ASN 51 48 48 ASN ASN A . n A 1 52 GLU 52 49 49 GLU GLU A . n A 1 53 ARG 53 50 50 ARG ARG A . n A 1 54 PRO 54 51 51 PRO PRO A . n A 1 55 VAL 55 52 52 VAL VAL A . n A 1 56 ILE 56 53 53 ILE ILE A . n A 1 57 GLU 57 54 54 GLU GLU A . n A 1 58 GLY 58 55 55 GLY GLY A . n A 1 59 VAL 59 56 56 VAL VAL A . n A 1 60 ASP 60 57 57 ASP ASP A . n A 1 61 THR 61 58 58 THR THR A . n A 1 62 VAL 62 59 59 VAL VAL A . n A 1 63 THR 63 60 60 THR THR A . n A 1 64 LEU 64 61 61 LEU LEU A . n A 1 65 TYR 65 62 62 TYR TYR A . n A 1 66 ILE 66 63 63 ILE ILE A . n A 1 67 ASN 67 64 64 ASN ASN A . n A 1 68 PRO 68 65 65 PRO PRO A . n A 1 69 GLN 69 66 66 GLN GLN A . n A 1 70 ASN 70 67 67 ASN ASN A . n A 1 71 GLN 71 68 68 GLN GLN A . n A 1 72 LEU 72 69 69 LEU LEU A . n A 1 73 SER 73 70 70 SER SER A . n A 1 74 GLU 74 71 71 GLU GLU A . n A 1 75 TYR 75 72 72 TYR TYR A . n A 1 76 ASN 76 73 73 ASN ASN A . n A 1 77 TYR 77 74 74 TYR TYR A . n A 1 78 ILE 78 75 75 ILE ILE A . n A 1 79 LEU 79 76 76 LEU LEU A . n A 1 80 SER 80 77 77 SER SER A . n A 1 81 LEU 81 78 78 LEU LEU A . n A 1 82 LYS 82 79 79 LYS LYS A . n A 1 83 PRO 83 80 80 PRO PRO A . n A 1 84 LYS 84 81 81 LYS LYS A . n A 1 85 ARG 85 82 82 ARG ARG A . n A 1 86 VAL 86 83 83 VAL VAL A . n A 1 87 ILE 87 84 84 ILE ILE A . n A 1 88 PHE 88 85 85 PHE PHE A . n A 1 89 ASN 89 86 86 ASN ASN A . n A 1 90 PRO 90 87 87 PRO PRO A . n A 1 91 GLY 91 88 88 GLY GLY A . n A 1 92 THR 92 89 89 THR THR A . n A 1 93 GLU 93 90 90 GLU GLU A . n A 1 94 ASN 94 91 91 ASN ASN A . n A 1 95 GLU 95 92 92 GLU GLU A . n A 1 96 GLU 96 93 93 GLU GLU A . n A 1 97 LEU 97 94 94 LEU LEU A . n A 1 98 GLU 98 95 95 GLU GLU A . n A 1 99 GLU 99 96 96 GLU GLU A . n A 1 100 ILE 100 97 97 ILE ILE A . n A 1 101 LEU 101 98 98 LEU LEU A . n A 1 102 SER 102 99 99 SER SER A . n A 1 103 GLU 103 100 100 GLU GLU A . n A 1 104 ASN 104 101 101 ASN ASN A . n A 1 105 GLY 105 102 102 GLY GLY A . n A 1 106 ILE 106 103 103 ILE ILE A . n A 1 107 GLU 107 104 104 GLU GLU A . n A 1 108 PRO 108 105 105 PRO PRO A . n A 1 109 VAL 109 106 106 VAL VAL A . n A 1 110 ILE 110 107 107 ILE ILE A . n A 1 111 GLY 111 108 108 GLY GLY A . n A 1 112 CYS 112 109 109 CYS CYS A . n A 1 113 THR 113 110 110 THR THR A . n A 1 114 LEU 114 111 111 LEU LEU A . n A 1 115 VAL 115 112 112 VAL VAL A . n A 1 116 MSE 116 113 113 MSE MSE A . n A 1 117 LEU 117 114 114 LEU LEU A . n A 1 118 SER 118 115 115 SER SER A . n A 1 119 ALA 119 116 116 ALA ALA A . n A 1 120 GLY 120 117 117 GLY GLY A . n A 1 121 THR 121 118 118 THR THR A . n A 1 122 PHE 122 119 119 PHE PHE A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 4 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 116 A MSE 113 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-12-16 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Refinement description' 3 2 'Structure model' 'Version format compliance' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 54.6596 18.4727 4.2521 0.0186 0.0298 0.0478 -0.0050 0.0092 0.0168 4.8684 3.3456 3.5280 0.3587 0.4872 -0.2541 0.0337 -0.0922 0.0585 -0.1932 -0.0055 -0.2099 -0.2151 -0.0821 0.2359 'X-RAY DIFFRACTION' 2 ? refined 51.6485 14.9523 6.8455 0.0275 0.0349 0.0642 -0.0073 -0.0118 0.0355 4.5928 4.7940 4.3565 0.3582 -0.4994 0.4625 0.1672 -0.0997 -0.0675 -0.3860 -0.3960 -0.0453 -0.0984 0.2301 0.0988 'X-RAY DIFFRACTION' 3 ? refined 43.8915 28.0312 1.4194 0.1285 0.0763 0.1116 0.0829 0.0038 -0.0085 3.9980 5.8176 4.5255 0.0089 1.2581 -2.1892 0.1229 -0.0265 -0.0964 -0.0136 0.4133 0.2231 0.0517 -0.5542 -0.3603 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 1 A 11 ? . . . . ? 'X-RAY DIFFRACTION' 2 1 A 29 A 35 ? . . . . ? 'X-RAY DIFFRACTION' 3 1 A 44 A 50 ? . . . . ? 'X-RAY DIFFRACTION' 4 1 A 51 A 64 ? . . . . ? 'X-RAY DIFFRACTION' 5 1 A 108 A 119 ? . . . . ? 'X-RAY DIFFRACTION' 6 2 A 12 A 28 ? . . . . ? 'X-RAY DIFFRACTION' 7 2 A 36 A 43 ? . . . . ? 'X-RAY DIFFRACTION' 8 2 A 80 A 88 ? . . . . ? 'X-RAY DIFFRACTION' 9 2 A 103 A 107 ? . . . . ? 'X-RAY DIFFRACTION' 10 3 A 65 A 79 ? . . . . ? 'X-RAY DIFFRACTION' 11 3 A 89 A 102 ? . . . . ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SBC-Collect 'data collection' . ? 1 HKL-3000 phasing . ? 2 MLPHARE phasing . ? 3 DM 'model building' . ? 4 SHELXD phasing . ? 5 RESOLVE 'model building' . ? 6 ARP/wARP 'model building' COOT ? 7 REFMAC refinement 5.5.0054 ? 8 HKL-3000 'data reduction' . ? 9 HKL-3000 'data scaling' . ? 10 DM phasing . ? 11 RESOLVE phasing . ? 12 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 128 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 184 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.18 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 NZ _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 LYS _pdbx_validate_symm_contact.auth_seq_id_1 44 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 148 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 5_665 _pdbx_validate_symm_contact.dist 2.13 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 100 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CG _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 100 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.390 _pdbx_validate_rmsd_bond.bond_target_value 1.517 _pdbx_validate_rmsd_bond.bond_deviation -0.127 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.019 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id SER _pdbx_unobs_or_zero_occ_residues.auth_seq_id -2 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id SER _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'DI(HYDROXYETHYL)ETHER' PEG 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PEG 1 201 201 PEG PEG A . C 3 HOH 1 120 1 HOH HOH A . C 3 HOH 2 121 2 HOH HOH A . C 3 HOH 3 122 3 HOH HOH A . C 3 HOH 4 123 4 HOH HOH A . C 3 HOH 5 124 5 HOH HOH A . C 3 HOH 6 125 6 HOH HOH A . C 3 HOH 7 126 7 HOH HOH A . C 3 HOH 8 127 8 HOH HOH A . C 3 HOH 9 128 9 HOH HOH A . C 3 HOH 10 129 10 HOH HOH A . C 3 HOH 11 130 11 HOH HOH A . C 3 HOH 12 131 12 HOH HOH A . C 3 HOH 13 132 13 HOH HOH A . C 3 HOH 14 133 14 HOH HOH A . C 3 HOH 15 134 15 HOH HOH A . C 3 HOH 16 135 16 HOH HOH A . C 3 HOH 17 136 17 HOH HOH A . C 3 HOH 18 137 18 HOH HOH A . C 3 HOH 19 138 19 HOH HOH A . C 3 HOH 20 139 20 HOH HOH A . C 3 HOH 21 140 21 HOH HOH A . C 3 HOH 22 141 22 HOH HOH A . C 3 HOH 23 142 23 HOH HOH A . C 3 HOH 24 143 24 HOH HOH A . C 3 HOH 25 144 25 HOH HOH A . C 3 HOH 26 145 26 HOH HOH A . C 3 HOH 27 146 27 HOH HOH A . C 3 HOH 28 147 28 HOH HOH A . C 3 HOH 29 148 29 HOH HOH A . C 3 HOH 30 149 30 HOH HOH A . C 3 HOH 31 150 31 HOH HOH A . C 3 HOH 32 151 32 HOH HOH A . C 3 HOH 33 152 33 HOH HOH A . C 3 HOH 34 153 34 HOH HOH A . C 3 HOH 35 154 35 HOH HOH A . C 3 HOH 36 155 36 HOH HOH A . C 3 HOH 37 156 37 HOH HOH A . C 3 HOH 38 157 38 HOH HOH A . C 3 HOH 39 158 39 HOH HOH A . C 3 HOH 40 159 40 HOH HOH A . C 3 HOH 41 160 41 HOH HOH A . C 3 HOH 42 161 42 HOH HOH A . C 3 HOH 43 162 43 HOH HOH A . C 3 HOH 44 163 44 HOH HOH A . C 3 HOH 45 164 45 HOH HOH A . C 3 HOH 46 165 46 HOH HOH A . C 3 HOH 47 166 47 HOH HOH A . C 3 HOH 48 167 48 HOH HOH A . C 3 HOH 49 168 49 HOH HOH A . C 3 HOH 50 169 50 HOH HOH A . C 3 HOH 51 170 51 HOH HOH A . C 3 HOH 52 171 52 HOH HOH A . C 3 HOH 53 172 53 HOH HOH A . C 3 HOH 54 173 54 HOH HOH A . C 3 HOH 55 174 55 HOH HOH A . C 3 HOH 56 175 56 HOH HOH A . C 3 HOH 57 176 57 HOH HOH A . C 3 HOH 58 177 58 HOH HOH A . C 3 HOH 59 178 59 HOH HOH A . C 3 HOH 60 179 60 HOH HOH A . C 3 HOH 61 180 61 HOH HOH A . C 3 HOH 62 181 62 HOH HOH A . C 3 HOH 63 182 63 HOH HOH A . C 3 HOH 64 183 64 HOH HOH A . C 3 HOH 65 184 65 HOH HOH A . #