data_3GA0 # _entry.id 3GA0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3GA0 RCSB RCSB051610 WWPDB D_1000051610 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1HL3 'CTBP/BARS: A DUAL-FUNCTION CTBP/BARS IN TERNARY COMPLEX WITH NAD(H) AND PIDLSKK PEPTIDE' unspecified PDB 1HKU 'CTBP/BARS: A DUAL-FUNCTION PROTEIN INVOLVED IN TRANSCRIPTION COREPRESSION AND GOLGI MEMBRANE FISSION' unspecified PDB 2HU2 'CTBP/BARS in ternary complex with NAD(H) and RRTGAPPAL peptide' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3GA0 _pdbx_database_status.recvd_initial_deposition_date 2009-02-16 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nardini, M.' 1 'Valente, C.' 2 'Ricagno, S.' 3 'Luini, A.' 4 'Corda, D.' 5 'Bolognesi, M.' 6 # _citation.id primary _citation.title 'CtBP1/BARS Gly172-->Glu mutant structure: impairing NAD(H)-binding and dimerization' _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_volume 381 _citation.page_first 70 _citation.page_last 74 _citation.year 2009 _citation.journal_id_ASTM BBRCA9 _citation.country US _citation.journal_id_ISSN 0006-291X _citation.journal_id_CSD 0146 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19351597 _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2009.02.010 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Nardini, M.' 1 primary 'Valente, C.' 2 primary 'Ricagno, S.' 3 primary 'Luini, A.' 4 primary 'Corda, D.' 5 primary 'Bolognesi, M.' 6 # _cell.entry_id 3GA0 _cell.length_a 89.197 _cell.length_b 89.197 _cell.length_c 160.259 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3GA0 _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'C-terminal-binding protein 1' 39581.195 1 1.1.1.- G172E 'UNP residues 1-350' ? 2 non-polymer syn 'FORMIC ACID' 46.025 2 ? ? ? ? 3 water nat water 18.015 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CtBP1, C-terminal-binding protein 3, CtBP3, 50 kDa BFA-dependent ADP-ribosylation substrate, BARS-50' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHMSGVRPPIMNGPMHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVGALMYHTITLTR EDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRTTWLHQALREGTRVQSVEQIR EVASGAARIRGETLGIIGLERVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQDLLFHSDCVTLHCGLNEHN HHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLICTPHAAWYSEQA SIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAATH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHMSGVRPPIMNGPMHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVGALMYHTITLTR EDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRTTWLHQALREGTRVQSVEQIR EVASGAARIRGETLGIIGLERVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQDLLFHSDCVTLHCGLNEHN HHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLICTPHAAWYSEQA SIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAATH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 MET n 1 10 SER n 1 11 GLY n 1 12 VAL n 1 13 ARG n 1 14 PRO n 1 15 PRO n 1 16 ILE n 1 17 MET n 1 18 ASN n 1 19 GLY n 1 20 PRO n 1 21 MET n 1 22 HIS n 1 23 PRO n 1 24 ARG n 1 25 PRO n 1 26 LEU n 1 27 VAL n 1 28 ALA n 1 29 LEU n 1 30 LEU n 1 31 ASP n 1 32 GLY n 1 33 ARG n 1 34 ASP n 1 35 CYS n 1 36 THR n 1 37 VAL n 1 38 GLU n 1 39 MET n 1 40 PRO n 1 41 ILE n 1 42 LEU n 1 43 LYS n 1 44 ASP n 1 45 VAL n 1 46 ALA n 1 47 THR n 1 48 VAL n 1 49 ALA n 1 50 PHE n 1 51 CYS n 1 52 ASP n 1 53 ALA n 1 54 GLN n 1 55 SER n 1 56 THR n 1 57 GLN n 1 58 GLU n 1 59 ILE n 1 60 HIS n 1 61 GLU n 1 62 LYS n 1 63 VAL n 1 64 LEU n 1 65 ASN n 1 66 GLU n 1 67 ALA n 1 68 VAL n 1 69 GLY n 1 70 ALA n 1 71 LEU n 1 72 MET n 1 73 TYR n 1 74 HIS n 1 75 THR n 1 76 ILE n 1 77 THR n 1 78 LEU n 1 79 THR n 1 80 ARG n 1 81 GLU n 1 82 ASP n 1 83 LEU n 1 84 GLU n 1 85 LYS n 1 86 PHE n 1 87 LYS n 1 88 ALA n 1 89 LEU n 1 90 ARG n 1 91 ILE n 1 92 ILE n 1 93 VAL n 1 94 ARG n 1 95 ILE n 1 96 GLY n 1 97 SER n 1 98 GLY n 1 99 PHE n 1 100 ASP n 1 101 ASN n 1 102 ILE n 1 103 ASP n 1 104 ILE n 1 105 LYS n 1 106 SER n 1 107 ALA n 1 108 GLY n 1 109 ASP n 1 110 LEU n 1 111 GLY n 1 112 ILE n 1 113 ALA n 1 114 VAL n 1 115 CYS n 1 116 ASN n 1 117 VAL n 1 118 PRO n 1 119 ALA n 1 120 ALA n 1 121 SER n 1 122 VAL n 1 123 GLU n 1 124 GLU n 1 125 THR n 1 126 ALA n 1 127 ASP n 1 128 SER n 1 129 THR n 1 130 LEU n 1 131 CYS n 1 132 HIS n 1 133 ILE n 1 134 LEU n 1 135 ASN n 1 136 LEU n 1 137 TYR n 1 138 ARG n 1 139 ARG n 1 140 THR n 1 141 THR n 1 142 TRP n 1 143 LEU n 1 144 HIS n 1 145 GLN n 1 146 ALA n 1 147 LEU n 1 148 ARG n 1 149 GLU n 1 150 GLY n 1 151 THR n 1 152 ARG n 1 153 VAL n 1 154 GLN n 1 155 SER n 1 156 VAL n 1 157 GLU n 1 158 GLN n 1 159 ILE n 1 160 ARG n 1 161 GLU n 1 162 VAL n 1 163 ALA n 1 164 SER n 1 165 GLY n 1 166 ALA n 1 167 ALA n 1 168 ARG n 1 169 ILE n 1 170 ARG n 1 171 GLY n 1 172 GLU n 1 173 THR n 1 174 LEU n 1 175 GLY n 1 176 ILE n 1 177 ILE n 1 178 GLY n 1 179 LEU n 1 180 GLU n 1 181 ARG n 1 182 VAL n 1 183 GLY n 1 184 GLN n 1 185 ALA n 1 186 VAL n 1 187 ALA n 1 188 LEU n 1 189 ARG n 1 190 ALA n 1 191 LYS n 1 192 ALA n 1 193 PHE n 1 194 GLY n 1 195 PHE n 1 196 ASN n 1 197 VAL n 1 198 LEU n 1 199 PHE n 1 200 TYR n 1 201 ASP n 1 202 PRO n 1 203 TYR n 1 204 LEU n 1 205 SER n 1 206 ASP n 1 207 GLY n 1 208 ILE n 1 209 GLU n 1 210 ARG n 1 211 ALA n 1 212 LEU n 1 213 GLY n 1 214 LEU n 1 215 GLN n 1 216 ARG n 1 217 VAL n 1 218 SER n 1 219 THR n 1 220 LEU n 1 221 GLN n 1 222 ASP n 1 223 LEU n 1 224 LEU n 1 225 PHE n 1 226 HIS n 1 227 SER n 1 228 ASP n 1 229 CYS n 1 230 VAL n 1 231 THR n 1 232 LEU n 1 233 HIS n 1 234 CYS n 1 235 GLY n 1 236 LEU n 1 237 ASN n 1 238 GLU n 1 239 HIS n 1 240 ASN n 1 241 HIS n 1 242 HIS n 1 243 LEU n 1 244 ILE n 1 245 ASN n 1 246 ASP n 1 247 PHE n 1 248 THR n 1 249 VAL n 1 250 LYS n 1 251 GLN n 1 252 MET n 1 253 ARG n 1 254 GLN n 1 255 GLY n 1 256 ALA n 1 257 PHE n 1 258 LEU n 1 259 VAL n 1 260 ASN n 1 261 THR n 1 262 ALA n 1 263 ARG n 1 264 GLY n 1 265 GLY n 1 266 LEU n 1 267 VAL n 1 268 ASP n 1 269 GLU n 1 270 LYS n 1 271 ALA n 1 272 LEU n 1 273 ALA n 1 274 GLN n 1 275 ALA n 1 276 LEU n 1 277 LYS n 1 278 GLU n 1 279 GLY n 1 280 ARG n 1 281 ILE n 1 282 ARG n 1 283 GLY n 1 284 ALA n 1 285 ALA n 1 286 LEU n 1 287 ASP n 1 288 VAL n 1 289 HIS n 1 290 GLU n 1 291 SER n 1 292 GLU n 1 293 PRO n 1 294 PHE n 1 295 SER n 1 296 PHE n 1 297 SER n 1 298 GLN n 1 299 GLY n 1 300 PRO n 1 301 LEU n 1 302 LYS n 1 303 ASP n 1 304 ALA n 1 305 PRO n 1 306 ASN n 1 307 LEU n 1 308 ILE n 1 309 CYS n 1 310 THR n 1 311 PRO n 1 312 HIS n 1 313 ALA n 1 314 ALA n 1 315 TRP n 1 316 TYR n 1 317 SER n 1 318 GLU n 1 319 GLN n 1 320 ALA n 1 321 SER n 1 322 ILE n 1 323 GLU n 1 324 MET n 1 325 ARG n 1 326 GLU n 1 327 GLU n 1 328 ALA n 1 329 ALA n 1 330 ARG n 1 331 GLU n 1 332 ILE n 1 333 ARG n 1 334 ARG n 1 335 ALA n 1 336 ILE n 1 337 THR n 1 338 GLY n 1 339 ARG n 1 340 ILE n 1 341 PRO n 1 342 ASP n 1 343 SER n 1 344 LEU n 1 345 LYS n 1 346 ASN n 1 347 CYS n 1 348 VAL n 1 349 ASN n 1 350 LYS n 1 351 ASP n 1 352 HIS n 1 353 LEU n 1 354 THR n 1 355 ALA n 1 356 ALA n 1 357 THR n 1 358 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Rat _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Ctbp1, Bars, Ctbp3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Bl21(de3)plyss' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET11D-HIS _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CTBP1_RAT _struct_ref.pdbx_db_accession Q9Z2F5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSGVRPPIMNGPMHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVGALMYHTITLTREDLEKFKA LRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAAR IRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFT VKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLICTPHAAWYSEQASIEMREEA AREIRRAITGRIPDSLKNCVNKDHLTAATH ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3GA0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 9 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 358 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Z2F5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 350 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 350 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3GA0 MET A 1 ? UNP Q9Z2F5 ? ? 'EXPRESSION TAG' -7 1 1 3GA0 GLY A 2 ? UNP Q9Z2F5 ? ? 'EXPRESSION TAG' -6 2 1 3GA0 HIS A 3 ? UNP Q9Z2F5 ? ? 'EXPRESSION TAG' -5 3 1 3GA0 HIS A 4 ? UNP Q9Z2F5 ? ? 'EXPRESSION TAG' -4 4 1 3GA0 HIS A 5 ? UNP Q9Z2F5 ? ? 'EXPRESSION TAG' -3 5 1 3GA0 HIS A 6 ? UNP Q9Z2F5 ? ? 'EXPRESSION TAG' -2 6 1 3GA0 HIS A 7 ? UNP Q9Z2F5 ? ? 'EXPRESSION TAG' -1 7 1 3GA0 HIS A 8 ? UNP Q9Z2F5 ? ? 'EXPRESSION TAG' 0 8 1 3GA0 GLU A 180 ? UNP Q9Z2F5 GLY 172 ENGINEERED 172 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FMT non-polymer . 'FORMIC ACID' ? 'C H2 O2' 46.025 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3GA0 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_percent_sol 47.09 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '1.8-2.1M Ammonium formate, 1.0M Hepes (pH7.5), cross-seeding technique, VAPOR DIFFUSION, temperature 294K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type ? _diffrn_detector.pdbx_collection_date 2004-12-16 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-3' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-3 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 3GA0 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 29.8 _reflns.d_resolution_high 3.4 _reflns.number_obs 5615 _reflns.number_all ? _reflns.percent_possible_obs 99.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4.4 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 3.4 _reflns_shell.d_res_low 3.5 _reflns_shell.percent_possible_all 98.9 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3GA0 _refine.ls_number_reflns_obs 5053 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 29.75 _refine.ls_d_res_high 3.40 _refine.ls_percent_reflns_obs 100.00 _refine.ls_R_factor_obs 0.26974 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.26248 _refine.ls_R_factor_R_free 0.33367 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.0 _refine.ls_number_reflns_R_free 560 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.882 _refine.correlation_coeff_Fo_to_Fc_free 0.850 _refine.B_iso_mean 58.689 _refine.aniso_B[1][1] 1.83 _refine.aniso_B[2][2] 1.83 _refine.aniso_B[3][3] -2.75 _refine.aniso_B[1][2] 0.92 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1HKU' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.665 _refine.pdbx_overall_ESU_R_Free 0.846 _refine.overall_SU_ML 0.667 _refine.overall_SU_B 40.232 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2609 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 7 _refine_hist.number_atoms_total 2616 _refine_hist.d_res_high 3.40 _refine_hist.d_res_low 29.75 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? o_angle_deg 1.142 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 3.401 _refine_ls_shell.d_res_low 3.488 _refine_ls_shell.number_reflns_R_work 355 _refine_ls_shell.R_factor_R_work 0.288 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.R_factor_R_free 0.309 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 38 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3GA0 _struct.title 'CtBP1/BARS Gly172->Glu mutant structure: impairing NAD(H) binding and dimerization' _struct.pdbx_descriptor 'C-terminal-binding protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3GA0 _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text ;TRANSCRIPTION CO-REPRESSION, ACYLTRANSFERASE, BREFELDIN A, NAD, GOLGI MEMBRANE, ACYL-COA, ADP-ribosylation, Cytoplasm, Nucleus, Oxidoreductase, Phosphoprotein, Ubl conjugation ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 38 ? LYS A 43 ? GLU A 30 LYS A 35 1 ? 6 HELX_P HELX_P2 2 SER A 55 ? ILE A 59 ? SER A 47 ILE A 51 5 ? 5 HELX_P HELX_P3 3 HIS A 60 ? ALA A 67 ? HIS A 52 ALA A 59 1 ? 8 HELX_P HELX_P4 4 THR A 79 ? PHE A 86 ? THR A 71 PHE A 78 1 ? 8 HELX_P HELX_P5 5 ASP A 103 ? ASP A 109 ? ASP A 95 ASP A 101 1 ? 7 HELX_P HELX_P6 6 SER A 121 ? ARG A 139 ? SER A 113 ARG A 131 1 ? 19 HELX_P HELX_P7 7 ARG A 139 ? GLU A 149 ? ARG A 131 GLU A 141 1 ? 11 HELX_P HELX_P8 8 SER A 155 ? ALA A 163 ? SER A 147 ALA A 155 1 ? 9 HELX_P HELX_P9 9 VAL A 182 ? PHE A 193 ? VAL A 174 PHE A 185 1 ? 12 HELX_P HELX_P10 10 GLY A 207 ? LEU A 212 ? GLY A 199 LEU A 204 1 ? 6 HELX_P HELX_P11 11 THR A 219 ? SER A 227 ? THR A 211 SER A 219 1 ? 9 HELX_P HELX_P12 12 ASN A 245 ? GLN A 251 ? ASN A 237 GLN A 243 1 ? 7 HELX_P HELX_P13 13 ARG A 263 ? VAL A 267 ? ARG A 255 VAL A 259 5 ? 5 HELX_P HELX_P14 14 ASP A 268 ? GLU A 278 ? ASP A 260 GLU A 270 1 ? 11 HELX_P HELX_P15 15 SER A 317 ? GLY A 338 ? SER A 309 GLY A 330 1 ? 22 HELX_P HELX_P16 16 ASN A 349 ? LEU A 353 ? ASN A 341 LEU A 345 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 340 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 332 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 341 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 333 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -11.01 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel B 1 2 ? parallel B 2 3 ? parallel B 3 4 ? parallel B 4 5 ? parallel B 5 6 ? parallel B 6 7 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 47 ? PHE A 50 ? THR A 39 PHE A 42 A 2 LEU A 26 ? LEU A 29 ? LEU A 18 LEU A 21 A 3 GLY A 69 ? MET A 72 ? GLY A 61 MET A 64 A 4 ILE A 91 ? ARG A 94 ? ILE A 83 ARG A 86 A 5 ALA A 113 ? CYS A 115 ? ALA A 105 CYS A 107 B 1 GLN A 215 ? ARG A 216 ? GLN A 207 ARG A 208 B 2 ASN A 196 ? TYR A 200 ? ASN A 188 TYR A 192 B 3 THR A 173 ? ILE A 177 ? THR A 165 ILE A 169 B 4 CYS A 229 ? LEU A 232 ? CYS A 221 LEU A 224 B 5 PHE A 257 ? ASN A 260 ? PHE A 249 ASN A 252 B 6 GLY A 283 ? LEU A 286 ? GLY A 275 LEU A 278 B 7 LEU A 307 ? CYS A 309 ? LEU A 299 CYS A 301 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 47 ? O THR A 39 N VAL A 27 ? N VAL A 19 A 2 3 N ALA A 28 ? N ALA A 20 O LEU A 71 ? O LEU A 63 A 3 4 N ALA A 70 ? N ALA A 62 O VAL A 93 ? O VAL A 85 A 4 5 N ILE A 92 ? N ILE A 84 O ALA A 113 ? O ALA A 105 B 1 2 O GLN A 215 ? O GLN A 207 N PHE A 199 ? N PHE A 191 B 2 3 O TYR A 200 ? O TYR A 192 N ILE A 176 ? N ILE A 168 B 3 4 N GLY A 175 ? N GLY A 167 O CYS A 229 ? O CYS A 221 B 4 5 N VAL A 230 ? N VAL A 222 O VAL A 259 ? O VAL A 251 B 5 6 N LEU A 258 ? N LEU A 250 O ALA A 285 ? O ALA A 277 B 6 7 N LEU A 286 ? N LEU A 278 O ILE A 308 ? O ILE A 300 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FMT A 800' AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FMT A 801' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 THR A 261 ? THR A 253 . ? 1_555 ? 2 AC1 4 ARG A 263 ? ARG A 255 . ? 1_555 ? 3 AC1 4 HIS A 312 ? HIS A 304 . ? 1_555 ? 4 AC1 4 FMT C . ? FMT A 801 . ? 1_555 ? 5 AC2 5 HIS A 74 ? HIS A 66 . ? 1_555 ? 6 AC2 5 ARG A 94 ? ARG A 86 . ? 1_555 ? 7 AC2 5 ILE A 95 ? ILE A 87 . ? 1_555 ? 8 AC2 5 TRP A 315 ? TRP A 307 . ? 1_555 ? 9 AC2 5 FMT B . ? FMT A 800 . ? 1_555 ? # _database_PDB_matrix.entry_id 3GA0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3GA0 _atom_sites.fract_transf_matrix[1][1] 0.011211 _atom_sites.fract_transf_matrix[1][2] 0.006473 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012946 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006240 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -7 ? ? ? A . n A 1 2 GLY 2 -6 ? ? ? A . n A 1 3 HIS 3 -5 ? ? ? A . n A 1 4 HIS 4 -4 ? ? ? A . n A 1 5 HIS 5 -3 ? ? ? A . n A 1 6 HIS 6 -2 ? ? ? A . n A 1 7 HIS 7 -1 ? ? ? A . n A 1 8 HIS 8 0 ? ? ? A . n A 1 9 MET 9 1 ? ? ? A . n A 1 10 SER 10 2 ? ? ? A . n A 1 11 GLY 11 3 ? ? ? A . n A 1 12 VAL 12 4 ? ? ? A . n A 1 13 ARG 13 5 ? ? ? A . n A 1 14 PRO 14 6 ? ? ? A . n A 1 15 PRO 15 7 ? ? ? A . n A 1 16 ILE 16 8 ? ? ? A . n A 1 17 MET 17 9 ? ? ? A . n A 1 18 ASN 18 10 10 ASN ASN A . n A 1 19 GLY 19 11 11 GLY GLY A . n A 1 20 PRO 20 12 12 PRO PRO A . n A 1 21 MET 21 13 13 MET MET A . n A 1 22 HIS 22 14 14 HIS HIS A . n A 1 23 PRO 23 15 15 PRO PRO A . n A 1 24 ARG 24 16 16 ARG ARG A . n A 1 25 PRO 25 17 17 PRO PRO A . n A 1 26 LEU 26 18 18 LEU LEU A . n A 1 27 VAL 27 19 19 VAL VAL A . n A 1 28 ALA 28 20 20 ALA ALA A . n A 1 29 LEU 29 21 21 LEU LEU A . n A 1 30 LEU 30 22 22 LEU LEU A . n A 1 31 ASP 31 23 23 ASP ASP A . n A 1 32 GLY 32 24 24 GLY GLY A . n A 1 33 ARG 33 25 25 ARG ARG A . n A 1 34 ASP 34 26 26 ASP ASP A . n A 1 35 CYS 35 27 27 CYS CYS A . n A 1 36 THR 36 28 28 THR THR A . n A 1 37 VAL 37 29 29 VAL VAL A . n A 1 38 GLU 38 30 30 GLU GLU A . n A 1 39 MET 39 31 31 MET MET A . n A 1 40 PRO 40 32 32 PRO PRO A . n A 1 41 ILE 41 33 33 ILE ILE A . n A 1 42 LEU 42 34 34 LEU LEU A . n A 1 43 LYS 43 35 35 LYS LYS A . n A 1 44 ASP 44 36 36 ASP ASP A . n A 1 45 VAL 45 37 37 VAL VAL A . n A 1 46 ALA 46 38 38 ALA ALA A . n A 1 47 THR 47 39 39 THR THR A . n A 1 48 VAL 48 40 40 VAL VAL A . n A 1 49 ALA 49 41 41 ALA ALA A . n A 1 50 PHE 50 42 42 PHE PHE A . n A 1 51 CYS 51 43 43 CYS CYS A . n A 1 52 ASP 52 44 44 ASP ASP A . n A 1 53 ALA 53 45 45 ALA ALA A . n A 1 54 GLN 54 46 46 GLN GLN A . n A 1 55 SER 55 47 47 SER SER A . n A 1 56 THR 56 48 48 THR THR A . n A 1 57 GLN 57 49 49 GLN GLN A . n A 1 58 GLU 58 50 50 GLU GLU A . n A 1 59 ILE 59 51 51 ILE ILE A . n A 1 60 HIS 60 52 52 HIS HIS A . n A 1 61 GLU 61 53 53 GLU GLU A . n A 1 62 LYS 62 54 54 LYS LYS A . n A 1 63 VAL 63 55 55 VAL VAL A . n A 1 64 LEU 64 56 56 LEU LEU A . n A 1 65 ASN 65 57 57 ASN ASN A . n A 1 66 GLU 66 58 58 GLU GLU A . n A 1 67 ALA 67 59 59 ALA ALA A . n A 1 68 VAL 68 60 60 VAL VAL A . n A 1 69 GLY 69 61 61 GLY GLY A . n A 1 70 ALA 70 62 62 ALA ALA A . n A 1 71 LEU 71 63 63 LEU LEU A . n A 1 72 MET 72 64 64 MET MET A . n A 1 73 TYR 73 65 65 TYR TYR A . n A 1 74 HIS 74 66 66 HIS HIS A . n A 1 75 THR 75 67 67 THR THR A . n A 1 76 ILE 76 68 68 ILE ILE A . n A 1 77 THR 77 69 69 THR THR A . n A 1 78 LEU 78 70 70 LEU LEU A . n A 1 79 THR 79 71 71 THR THR A . n A 1 80 ARG 80 72 72 ARG ARG A . n A 1 81 GLU 81 73 73 GLU GLU A . n A 1 82 ASP 82 74 74 ASP ASP A . n A 1 83 LEU 83 75 75 LEU LEU A . n A 1 84 GLU 84 76 76 GLU GLU A . n A 1 85 LYS 85 77 77 LYS LYS A . n A 1 86 PHE 86 78 78 PHE PHE A . n A 1 87 LYS 87 79 79 LYS LYS A . n A 1 88 ALA 88 80 80 ALA ALA A . n A 1 89 LEU 89 81 81 LEU LEU A . n A 1 90 ARG 90 82 82 ARG ARG A . n A 1 91 ILE 91 83 83 ILE ILE A . n A 1 92 ILE 92 84 84 ILE ILE A . n A 1 93 VAL 93 85 85 VAL VAL A . n A 1 94 ARG 94 86 86 ARG ARG A . n A 1 95 ILE 95 87 87 ILE ILE A . n A 1 96 GLY 96 88 88 GLY GLY A . n A 1 97 SER 97 89 89 SER SER A . n A 1 98 GLY 98 90 90 GLY GLY A . n A 1 99 PHE 99 91 91 PHE PHE A . n A 1 100 ASP 100 92 92 ASP ASP A . n A 1 101 ASN 101 93 93 ASN ASN A . n A 1 102 ILE 102 94 94 ILE ILE A . n A 1 103 ASP 103 95 95 ASP ASP A . n A 1 104 ILE 104 96 96 ILE ILE A . n A 1 105 LYS 105 97 97 LYS LYS A . n A 1 106 SER 106 98 98 SER SER A . n A 1 107 ALA 107 99 99 ALA ALA A . n A 1 108 GLY 108 100 100 GLY GLY A . n A 1 109 ASP 109 101 101 ASP ASP A . n A 1 110 LEU 110 102 102 LEU LEU A . n A 1 111 GLY 111 103 103 GLY GLY A . n A 1 112 ILE 112 104 104 ILE ILE A . n A 1 113 ALA 113 105 105 ALA ALA A . n A 1 114 VAL 114 106 106 VAL VAL A . n A 1 115 CYS 115 107 107 CYS CYS A . n A 1 116 ASN 116 108 108 ASN ASN A . n A 1 117 VAL 117 109 109 VAL VAL A . n A 1 118 PRO 118 110 110 PRO PRO A . n A 1 119 ALA 119 111 111 ALA ALA A . n A 1 120 ALA 120 112 112 ALA ALA A . n A 1 121 SER 121 113 113 SER SER A . n A 1 122 VAL 122 114 114 VAL VAL A . n A 1 123 GLU 123 115 115 GLU GLU A . n A 1 124 GLU 124 116 116 GLU GLU A . n A 1 125 THR 125 117 117 THR THR A . n A 1 126 ALA 126 118 118 ALA ALA A . n A 1 127 ASP 127 119 119 ASP ASP A . n A 1 128 SER 128 120 120 SER SER A . n A 1 129 THR 129 121 121 THR THR A . n A 1 130 LEU 130 122 122 LEU LEU A . n A 1 131 CYS 131 123 123 CYS CYS A . n A 1 132 HIS 132 124 124 HIS HIS A . n A 1 133 ILE 133 125 125 ILE ILE A . n A 1 134 LEU 134 126 126 LEU LEU A . n A 1 135 ASN 135 127 127 ASN ASN A . n A 1 136 LEU 136 128 128 LEU LEU A . n A 1 137 TYR 137 129 129 TYR TYR A . n A 1 138 ARG 138 130 130 ARG ARG A . n A 1 139 ARG 139 131 131 ARG ARG A . n A 1 140 THR 140 132 132 THR THR A . n A 1 141 THR 141 133 133 THR THR A . n A 1 142 TRP 142 134 134 TRP TRP A . n A 1 143 LEU 143 135 135 LEU LEU A . n A 1 144 HIS 144 136 136 HIS HIS A . n A 1 145 GLN 145 137 137 GLN GLN A . n A 1 146 ALA 146 138 138 ALA ALA A . n A 1 147 LEU 147 139 139 LEU LEU A . n A 1 148 ARG 148 140 140 ARG ARG A . n A 1 149 GLU 149 141 141 GLU GLU A . n A 1 150 GLY 150 142 142 GLY GLY A . n A 1 151 THR 151 143 143 THR THR A . n A 1 152 ARG 152 144 144 ARG ARG A . n A 1 153 VAL 153 145 145 VAL VAL A . n A 1 154 GLN 154 146 146 GLN GLN A . n A 1 155 SER 155 147 147 SER SER A . n A 1 156 VAL 156 148 148 VAL VAL A . n A 1 157 GLU 157 149 149 GLU GLU A . n A 1 158 GLN 158 150 150 GLN GLN A . n A 1 159 ILE 159 151 151 ILE ILE A . n A 1 160 ARG 160 152 152 ARG ARG A . n A 1 161 GLU 161 153 153 GLU GLU A . n A 1 162 VAL 162 154 154 VAL VAL A . n A 1 163 ALA 163 155 155 ALA ALA A . n A 1 164 SER 164 156 156 SER SER A . n A 1 165 GLY 165 157 157 GLY GLY A . n A 1 166 ALA 166 158 158 ALA ALA A . n A 1 167 ALA 167 159 159 ALA ALA A . n A 1 168 ARG 168 160 160 ARG ARG A . n A 1 169 ILE 169 161 161 ILE ILE A . n A 1 170 ARG 170 162 162 ARG ARG A . n A 1 171 GLY 171 163 163 GLY GLY A . n A 1 172 GLU 172 164 164 GLU GLU A . n A 1 173 THR 173 165 165 THR THR A . n A 1 174 LEU 174 166 166 LEU LEU A . n A 1 175 GLY 175 167 167 GLY GLY A . n A 1 176 ILE 176 168 168 ILE ILE A . n A 1 177 ILE 177 169 169 ILE ILE A . n A 1 178 GLY 178 170 170 GLY GLY A . n A 1 179 LEU 179 171 171 LEU LEU A . n A 1 180 GLU 180 172 172 GLU GLU A . n A 1 181 ARG 181 173 173 ARG ARG A . n A 1 182 VAL 182 174 174 VAL VAL A . n A 1 183 GLY 183 175 175 GLY GLY A . n A 1 184 GLN 184 176 176 GLN GLN A . n A 1 185 ALA 185 177 177 ALA ALA A . n A 1 186 VAL 186 178 178 VAL VAL A . n A 1 187 ALA 187 179 179 ALA ALA A . n A 1 188 LEU 188 180 180 LEU LEU A . n A 1 189 ARG 189 181 181 ARG ARG A . n A 1 190 ALA 190 182 182 ALA ALA A . n A 1 191 LYS 191 183 183 LYS LYS A . n A 1 192 ALA 192 184 184 ALA ALA A . n A 1 193 PHE 193 185 185 PHE PHE A . n A 1 194 GLY 194 186 186 GLY GLY A . n A 1 195 PHE 195 187 187 PHE PHE A . n A 1 196 ASN 196 188 188 ASN ASN A . n A 1 197 VAL 197 189 189 VAL VAL A . n A 1 198 LEU 198 190 190 LEU LEU A . n A 1 199 PHE 199 191 191 PHE PHE A . n A 1 200 TYR 200 192 192 TYR TYR A . n A 1 201 ASP 201 193 193 ASP ASP A . n A 1 202 PRO 202 194 194 PRO PRO A . n A 1 203 TYR 203 195 195 TYR TYR A . n A 1 204 LEU 204 196 196 LEU LEU A . n A 1 205 SER 205 197 197 SER SER A . n A 1 206 ASP 206 198 198 ASP ASP A . n A 1 207 GLY 207 199 199 GLY GLY A . n A 1 208 ILE 208 200 200 ILE ILE A . n A 1 209 GLU 209 201 201 GLU GLU A . n A 1 210 ARG 210 202 202 ARG ARG A . n A 1 211 ALA 211 203 203 ALA ALA A . n A 1 212 LEU 212 204 204 LEU LEU A . n A 1 213 GLY 213 205 205 GLY GLY A . n A 1 214 LEU 214 206 206 LEU LEU A . n A 1 215 GLN 215 207 207 GLN GLN A . n A 1 216 ARG 216 208 208 ARG ARG A . n A 1 217 VAL 217 209 209 VAL VAL A . n A 1 218 SER 218 210 210 SER SER A . n A 1 219 THR 219 211 211 THR THR A . n A 1 220 LEU 220 212 212 LEU LEU A . n A 1 221 GLN 221 213 213 GLN GLN A . n A 1 222 ASP 222 214 214 ASP ASP A . n A 1 223 LEU 223 215 215 LEU LEU A . n A 1 224 LEU 224 216 216 LEU LEU A . n A 1 225 PHE 225 217 217 PHE PHE A . n A 1 226 HIS 226 218 218 HIS HIS A . n A 1 227 SER 227 219 219 SER SER A . n A 1 228 ASP 228 220 220 ASP ASP A . n A 1 229 CYS 229 221 221 CYS CYS A . n A 1 230 VAL 230 222 222 VAL VAL A . n A 1 231 THR 231 223 223 THR THR A . n A 1 232 LEU 232 224 224 LEU LEU A . n A 1 233 HIS 233 225 225 HIS HIS A . n A 1 234 CYS 234 226 226 CYS CYS A . n A 1 235 GLY 235 227 227 GLY GLY A . n A 1 236 LEU 236 228 228 LEU LEU A . n A 1 237 ASN 237 229 229 ASN ASN A . n A 1 238 GLU 238 230 230 GLU GLU A . n A 1 239 HIS 239 231 231 HIS HIS A . n A 1 240 ASN 240 232 232 ASN ASN A . n A 1 241 HIS 241 233 233 HIS HIS A . n A 1 242 HIS 242 234 234 HIS HIS A . n A 1 243 LEU 243 235 235 LEU LEU A . n A 1 244 ILE 244 236 236 ILE ILE A . n A 1 245 ASN 245 237 237 ASN ASN A . n A 1 246 ASP 246 238 238 ASP ASP A . n A 1 247 PHE 247 239 239 PHE PHE A . n A 1 248 THR 248 240 240 THR THR A . n A 1 249 VAL 249 241 241 VAL VAL A . n A 1 250 LYS 250 242 242 LYS LYS A . n A 1 251 GLN 251 243 243 GLN GLN A . n A 1 252 MET 252 244 244 MET MET A . n A 1 253 ARG 253 245 245 ARG ARG A . n A 1 254 GLN 254 246 246 GLN GLN A . n A 1 255 GLY 255 247 247 GLY GLY A . n A 1 256 ALA 256 248 248 ALA ALA A . n A 1 257 PHE 257 249 249 PHE PHE A . n A 1 258 LEU 258 250 250 LEU LEU A . n A 1 259 VAL 259 251 251 VAL VAL A . n A 1 260 ASN 260 252 252 ASN ASN A . n A 1 261 THR 261 253 253 THR THR A . n A 1 262 ALA 262 254 254 ALA ALA A . n A 1 263 ARG 263 255 255 ARG ARG A . n A 1 264 GLY 264 256 256 GLY GLY A . n A 1 265 GLY 265 257 257 GLY GLY A . n A 1 266 LEU 266 258 258 LEU LEU A . n A 1 267 VAL 267 259 259 VAL VAL A . n A 1 268 ASP 268 260 260 ASP ASP A . n A 1 269 GLU 269 261 261 GLU GLU A . n A 1 270 LYS 270 262 262 LYS LYS A . n A 1 271 ALA 271 263 263 ALA ALA A . n A 1 272 LEU 272 264 264 LEU LEU A . n A 1 273 ALA 273 265 265 ALA ALA A . n A 1 274 GLN 274 266 266 GLN GLN A . n A 1 275 ALA 275 267 267 ALA ALA A . n A 1 276 LEU 276 268 268 LEU LEU A . n A 1 277 LYS 277 269 269 LYS LYS A . n A 1 278 GLU 278 270 270 GLU GLU A . n A 1 279 GLY 279 271 271 GLY GLY A . n A 1 280 ARG 280 272 272 ARG ARG A . n A 1 281 ILE 281 273 273 ILE ILE A . n A 1 282 ARG 282 274 274 ARG ARG A . n A 1 283 GLY 283 275 275 GLY GLY A . n A 1 284 ALA 284 276 276 ALA ALA A . n A 1 285 ALA 285 277 277 ALA ALA A . n A 1 286 LEU 286 278 278 LEU LEU A . n A 1 287 ASP 287 279 279 ASP ASP A . n A 1 288 VAL 288 280 280 VAL VAL A . n A 1 289 HIS 289 281 281 HIS HIS A . n A 1 290 GLU 290 282 282 GLU GLU A . n A 1 291 SER 291 283 283 SER SER A . n A 1 292 GLU 292 284 284 GLU GLU A . n A 1 293 PRO 293 285 285 PRO PRO A . n A 1 294 PHE 294 286 286 PHE PHE A . n A 1 295 SER 295 287 287 SER SER A . n A 1 296 PHE 296 288 288 PHE PHE A . n A 1 297 SER 297 289 289 SER SER A . n A 1 298 GLN 298 290 290 GLN GLN A . n A 1 299 GLY 299 291 291 GLY GLY A . n A 1 300 PRO 300 292 292 PRO PRO A . n A 1 301 LEU 301 293 293 LEU LEU A . n A 1 302 LYS 302 294 294 LYS LYS A . n A 1 303 ASP 303 295 295 ASP ASP A . n A 1 304 ALA 304 296 296 ALA ALA A . n A 1 305 PRO 305 297 297 PRO PRO A . n A 1 306 ASN 306 298 298 ASN ASN A . n A 1 307 LEU 307 299 299 LEU LEU A . n A 1 308 ILE 308 300 300 ILE ILE A . n A 1 309 CYS 309 301 301 CYS CYS A . n A 1 310 THR 310 302 302 THR THR A . n A 1 311 PRO 311 303 303 PRO PRO A . n A 1 312 HIS 312 304 304 HIS HIS A . n A 1 313 ALA 313 305 305 ALA ALA A . n A 1 314 ALA 314 306 306 ALA ALA A . n A 1 315 TRP 315 307 307 TRP TRP A . n A 1 316 TYR 316 308 308 TYR TYR A . n A 1 317 SER 317 309 309 SER SER A . n A 1 318 GLU 318 310 310 GLU GLU A . n A 1 319 GLN 319 311 311 GLN GLN A . n A 1 320 ALA 320 312 312 ALA ALA A . n A 1 321 SER 321 313 313 SER SER A . n A 1 322 ILE 322 314 314 ILE ILE A . n A 1 323 GLU 323 315 315 GLU GLU A . n A 1 324 MET 324 316 316 MET MET A . n A 1 325 ARG 325 317 317 ARG ARG A . n A 1 326 GLU 326 318 318 GLU GLU A . n A 1 327 GLU 327 319 319 GLU GLU A . n A 1 328 ALA 328 320 320 ALA ALA A . n A 1 329 ALA 329 321 321 ALA ALA A . n A 1 330 ARG 330 322 322 ARG ARG A . n A 1 331 GLU 331 323 323 GLU GLU A . n A 1 332 ILE 332 324 324 ILE ILE A . n A 1 333 ARG 333 325 325 ARG ARG A . n A 1 334 ARG 334 326 326 ARG ARG A . n A 1 335 ALA 335 327 327 ALA ALA A . n A 1 336 ILE 336 328 328 ILE ILE A . n A 1 337 THR 337 329 329 THR THR A . n A 1 338 GLY 338 330 330 GLY GLY A . n A 1 339 ARG 339 331 331 ARG ARG A . n A 1 340 ILE 340 332 332 ILE ILE A . n A 1 341 PRO 341 333 333 PRO PRO A . n A 1 342 ASP 342 334 334 ASP ASP A . n A 1 343 SER 343 335 335 SER SER A . n A 1 344 LEU 344 336 336 LEU LEU A . n A 1 345 LYS 345 337 337 LYS LYS A . n A 1 346 ASN 346 338 338 ASN ASN A . n A 1 347 CYS 347 339 339 CYS CYS A . n A 1 348 VAL 348 340 340 VAL VAL A . n A 1 349 ASN 349 341 341 ASN ASN A . n A 1 350 LYS 350 342 342 LYS LYS A . n A 1 351 ASP 351 343 343 ASP ASP A . n A 1 352 HIS 352 344 344 HIS HIS A . n A 1 353 LEU 353 345 345 LEU LEU A . n A 1 354 THR 354 346 346 THR THR A . n A 1 355 ALA 355 347 ? ? ? A . n A 1 356 ALA 356 348 ? ? ? A . n A 1 357 THR 357 349 ? ? ? A . n A 1 358 HIS 358 350 ? ? ? A . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D 2 1,2 A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 6540 ? 2 MORE -25.1 ? 2 'SSA (A^2)' 28670 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 11_555 -x+y,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-04-21 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MOLREP phasing . ? 1 REFMAC refinement 5.2.0019 ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 14 ? ? -139.42 -74.37 2 1 PRO A 15 ? ? -18.01 -87.25 3 1 ASP A 44 ? ? 37.93 43.99 4 1 TYR A 65 ? ? -103.67 -144.54 5 1 GLU A 141 ? ? -74.90 29.03 6 1 GLN A 146 ? ? -134.45 -65.20 7 1 ARG A 173 ? ? 47.01 -126.35 8 1 ALA A 254 ? ? -65.74 -142.02 9 1 ASP A 260 ? ? -67.19 90.76 10 1 GLU A 282 ? ? -68.72 83.41 11 1 SER A 283 ? ? 179.05 91.95 12 1 PRO A 285 ? ? 0.37 -71.08 13 1 SER A 287 ? ? -164.96 -154.37 14 1 PHE A 288 ? ? 63.26 -26.13 15 1 ASP A 295 ? ? 59.66 18.93 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 GLY A 11 ? ? PRO A 12 ? ? -138.67 2 1 MET A 13 ? ? HIS A 14 ? ? -146.61 3 1 HIS A 14 ? ? PRO A 15 ? ? -139.09 4 1 ARG A 16 ? ? PRO A 17 ? ? -143.24 5 1 SER A 283 ? ? GLU A 284 ? ? -141.76 6 1 PHE A 286 ? ? SER A 287 ? ? 142.54 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -7 ? A MET 1 2 1 Y 1 A GLY -6 ? A GLY 2 3 1 Y 1 A HIS -5 ? A HIS 3 4 1 Y 1 A HIS -4 ? A HIS 4 5 1 Y 1 A HIS -3 ? A HIS 5 6 1 Y 1 A HIS -2 ? A HIS 6 7 1 Y 1 A HIS -1 ? A HIS 7 8 1 Y 1 A HIS 0 ? A HIS 8 9 1 Y 1 A MET 1 ? A MET 9 10 1 Y 1 A SER 2 ? A SER 10 11 1 Y 1 A GLY 3 ? A GLY 11 12 1 Y 1 A VAL 4 ? A VAL 12 13 1 Y 1 A ARG 5 ? A ARG 13 14 1 Y 1 A PRO 6 ? A PRO 14 15 1 Y 1 A PRO 7 ? A PRO 15 16 1 Y 1 A ILE 8 ? A ILE 16 17 1 Y 1 A MET 9 ? A MET 17 18 1 Y 1 A ALA 347 ? A ALA 355 19 1 Y 1 A ALA 348 ? A ALA 356 20 1 Y 1 A THR 349 ? A THR 357 21 1 Y 1 A HIS 350 ? A HIS 358 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FORMIC ACID' FMT 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FMT 1 800 800 FMT FMT A . C 2 FMT 1 801 801 FMT FMT A . D 3 HOH 1 351 1 HOH HOH A . #