data_3FYM # _entry.id 3FYM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3FYM RCSB RCSB051200 WWPDB D_1000051200 # _pdbx_database_status.entry_id 3FYM _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2009-01-22 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Xu, L.' 1 'Sedelnikova, S.E.' 2 'Baker, P.J.' 3 'Rice, D.W.' 4 # _citation.id primary _citation.title 'The 1A structure of YmfM, a putative DNA-binding membrane protein from Staphylococcus aureus' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Xu, L.' 1 primary 'Sedelnikova, S.E.' 2 primary 'Baker, P.J.' 3 primary 'Rice, D.W.' 4 # _cell.length_a 45.456 _cell.length_b 45.456 _cell.length_c 72.903 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 3FYM _cell.pdbx_unique_axis ? _cell.Z_PDB 8 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.entry_id 3FYM _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 96 _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative uncharacterized protein' 15130.502 1 ? ? 'N-terminal soluble domain' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 water nat water 18.015 145 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'hypothetical protein YmfM' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKTVGEALKGRRERLGMTLTELEQRTGIKREMLVHIENNEFDQLPNKNYSEGFIRKYASVVNIEPNQLIQAHQDEIPSNQ AEWDEVITVFNNNKDLDYKSKSKEPIQLLVIMGITVLITLLLWIMLVLIF ; _entity_poly.pdbx_seq_one_letter_code_can ;MKTVGEALKGRRERLGMTLTELEQRTGIKREMLVHIENNEFDQLPNKNYSEGFIRKYASVVNIEPNQLIQAHQDEIPSNQ AEWDEVITVFNNNKDLDYKSKSKEPIQLLVIMGITVLITLLLWIMLVLIF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 THR n 1 4 VAL n 1 5 GLY n 1 6 GLU n 1 7 ALA n 1 8 LEU n 1 9 LYS n 1 10 GLY n 1 11 ARG n 1 12 ARG n 1 13 GLU n 1 14 ARG n 1 15 LEU n 1 16 GLY n 1 17 MET n 1 18 THR n 1 19 LEU n 1 20 THR n 1 21 GLU n 1 22 LEU n 1 23 GLU n 1 24 GLN n 1 25 ARG n 1 26 THR n 1 27 GLY n 1 28 ILE n 1 29 LYS n 1 30 ARG n 1 31 GLU n 1 32 MET n 1 33 LEU n 1 34 VAL n 1 35 HIS n 1 36 ILE n 1 37 GLU n 1 38 ASN n 1 39 ASN n 1 40 GLU n 1 41 PHE n 1 42 ASP n 1 43 GLN n 1 44 LEU n 1 45 PRO n 1 46 ASN n 1 47 LYS n 1 48 ASN n 1 49 TYR n 1 50 SER n 1 51 GLU n 1 52 GLY n 1 53 PHE n 1 54 ILE n 1 55 ARG n 1 56 LYS n 1 57 TYR n 1 58 ALA n 1 59 SER n 1 60 VAL n 1 61 VAL n 1 62 ASN n 1 63 ILE n 1 64 GLU n 1 65 PRO n 1 66 ASN n 1 67 GLN n 1 68 LEU n 1 69 ILE n 1 70 GLN n 1 71 ALA n 1 72 HIS n 1 73 GLN n 1 74 ASP n 1 75 GLU n 1 76 ILE n 1 77 PRO n 1 78 SER n 1 79 ASN n 1 80 GLN n 1 81 ALA n 1 82 GLU n 1 83 TRP n 1 84 ASP n 1 85 GLU n 1 86 VAL n 1 87 ILE n 1 88 THR n 1 89 VAL n 1 90 PHE n 1 91 ASN n 1 92 ASN n 1 93 ASN n 1 94 LYS n 1 95 ASP n 1 96 LEU n 1 97 ASP n 1 98 TYR n 1 99 LYS n 1 100 SER n 1 101 LYS n 1 102 SER n 1 103 LYS n 1 104 GLU n 1 105 PRO n 1 106 ILE n 1 107 GLN n 1 108 LEU n 1 109 LEU n 1 110 VAL n 1 111 ILE n 1 112 MET n 1 113 GLY n 1 114 ILE n 1 115 THR n 1 116 VAL n 1 117 LEU n 1 118 ILE n 1 119 THR n 1 120 LEU n 1 121 LEU n 1 122 LEU n 1 123 TRP n 1 124 ILE n 1 125 MET n 1 126 LEU n 1 127 VAL n 1 128 LEU n 1 129 ILE n 1 130 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus subsp. aureus Mu50' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 158878 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector plasmid _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pETBLUE1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q99UJ0_STAAM _struct_ref.pdbx_db_accession Q99UJ0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKTVGEALKGRRERLGMTLTELEQRTGIKREMLVHIENNEFDQLPNKNYSEGFIRKYASVVNIEPNQLIQAHQDEIPSNQ AEWDEVITVFNNNKDLDYKSKSKEPIQLLVIMGITVLITLLLWIMLVLIF ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3FYM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 130 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99UJ0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 130 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1001 _struct_ref_seq.pdbx_auth_seq_align_end 1130 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.crystals_number 1 _exptl.entry_id 3FYM _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_percent_sol ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.temp 294 _exptl_crystal_grow.pdbx_details '0.1M MES pH6.5, 0.01M Zinc Sulphate, 25% PEG 550MME, VAPOR DIFFUSION, HANGING DROP, temperature 294K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector ? _diffrn_detector.type ? _diffrn_detector.pdbx_collection_date 2006-02-02 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 2.07 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SRS BEAMLINE PX10.1' _diffrn_source.pdbx_wavelength_list 2.07 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site SRS _diffrn_source.pdbx_synchrotron_beamline PX10.1 # _reflns.entry_id 3FYM _reflns.observed_criterion_sigma_F 1 _reflns.observed_criterion_sigma_I 1 _reflns.d_resolution_high 1 _reflns.d_resolution_low 20 _reflns.number_all 38933 _reflns.number_obs 38933 _reflns.percent_possible_obs 92.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1 _reflns_shell.d_res_low 20 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 92.5 _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3FYM _refine.B_iso_mean 16.077 _refine.pdbx_method_to_determine_struct ? _refine.B_iso_max 55.31 _refine.B_iso_min 6.99 _refine.occupancy_max 1.00 _refine.occupancy_min 0.24 _refine.ls_d_res_high 1 _refine.ls_d_res_low 20 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 38933 _refine.ls_number_reflns_obs 38933 _refine.ls_number_reflns_R_free 14 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.11 _refine.ls_R_factor_R_work 0.11 _refine.ls_R_factor_R_free 0.14 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free 5 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.details ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 700 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 145 _refine_hist.number_atoms_total 846 _refine_hist.d_res_high 1 _refine_hist.d_res_low 20 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function s_bond_d 0.018 ? ? ? 'X-RAY DIFFRACTION' ? s_angle_d 0.038 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 3FYM _struct.title 'The 1A structure of YmfM, a putative DNA-binding membrane protein from Staphylococcus aureus' _struct.pdbx_descriptor 'Putative uncharacterized protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3FYM _struct_keywords.text 'HTH DNA binding, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 3 ? LEU A 15 ? THR A 1003 LEU A 1015 1 ? 13 HELX_P HELX_P2 2 THR A 18 ? GLY A 27 ? THR A 1018 GLY A 1027 1 ? 10 HELX_P HELX_P3 3 LYS A 29 ? ASN A 38 ? LYS A 1029 ASN A 1038 1 ? 10 HELX_P HELX_P4 4 GLU A 40 ? LEU A 44 ? GLU A 1040 LEU A 1044 5 ? 5 HELX_P HELX_P5 5 ASN A 46 ? ASN A 48 ? ASN A 1046 ASN A 1048 5 ? 3 HELX_P HELX_P6 6 TYR A 49 ? VAL A 61 ? TYR A 1049 VAL A 1061 1 ? 13 HELX_P HELX_P7 7 GLU A 64 ? HIS A 72 ? GLU A 1064 HIS A 1072 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A GLU 31 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 1031 A ZN 2001 1_555 ? ? ? ? ? ? ? 1.916 ? metalc2 metalc ? ? A HIS 35 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 1035 A ZN 2001 1_555 ? ? ? ? ? ? ? 1.972 ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 C HOH . O ? ? A ZN 2001 A HOH 3101 1_555 ? ? ? ? ? ? ? 1.993 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 2001' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 31 ? GLU A 1031 . ? 1_555 ? 2 AC1 4 HIS A 35 ? HIS A 1035 . ? 1_555 ? 3 AC1 4 GLU A 51 ? GLU A 1051 . ? 6_455 ? 4 AC1 4 HOH C . ? HOH A 3101 . ? 1_555 ? # _atom_sites.entry_id 3FYM _atom_sites.fract_transf_matrix[1][1] 0.021999 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021999 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013717 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1001 ? ? ? A . n A 1 2 LYS 2 1002 1002 LYS LYS A . n A 1 3 THR 3 1003 1003 THR THR A . n A 1 4 VAL 4 1004 1004 VAL VAL A . n A 1 5 GLY 5 1005 1005 GLY GLY A . n A 1 6 GLU 6 1006 1006 GLU GLU A . n A 1 7 ALA 7 1007 1007 ALA ALA A . n A 1 8 LEU 8 1008 1008 LEU LEU A . n A 1 9 LYS 9 1009 1009 LYS LYS A . n A 1 10 GLY 10 1010 1010 GLY GLY A . n A 1 11 ARG 11 1011 1011 ARG ARG A . n A 1 12 ARG 12 1012 1012 ARG ARG A . n A 1 13 GLU 13 1013 1013 GLU GLU A . n A 1 14 ARG 14 1014 1014 ARG ARG A . n A 1 15 LEU 15 1015 1015 LEU LEU A . n A 1 16 GLY 16 1016 1016 GLY GLY A . n A 1 17 MET 17 1017 1017 MET MET A . n A 1 18 THR 18 1018 1018 THR THR A . n A 1 19 LEU 19 1019 1019 LEU LEU A . n A 1 20 THR 20 1020 1020 THR THR A . n A 1 21 GLU 21 1021 1021 GLU ALA A . n A 1 22 LEU 22 1022 1022 LEU LEU A . n A 1 23 GLU 23 1023 1023 GLU GLU A . n A 1 24 GLN 24 1024 1024 GLN GLN A . n A 1 25 ARG 25 1025 1025 ARG ARG A . n A 1 26 THR 26 1026 1026 THR THR A . n A 1 27 GLY 27 1027 1027 GLY GLY A . n A 1 28 ILE 28 1028 1028 ILE ILE A . n A 1 29 LYS 29 1029 1029 LYS LYS A . n A 1 30 ARG 30 1030 1030 ARG ARG A . n A 1 31 GLU 31 1031 1031 GLU GLU A . n A 1 32 MET 32 1032 1032 MET MET A . n A 1 33 LEU 33 1033 1033 LEU LEU A . n A 1 34 VAL 34 1034 1034 VAL VAL A . n A 1 35 HIS 35 1035 1035 HIS HIS A . n A 1 36 ILE 36 1036 1036 ILE ILE A . n A 1 37 GLU 37 1037 1037 GLU GLU A . n A 1 38 ASN 38 1038 1038 ASN ASN A . n A 1 39 ASN 39 1039 1039 ASN ASN A . n A 1 40 GLU 40 1040 1040 GLU GLU A . n A 1 41 PHE 41 1041 1041 PHE PHE A . n A 1 42 ASP 42 1042 1042 ASP ASP A . n A 1 43 GLN 43 1043 1043 GLN GLN A . n A 1 44 LEU 44 1044 1044 LEU LEU A . n A 1 45 PRO 45 1045 1045 PRO PRO A . n A 1 46 ASN 46 1046 1046 ASN ASN A . n A 1 47 LYS 47 1047 1047 LYS LYS A . n A 1 48 ASN 48 1048 1048 ASN ASN A . n A 1 49 TYR 49 1049 1049 TYR TYR A . n A 1 50 SER 50 1050 1050 SER SER A . n A 1 51 GLU 51 1051 1051 GLU GLU A . n A 1 52 GLY 52 1052 1052 GLY GLY A . n A 1 53 PHE 53 1053 1053 PHE PHE A . n A 1 54 ILE 54 1054 1054 ILE ILE A . n A 1 55 ARG 55 1055 1055 ARG ARG A . n A 1 56 LYS 56 1056 1056 LYS LYS A . n A 1 57 TYR 57 1057 1057 TYR TYR A . n A 1 58 ALA 58 1058 1058 ALA ALA A . n A 1 59 SER 59 1059 1059 SER SER A . n A 1 60 VAL 60 1060 1060 VAL VAL A . n A 1 61 VAL 61 1061 1061 VAL VAL A . n A 1 62 ASN 62 1062 1062 ASN ASN A . n A 1 63 ILE 63 1063 1063 ILE ILE A . n A 1 64 GLU 64 1064 1064 GLU GLU A . n A 1 65 PRO 65 1065 1065 PRO PRO A . n A 1 66 ASN 66 1066 1066 ASN ASN A . n A 1 67 GLN 67 1067 1067 GLN GLN A . n A 1 68 LEU 68 1068 1068 LEU LEU A . n A 1 69 ILE 69 1069 1069 ILE ILE A . n A 1 70 GLN 70 1070 1070 GLN GLN A . n A 1 71 ALA 71 1071 1071 ALA ALA A . n A 1 72 HIS 72 1072 1072 HIS HIS A . n A 1 73 GLN 73 1073 1073 GLN GLN A . n A 1 74 ASP 74 1074 1074 ASP ASP A . n A 1 75 GLU 75 1075 1075 GLU GLU A . n A 1 76 ILE 76 1076 1076 ILE ILE A . n A 1 77 PRO 77 1077 1077 PRO PRO A . n A 1 78 SER 78 1078 1078 SER SER A . n A 1 79 ASN 79 1079 1079 ASN ASN A . n A 1 80 GLN 80 1080 1080 GLN GLN A . n A 1 81 ALA 81 1081 1081 ALA ALA A . n A 1 82 GLU 82 1082 1082 GLU GLU A . n A 1 83 TRP 83 1083 1083 TRP TRP A . n A 1 84 ASP 84 1084 ? ? ? A . n A 1 85 GLU 85 1085 ? ? ? A . n A 1 86 VAL 86 1086 ? ? ? A . n A 1 87 ILE 87 1087 ? ? ? A . n A 1 88 THR 88 1088 ? ? ? A . n A 1 89 VAL 89 1089 ? ? ? A . n A 1 90 PHE 90 1090 ? ? ? A . n A 1 91 ASN 91 1091 ? ? ? A . n A 1 92 ASN 92 1092 ? ? ? A . n A 1 93 ASN 93 1093 ? ? ? A . n A 1 94 LYS 94 1094 ? ? ? A . n A 1 95 ASP 95 1095 ? ? ? A . n A 1 96 LEU 96 1096 ? ? ? A . n A 1 97 ASP 97 1097 ? ? ? A . n A 1 98 TYR 98 1098 ? ? ? A . n A 1 99 LYS 99 1099 ? ? ? A . n A 1 100 SER 100 1100 ? ? ? A . n A 1 101 LYS 101 1101 ? ? ? A . n A 1 102 SER 102 1102 ? ? ? A . n A 1 103 LYS 103 1103 ? ? ? A . n A 1 104 GLU 104 1104 ? ? ? A . n A 1 105 PRO 105 1105 ? ? ? A . n A 1 106 ILE 106 1106 ? ? ? A . n A 1 107 GLN 107 1107 ? ? ? A . n A 1 108 LEU 108 1108 ? ? ? A . n A 1 109 LEU 109 1109 ? ? ? A . n A 1 110 VAL 110 1110 ? ? ? A . n A 1 111 ILE 111 1111 ? ? ? A . n A 1 112 MET 112 1112 ? ? ? A . n A 1 113 GLY 113 1113 ? ? ? A . n A 1 114 ILE 114 1114 ? ? ? A . n A 1 115 THR 115 1115 ? ? ? A . n A 1 116 VAL 116 1116 ? ? ? A . n A 1 117 LEU 117 1117 ? ? ? A . n A 1 118 ILE 118 1118 ? ? ? A . n A 1 119 THR 119 1119 ? ? ? A . n A 1 120 LEU 120 1120 ? ? ? A . n A 1 121 LEU 121 1121 ? ? ? A . n A 1 122 LEU 122 1122 ? ? ? A . n A 1 123 TRP 123 1123 ? ? ? A . n A 1 124 ILE 124 1124 ? ? ? A . n A 1 125 MET 125 1125 ? ? ? A . n A 1 126 LEU 126 1126 ? ? ? A . n A 1 127 VAL 127 1127 ? ? ? A . n A 1 128 LEU 128 1128 ? ? ? A . n A 1 129 ILE 129 1129 ? ? ? A . n A 1 130 PHE 130 1130 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 2001 2001 ZN ZN A . C 3 HOH 1 3001 3001 HOH HOH A . C 3 HOH 2 3002 3002 HOH HOH A . C 3 HOH 3 3003 3003 HOH HOH A . C 3 HOH 4 3004 3004 HOH HOH A . C 3 HOH 5 3005 3005 HOH HOH A . C 3 HOH 6 3006 3006 HOH HOH A . C 3 HOH 7 3007 3007 HOH HOH A . C 3 HOH 8 3008 3008 HOH HOH A . C 3 HOH 9 3009 3009 HOH HOH A . C 3 HOH 10 3010 3010 HOH HOH A . C 3 HOH 11 3011 3011 HOH HOH A . C 3 HOH 12 3012 3012 HOH HOH A . C 3 HOH 13 3013 3013 HOH HOH A . C 3 HOH 14 3014 3014 HOH HOH A . C 3 HOH 15 3015 3015 HOH HOH A . C 3 HOH 16 3016 3016 HOH HOH A . C 3 HOH 17 3017 3017 HOH HOH A . C 3 HOH 18 3018 3018 HOH HOH A . C 3 HOH 19 3019 3019 HOH HOH A . C 3 HOH 20 3020 3020 HOH HOH A . C 3 HOH 21 3021 3021 HOH HOH A . C 3 HOH 22 3022 3022 HOH HOH A . C 3 HOH 23 3023 3023 HOH HOH A . C 3 HOH 24 3024 3024 HOH HOH A . C 3 HOH 25 3025 3025 HOH HOH A . C 3 HOH 26 3026 3026 HOH HOH A . C 3 HOH 27 3027 3027 HOH HOH A . C 3 HOH 28 3028 3028 HOH HOH A . C 3 HOH 29 3029 3029 HOH HOH A . C 3 HOH 30 3030 3030 HOH HOH A . C 3 HOH 31 3031 3031 HOH HOH A . C 3 HOH 32 3032 3032 HOH HOH A . C 3 HOH 33 3033 3033 HOH HOH A . C 3 HOH 34 3034 3034 HOH HOH A . C 3 HOH 35 3035 3035 HOH HOH A . C 3 HOH 36 3036 3036 HOH HOH A . C 3 HOH 37 3037 3037 HOH HOH A . C 3 HOH 38 3038 3038 HOH HOH A . C 3 HOH 39 3039 3039 HOH HOH A . C 3 HOH 40 3040 3040 HOH HOH A . C 3 HOH 41 3041 3041 HOH HOH A . C 3 HOH 42 3042 3042 HOH HOH A . C 3 HOH 43 3043 3043 HOH HOH A . C 3 HOH 44 3044 3044 HOH HOH A . C 3 HOH 45 3045 3045 HOH HOH A . C 3 HOH 46 3046 3046 HOH HOH A . C 3 HOH 47 3047 3047 HOH HOH A . C 3 HOH 48 3048 3048 HOH HOH A . C 3 HOH 49 3049 3049 HOH HOH A . C 3 HOH 50 3050 3050 HOH HOH A . C 3 HOH 51 3051 3051 HOH HOH A . C 3 HOH 52 3052 3052 HOH HOH A . C 3 HOH 53 3053 3053 HOH HOH A . C 3 HOH 54 3054 3054 HOH HOH A . C 3 HOH 55 3055 3055 HOH HOH A . C 3 HOH 56 3056 3056 HOH HOH A . C 3 HOH 57 3057 3057 HOH HOH A . C 3 HOH 58 3058 3058 HOH HOH A . C 3 HOH 59 3059 3059 HOH HOH A . C 3 HOH 60 3060 3060 HOH HOH A . C 3 HOH 61 3061 3061 HOH HOH A . C 3 HOH 62 3062 3062 HOH HOH A . C 3 HOH 63 3063 3063 HOH HOH A . C 3 HOH 64 3064 3064 HOH HOH A . C 3 HOH 65 3065 3065 HOH HOH A . C 3 HOH 66 3066 3066 HOH HOH A . C 3 HOH 67 3067 3067 HOH HOH A . C 3 HOH 68 3068 3068 HOH HOH A . C 3 HOH 69 3069 3069 HOH HOH A . C 3 HOH 70 3070 3070 HOH HOH A . C 3 HOH 71 3071 3071 HOH HOH A . C 3 HOH 72 3072 3072 HOH HOH A . C 3 HOH 73 3073 3073 HOH HOH A . C 3 HOH 74 3074 3074 HOH HOH A . C 3 HOH 75 3075 3075 HOH HOH A . C 3 HOH 76 3076 3076 HOH HOH A . C 3 HOH 77 3077 3077 HOH HOH A . C 3 HOH 78 3078 3078 HOH HOH A . C 3 HOH 79 3079 3079 HOH HOH A . C 3 HOH 80 3080 3080 HOH HOH A . C 3 HOH 81 3081 3081 HOH HOH A . C 3 HOH 82 3082 3082 HOH HOH A . C 3 HOH 83 3083 3083 HOH HOH A . C 3 HOH 84 3084 3084 HOH HOH A . C 3 HOH 85 3085 3085 HOH HOH A . C 3 HOH 86 3086 3086 HOH HOH A . C 3 HOH 87 3087 3087 HOH HOH A . C 3 HOH 88 3088 3088 HOH HOH A . C 3 HOH 89 3089 3089 HOH HOH A . C 3 HOH 90 3090 3090 HOH HOH A . C 3 HOH 91 3091 3091 HOH HOH A . C 3 HOH 92 3092 3092 HOH HOH A . C 3 HOH 93 3093 3093 HOH HOH A . C 3 HOH 94 3094 3094 HOH HOH A . C 3 HOH 95 3095 3095 HOH HOH A . C 3 HOH 96 3096 3096 HOH HOH A . C 3 HOH 97 3097 3097 HOH HOH A . C 3 HOH 98 3098 3098 HOH HOH A . C 3 HOH 99 3099 3099 HOH HOH A . C 3 HOH 100 3100 3100 HOH HOH A . C 3 HOH 101 3101 3101 HOH HOH A . C 3 HOH 102 3102 3102 HOH HOH A . C 3 HOH 103 3103 3103 HOH HOH A . C 3 HOH 104 3104 3104 HOH HOH A . C 3 HOH 105 3105 3105 HOH HOH A . C 3 HOH 106 3106 3106 HOH HOH A . C 3 HOH 107 3107 3107 HOH HOH A . C 3 HOH 108 3108 3108 HOH HOH A . C 3 HOH 109 3109 3109 HOH HOH A . C 3 HOH 110 3110 3110 HOH HOH A . C 3 HOH 111 3111 3111 HOH HOH A . C 3 HOH 112 3112 3112 HOH HOH A . C 3 HOH 113 3113 3113 HOH HOH A . C 3 HOH 114 3114 3114 HOH HOH A . C 3 HOH 115 3115 3115 HOH HOH A . C 3 HOH 116 3116 3116 HOH HOH A . C 3 HOH 117 3117 3117 HOH HOH A . C 3 HOH 118 3118 3118 HOH HOH A . C 3 HOH 119 3119 3119 HOH HOH A . C 3 HOH 120 3120 3120 HOH HOH A . C 3 HOH 121 3121 3121 HOH HOH A . C 3 HOH 122 3122 3122 HOH HOH A . C 3 HOH 123 3123 3123 HOH HOH A . C 3 HOH 124 3124 3124 HOH HOH A . C 3 HOH 125 3125 3125 HOH HOH A . C 3 HOH 126 3126 3126 HOH HOH A . C 3 HOH 127 3127 3127 HOH HOH A . C 3 HOH 128 3128 3128 HOH HOH A . C 3 HOH 129 3129 3129 HOH HOH A . C 3 HOH 130 3130 3130 HOH HOH A . C 3 HOH 131 3131 3131 HOH HOH A . C 3 HOH 132 3133 3133 HOH HOH A . C 3 HOH 133 3134 3134 HOH HOH A . C 3 HOH 134 3135 3135 HOH HOH A . C 3 HOH 135 3136 3136 HOH HOH A . C 3 HOH 136 3137 3137 HOH HOH A . C 3 HOH 137 3138 3138 HOH HOH A . C 3 HOH 138 3139 3139 HOH HOH A . C 3 HOH 139 3140 3140 HOH HOH A . C 3 HOH 140 3141 3141 HOH HOH A . C 3 HOH 141 3142 3142 HOH HOH A . C 3 HOH 142 3143 3143 HOH HOH A . C 3 HOH 143 3144 3144 HOH HOH A . C 3 HOH 144 3145 3145 HOH HOH A . C 3 HOH 145 3147 3147 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 3041 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 31 ? A GLU 1031 ? 1_555 ZN ? B ZN . ? A ZN 2001 ? 1_555 NE2 ? A HIS 35 ? A HIS 1035 ? 1_555 122.3 ? 2 OE2 ? A GLU 31 ? A GLU 1031 ? 1_555 ZN ? B ZN . ? A ZN 2001 ? 1_555 O ? C HOH . ? A HOH 3101 ? 1_555 98.1 ? 3 NE2 ? A HIS 35 ? A HIS 1035 ? 1_555 ZN ? B ZN . ? A ZN 2001 ? 1_555 O ? C HOH . ? A HOH 3101 ? 1_555 110.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-02-09 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal SHELX . ? package 'George M. Sheldrick' gsheldr@shelx.uni-ac.gwdg.de refinement http://shelx.uni-ac.gwdg.de/SHELX/ Fortran_77 ? 1 PDB_EXTRACT 3.006 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 2 HKL-2000 . ? ? ? ? 'data collection' ? ? ? 3 MOSFLM . ? ? ? ? 'data reduction' ? ? ? 4 SCALA . ? ? ? ? 'data scaling' ? ? ? 5 SHELXS . ? ? ? ? phasing ? ? ? 6 SHELXL . ? ? ? ? refinement ? ? ? 7 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 3108 ? ? O A HOH 3124 ? ? 1.97 2 1 O A HOH 3122 ? ? O A HOH 3131 ? ? 2.08 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 3096 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 3097 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 5_555 _pdbx_validate_symm_contact.dist 2.13 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 1023 ? ? OE1 A GLU 1023 ? ? 1.166 1.252 -0.086 0.011 N 2 1 CG A GLU 1082 ? ? CD A GLU 1082 ? ? 1.399 1.515 -0.116 0.015 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 1014 ? ? CZ A ARG 1014 ? ? NH1 A ARG 1014 ? ? 113.93 120.30 -6.37 0.50 N 2 1 NE A ARG 1014 ? ? CZ A ARG 1014 ? ? NH2 A ARG 1014 ? ? 123.32 120.30 3.02 0.50 N 3 1 OE1 A GLU 1023 ? ? CD A GLU 1023 ? ? OE2 A GLU 1023 ? ? 111.41 123.30 -11.89 1.20 N 4 1 CG A ARG 1025 ? ? CD A ARG 1025 ? ? NE A ARG 1025 ? ? 125.50 111.80 13.70 2.10 N 5 1 CD A ARG 1025 ? ? NE A ARG 1025 ? ? CZ A ARG 1025 ? ? 133.93 123.60 10.33 1.40 N 6 1 NE A ARG 1025 ? ? CZ A ARG 1025 ? ? NH1 A ARG 1025 ? ? 124.44 120.30 4.14 0.50 N 7 1 O A GLY 1027 ? ? C A GLY 1027 ? ? N A ILE 1028 ? ? 110.48 122.70 -12.22 1.60 Y 8 1 C A GLY 1027 ? ? N A ILE 1028 ? ? CA A ILE 1028 ? ? 141.19 121.70 19.49 2.50 Y 9 1 CB A TYR 1057 ? ? CG A TYR 1057 ? ? CD1 A TYR 1057 ? ? 125.32 121.00 4.32 0.60 N 10 1 CB A GLU 1082 ? ? CG A GLU 1082 ? ? CD A GLU 1082 ? ? 156.79 114.20 42.59 2.70 N # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 1021 ? CG ? A GLU 21 CG 2 1 Y 1 A GLU 1021 ? CD ? A GLU 21 CD 3 1 Y 1 A GLU 1021 ? OE1 ? A GLU 21 OE1 4 1 Y 1 A GLU 1021 ? OE2 ? A GLU 21 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1001 ? A MET 1 2 1 Y 1 A ASP 1084 ? A ASP 84 3 1 Y 1 A GLU 1085 ? A GLU 85 4 1 Y 1 A VAL 1086 ? A VAL 86 5 1 Y 1 A ILE 1087 ? A ILE 87 6 1 Y 1 A THR 1088 ? A THR 88 7 1 Y 1 A VAL 1089 ? A VAL 89 8 1 Y 1 A PHE 1090 ? A PHE 90 9 1 Y 1 A ASN 1091 ? A ASN 91 10 1 Y 1 A ASN 1092 ? A ASN 92 11 1 Y 1 A ASN 1093 ? A ASN 93 12 1 Y 1 A LYS 1094 ? A LYS 94 13 1 Y 1 A ASP 1095 ? A ASP 95 14 1 Y 1 A LEU 1096 ? A LEU 96 15 1 Y 1 A ASP 1097 ? A ASP 97 16 1 Y 1 A TYR 1098 ? A TYR 98 17 1 Y 1 A LYS 1099 ? A LYS 99 18 1 Y 1 A SER 1100 ? A SER 100 19 1 Y 1 A LYS 1101 ? A LYS 101 20 1 Y 1 A SER 1102 ? A SER 102 21 1 Y 1 A LYS 1103 ? A LYS 103 22 1 Y 1 A GLU 1104 ? A GLU 104 23 1 Y 1 A PRO 1105 ? A PRO 105 24 1 Y 1 A ILE 1106 ? A ILE 106 25 1 Y 1 A GLN 1107 ? A GLN 107 26 1 Y 1 A LEU 1108 ? A LEU 108 27 1 Y 1 A LEU 1109 ? A LEU 109 28 1 Y 1 A VAL 1110 ? A VAL 110 29 1 Y 1 A ILE 1111 ? A ILE 111 30 1 Y 1 A MET 1112 ? A MET 112 31 1 Y 1 A GLY 1113 ? A GLY 113 32 1 Y 1 A ILE 1114 ? A ILE 114 33 1 Y 1 A THR 1115 ? A THR 115 34 1 Y 1 A VAL 1116 ? A VAL 116 35 1 Y 1 A LEU 1117 ? A LEU 117 36 1 Y 1 A ILE 1118 ? A ILE 118 37 1 Y 1 A THR 1119 ? A THR 119 38 1 Y 1 A LEU 1120 ? A LEU 120 39 1 Y 1 A LEU 1121 ? A LEU 121 40 1 Y 1 A LEU 1122 ? A LEU 122 41 1 Y 1 A TRP 1123 ? A TRP 123 42 1 Y 1 A ILE 1124 ? A ILE 124 43 1 Y 1 A MET 1125 ? A MET 125 44 1 Y 1 A LEU 1126 ? A LEU 126 45 1 Y 1 A VAL 1127 ? A VAL 127 46 1 Y 1 A LEU 1128 ? A LEU 128 47 1 Y 1 A ILE 1129 ? A ILE 129 48 1 Y 1 A PHE 1130 ? A PHE 130 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH #