data_3GA2 # _entry.id 3GA2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3GA2 pdb_00003ga2 10.2210/pdb3ga2/pdb RCSB RCSB051612 ? ? WWPDB D_1000051612 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id SR604 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3GA2 _pdbx_database_status.recvd_initial_deposition_date 2009-02-16 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Forouhar, F.' 1 'Abashidze, M.' 2 'Hussain, M.' 3 'Seetharaman, J.' 4 'Janjua, H.' 5 'Fang, Y.' 6 'Xiao, R.' 7 'Cunningham, K.' 8 'Ma, L.-C.' 9 'Owens, L.' 10 'Wang, D.' 11 'Everett, J.K.' 12 'Nair, R.' 13 'Acton, T.B.' 14 'Rost, B.' 15 'Montelione, G.T.' 16 'Tong, L.' 17 'Hunt, J.F.' 18 'Northeast Structural Genomics Consortium (NESG)' 19 # _citation.id primary _citation.title 'Crystal structure of the Endonuclease_V (BSU36170) from Bacillus subtilis, Northeast Structural Genomics Consortium Target SR624' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Forouhar, F.' 1 ? primary 'Abashidze, M.' 2 ? primary 'Hussain, M.' 3 ? primary 'Seetharaman, J.' 4 ? primary 'Janjua, H.' 5 ? primary 'Fang, Y.' 6 ? primary 'Xiao, R.' 7 ? primary 'Cunningham, K.' 8 ? primary 'Ma, L.-C.' 9 ? primary 'Owens, L.' 10 ? primary 'Wang, D.' 11 ? primary 'Everett, J.K.' 12 ? primary 'Nair, R.' 13 ? primary 'Acton, T.B.' 14 ? primary 'Rost, B.' 15 ? primary 'Montelione, G.T.' 16 ? primary 'Tong, L.' 17 ? primary 'Hunt, J.F.' 18 ? # _cell.entry_id 3GA2 _cell.length_a 61.806 _cell.length_b 83.861 _cell.length_c 52.287 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3GA2 _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Endonuclease V' 28359.732 1 3.1.21.7 G42T ? ? 2 water nat water 18.015 152 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Deoxyinosine 3'endonuclease, Deoxyribonuclease V, DNase V ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)KVFDVHKFD(MSE)KKEQDFLQVQFNLKNRINLSPTIHPDSINTTAGVDLAYWEQDGEPYGVCCIIVIDADTKEV IEKVHS(MSE)GRISVPYVSGFLAFRELPLIIEAAKKLETEPDVFLFDGNGYLHYNH(MSE)GVATHAAFFLGKPTIGIA KTYLKIKGCDFVTPEIEVGAYTDIIIDGEVYGRALRTRRDVKPIFLSCGNYIDLDSSYQIT(MSE)SLINQESRLPIPVR LADLETHVLRTFYQKNHVLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MKVFDVHKFDMKKEQDFLQVQFNLKNRINLSPTIHPDSINTTAGVDLAYWEQDGEPYGVCCIIVIDADTKEVIEKVHSMG RISVPYVSGFLAFRELPLIIEAAKKLETEPDVFLFDGNGYLHYNHMGVATHAAFFLGKPTIGIAKTYLKIKGCDFVTPEI EVGAYTDIIIDGEVYGRALRTRRDVKPIFLSCGNYIDLDSSYQITMSLINQESRLPIPVRLADLETHVLRTFYQKNHVLE HHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SR604 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 LYS n 1 3 VAL n 1 4 PHE n 1 5 ASP n 1 6 VAL n 1 7 HIS n 1 8 LYS n 1 9 PHE n 1 10 ASP n 1 11 MSE n 1 12 LYS n 1 13 LYS n 1 14 GLU n 1 15 GLN n 1 16 ASP n 1 17 PHE n 1 18 LEU n 1 19 GLN n 1 20 VAL n 1 21 GLN n 1 22 PHE n 1 23 ASN n 1 24 LEU n 1 25 LYS n 1 26 ASN n 1 27 ARG n 1 28 ILE n 1 29 ASN n 1 30 LEU n 1 31 SER n 1 32 PRO n 1 33 THR n 1 34 ILE n 1 35 HIS n 1 36 PRO n 1 37 ASP n 1 38 SER n 1 39 ILE n 1 40 ASN n 1 41 THR n 1 42 THR n 1 43 ALA n 1 44 GLY n 1 45 VAL n 1 46 ASP n 1 47 LEU n 1 48 ALA n 1 49 TYR n 1 50 TRP n 1 51 GLU n 1 52 GLN n 1 53 ASP n 1 54 GLY n 1 55 GLU n 1 56 PRO n 1 57 TYR n 1 58 GLY n 1 59 VAL n 1 60 CYS n 1 61 CYS n 1 62 ILE n 1 63 ILE n 1 64 VAL n 1 65 ILE n 1 66 ASP n 1 67 ALA n 1 68 ASP n 1 69 THR n 1 70 LYS n 1 71 GLU n 1 72 VAL n 1 73 ILE n 1 74 GLU n 1 75 LYS n 1 76 VAL n 1 77 HIS n 1 78 SER n 1 79 MSE n 1 80 GLY n 1 81 ARG n 1 82 ILE n 1 83 SER n 1 84 VAL n 1 85 PRO n 1 86 TYR n 1 87 VAL n 1 88 SER n 1 89 GLY n 1 90 PHE n 1 91 LEU n 1 92 ALA n 1 93 PHE n 1 94 ARG n 1 95 GLU n 1 96 LEU n 1 97 PRO n 1 98 LEU n 1 99 ILE n 1 100 ILE n 1 101 GLU n 1 102 ALA n 1 103 ALA n 1 104 LYS n 1 105 LYS n 1 106 LEU n 1 107 GLU n 1 108 THR n 1 109 GLU n 1 110 PRO n 1 111 ASP n 1 112 VAL n 1 113 PHE n 1 114 LEU n 1 115 PHE n 1 116 ASP n 1 117 GLY n 1 118 ASN n 1 119 GLY n 1 120 TYR n 1 121 LEU n 1 122 HIS n 1 123 TYR n 1 124 ASN n 1 125 HIS n 1 126 MSE n 1 127 GLY n 1 128 VAL n 1 129 ALA n 1 130 THR n 1 131 HIS n 1 132 ALA n 1 133 ALA n 1 134 PHE n 1 135 PHE n 1 136 LEU n 1 137 GLY n 1 138 LYS n 1 139 PRO n 1 140 THR n 1 141 ILE n 1 142 GLY n 1 143 ILE n 1 144 ALA n 1 145 LYS n 1 146 THR n 1 147 TYR n 1 148 LEU n 1 149 LYS n 1 150 ILE n 1 151 LYS n 1 152 GLY n 1 153 CYS n 1 154 ASP n 1 155 PHE n 1 156 VAL n 1 157 THR n 1 158 PRO n 1 159 GLU n 1 160 ILE n 1 161 GLU n 1 162 VAL n 1 163 GLY n 1 164 ALA n 1 165 TYR n 1 166 THR n 1 167 ASP n 1 168 ILE n 1 169 ILE n 1 170 ILE n 1 171 ASP n 1 172 GLY n 1 173 GLU n 1 174 VAL n 1 175 TYR n 1 176 GLY n 1 177 ARG n 1 178 ALA n 1 179 LEU n 1 180 ARG n 1 181 THR n 1 182 ARG n 1 183 ARG n 1 184 ASP n 1 185 VAL n 1 186 LYS n 1 187 PRO n 1 188 ILE n 1 189 PHE n 1 190 LEU n 1 191 SER n 1 192 CYS n 1 193 GLY n 1 194 ASN n 1 195 TYR n 1 196 ILE n 1 197 ASP n 1 198 LEU n 1 199 ASP n 1 200 SER n 1 201 SER n 1 202 TYR n 1 203 GLN n 1 204 ILE n 1 205 THR n 1 206 MSE n 1 207 SER n 1 208 LEU n 1 209 ILE n 1 210 ASN n 1 211 GLN n 1 212 GLU n 1 213 SER n 1 214 ARG n 1 215 LEU n 1 216 PRO n 1 217 ILE n 1 218 PRO n 1 219 VAL n 1 220 ARG n 1 221 LEU n 1 222 ALA n 1 223 ASP n 1 224 LEU n 1 225 GLU n 1 226 THR n 1 227 HIS n 1 228 VAL n 1 229 LEU n 1 230 ARG n 1 231 THR n 1 232 PHE n 1 233 TYR n 1 234 GLN n 1 235 LYS n 1 236 ASN n 1 237 HIS n 1 238 VAL n 1 239 LEU n 1 240 GLU n 1 241 HIS n 1 242 HIS n 1 243 HIS n 1 244 HIS n 1 245 HIS n 1 246 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'nfi, ywqL' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'str. 168' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NFI_BACSU _struct_ref.pdbx_db_accession P96724 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKVFDVHKFDMKKEQDFLQVQFNLKNRINLSPTIHPDSINTGAGVDLAYWEQDGEPYGVCCIIVIDADTKEVIEKVHSMG RISVPYVSGFLAFRELPLIIEAAKKLETEPDVFLFDGNGYLHYNHMGVATHAAFFLGKPTIGIAKTYLKIKGCDFVTPEI EVGAYTDIIIDGEVYGRALRTRRDVKPIFLSCGNYIDLDSSYQITMSLINQESRLPIPVRLADLETHVLRTFYQKNHV ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3GA2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 238 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P96724 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 238 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 238 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3GA2 THR A 42 ? UNP P96724 GLY 42 'engineered mutation' 42 1 1 3GA2 LEU A 239 ? UNP P96724 ? ? 'expression tag' 239 2 1 3GA2 GLU A 240 ? UNP P96724 ? ? 'expression tag' 240 3 1 3GA2 HIS A 241 ? UNP P96724 ? ? 'expression tag' 241 4 1 3GA2 HIS A 242 ? UNP P96724 ? ? 'expression tag' 242 5 1 3GA2 HIS A 243 ? UNP P96724 ? ? 'expression tag' 243 6 1 3GA2 HIS A 244 ? UNP P96724 ? ? 'expression tag' 244 7 1 3GA2 HIS A 245 ? UNP P96724 ? ? 'expression tag' 245 8 1 3GA2 HIS A 246 ? UNP P96724 ? ? 'expression tag' 246 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3GA2 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.39 _exptl_crystal.density_percent_sol 48.51 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details ;Protein solution: 10 mM Tris (pH 7.5), 100 mM sodium chloride, and 5 mM DTT. Reservoir solution: 16% PEG 3350 and 200 mM ammonium tartrate., VAPOR DIFFUSION, HANGING DROP, temperature 291K ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2007-08-10 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97902 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97902 # _reflns.entry_id 3GA2 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 30 _reflns.d_resolution_high 2.1 _reflns.number_obs 30177 _reflns.number_all 30730 _reflns.percent_possible_obs 98.2 _reflns.pdbx_Rmerge_I_obs 0.095 _reflns.pdbx_Rsym_value 0.065 _reflns.pdbx_netI_over_sigmaI 20.1 _reflns.B_iso_Wilson_estimate 6.0 _reflns.pdbx_redundancy 7.2 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_Rrim_I_all ? # _reflns_shell.d_res_high 2.1 _reflns_shell.d_res_low 2.18 _reflns_shell.percent_possible_all 88.2 _reflns_shell.Rmerge_I_obs 0.353 _reflns_shell.pdbx_Rsym_value 0.303 _reflns_shell.meanI_over_sigI_obs 3.8 _reflns_shell.pdbx_redundancy 5.3 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 3061 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? # _refine.entry_id 3GA2 _refine.ls_number_reflns_obs 26224 _refine.ls_number_reflns_all 30635 _refine.pdbx_ls_sigma_I 2.0 _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 98764.74 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.96 _refine.ls_d_res_high 2.10 _refine.ls_percent_reflns_obs 85.6 _refine.ls_R_factor_obs 0.200 _refine.ls_R_factor_all 0.202 _refine.ls_R_factor_R_work 0.200 _refine.ls_R_factor_R_free 0.243 _refine.ls_R_factor_R_free_error 0.005 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.7 _refine.ls_number_reflns_R_free 2555 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 26.2 _refine.aniso_B[1][1] -2.66 _refine.aniso_B[2][2] -5.32 _refine.aniso_B[3][3] 7.98 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.5 _refine.solvent_model_param_bsol 94.6304 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3GA2 _refine_analyze.Luzzati_coordinate_error_obs 0.22 _refine_analyze.Luzzati_sigma_a_obs 0.08 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.28 _refine_analyze.Luzzati_sigma_a_free 0.10 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1897 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 152 _refine_hist.number_atoms_total 2049 _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 19.96 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.005 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.2 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 23.0 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.68 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.d_res_high 2.10 _refine_ls_shell.d_res_low 2.17 _refine_ls_shell.number_reflns_R_work 1676 _refine_ls_shell.R_factor_R_work 0.195 _refine_ls_shell.percent_reflns_obs 61.1 _refine_ls_shell.R_factor_R_free 0.226 _refine_ls_shell.R_factor_R_free_error 0.016 _refine_ls_shell.percent_reflns_R_free 10.1 _refine_ls_shell.number_reflns_R_free 188 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 1676 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_obs ? # _struct.entry_id 3GA2 _struct.title 'Crystal structure of the Endonuclease_V (BSU36170) from Bacillus subtilis, Northeast Structural Genomics Consortium Target SR624' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3GA2 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;alpha-beta protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Cytoplasm, DNA damage, DNA repair, Endonuclease, Hydrolase, Magnesium, Nuclease ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 13 ? ASN A 26 ? LYS A 13 ASN A 26 1 ? 14 HELX_P HELX_P2 2 HIS A 35 ? ILE A 39 ? HIS A 35 ILE A 39 5 ? 5 HELX_P HELX_P3 3 PHE A 90 ? ARG A 94 ? PHE A 90 ARG A 94 5 ? 5 HELX_P HELX_P4 4 GLU A 95 ? LEU A 106 ? GLU A 95 LEU A 106 1 ? 12 HELX_P HELX_P5 5 GLY A 127 ? GLY A 137 ? GLY A 127 GLY A 137 1 ? 11 HELX_P HELX_P6 6 ASP A 197 ? LEU A 208 ? ASP A 197 LEU A 208 1 ? 12 HELX_P HELX_P7 7 PRO A 216 ? ASN A 236 ? PRO A 216 ASN A 236 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A MSE 1 C ? ? ? 1_555 A LYS 2 N ? ? A MSE 1 A LYS 2 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale2 covale both ? A ASP 10 C ? ? ? 1_555 A MSE 11 N ? ? A ASP 10 A MSE 11 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale3 covale both ? A MSE 11 C ? ? ? 1_555 A LYS 12 N ? ? A MSE 11 A LYS 12 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale4 covale both ? A SER 78 C ? ? ? 1_555 A MSE 79 N ? ? A SER 78 A MSE 79 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale5 covale both ? A MSE 79 C ? ? ? 1_555 A GLY 80 N ? ? A MSE 79 A GLY 80 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale6 covale both ? A HIS 125 C ? ? ? 1_555 A MSE 126 N ? ? A HIS 125 A MSE 126 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale7 covale both ? A MSE 126 C ? ? ? 1_555 A GLY 127 N ? ? A MSE 126 A GLY 127 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale8 covale both ? A THR 205 C ? ? ? 1_555 A MSE 206 N ? ? A THR 205 A MSE 206 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale9 covale both ? A MSE 206 C ? ? ? 1_555 A SER 207 N ? ? A MSE 206 A SER 207 1_555 ? ? ? ? ? ? ? 1.330 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 72 ? ARG A 81 ? VAL A 72 ARG A 81 A 2 GLU A 55 ? ASP A 66 ? GLU A 55 ASP A 66 A 3 THR A 41 ? GLN A 52 ? THR A 41 GLN A 52 A 4 PHE A 113 ? ASP A 116 ? PHE A 113 ASP A 116 A 5 THR A 140 ? ALA A 144 ? THR A 140 ALA A 144 A 6 ILE A 188 ? ASN A 194 ? ILE A 188 ASN A 194 A 7 GLU A 173 ? LEU A 179 ? GLU A 173 LEU A 179 A 8 TYR A 165 ? ILE A 170 ? TYR A 165 ILE A 170 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 74 ? O GLU A 74 N VAL A 64 ? N VAL A 64 A 2 3 O ILE A 65 ? O ILE A 65 N THR A 42 ? N THR A 42 A 3 4 N ALA A 43 ? N ALA A 43 O LEU A 114 ? O LEU A 114 A 4 5 N PHE A 115 ? N PHE A 115 O ILE A 141 ? O ILE A 141 A 5 6 N GLY A 142 ? N GLY A 142 O SER A 191 ? O SER A 191 A 6 7 O ILE A 188 ? O ILE A 188 N LEU A 179 ? N LEU A 179 A 7 8 O GLY A 176 ? O GLY A 176 N ILE A 168 ? N ILE A 168 # _database_PDB_matrix.entry_id 3GA2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3GA2 _atom_sites.fract_transf_matrix[1][1] 0.016180 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011924 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019125 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 MSE 11 11 11 MSE MSE A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 MSE 79 79 79 MSE MSE A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 TYR 120 120 120 TYR TYR A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 MSE 126 126 126 MSE MSE A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 TYR 147 147 147 TYR TYR A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 CYS 153 153 153 CYS CYS A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 PRO 158 158 158 PRO PRO A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 TYR 165 165 165 TYR TYR A . n A 1 166 THR 166 166 166 THR THR A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 TYR 175 175 175 TYR TYR A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 ARG 180 180 180 ARG ARG A . n A 1 181 THR 181 181 181 THR THR A . n A 1 182 ARG 182 182 182 ARG ARG A . n A 1 183 ARG 183 183 183 ARG ARG A . n A 1 184 ASP 184 184 184 ASP ASP A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 LYS 186 186 186 LYS LYS A . n A 1 187 PRO 187 187 187 PRO PRO A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 PHE 189 189 189 PHE PHE A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 SER 191 191 191 SER SER A . n A 1 192 CYS 192 192 192 CYS CYS A . n A 1 193 GLY 193 193 193 GLY GLY A . n A 1 194 ASN 194 194 194 ASN ASN A . n A 1 195 TYR 195 195 195 TYR TYR A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 ASP 197 197 197 ASP ASP A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 ASP 199 199 199 ASP ASP A . n A 1 200 SER 200 200 200 SER SER A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 TYR 202 202 202 TYR TYR A . n A 1 203 GLN 203 203 203 GLN GLN A . n A 1 204 ILE 204 204 204 ILE ILE A . n A 1 205 THR 205 205 205 THR THR A . n A 1 206 MSE 206 206 206 MSE MSE A . n A 1 207 SER 207 207 207 SER SER A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 ILE 209 209 209 ILE ILE A . n A 1 210 ASN 210 210 210 ASN ASN A . n A 1 211 GLN 211 211 211 GLN GLN A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 SER 213 213 213 SER SER A . n A 1 214 ARG 214 214 214 ARG ARG A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 PRO 216 216 216 PRO PRO A . n A 1 217 ILE 217 217 217 ILE ILE A . n A 1 218 PRO 218 218 218 PRO PRO A . n A 1 219 VAL 219 219 219 VAL VAL A . n A 1 220 ARG 220 220 220 ARG ARG A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 ASP 223 223 223 ASP ASP A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 GLU 225 225 225 GLU GLU A . n A 1 226 THR 226 226 226 THR THR A . n A 1 227 HIS 227 227 227 HIS HIS A . n A 1 228 VAL 228 228 228 VAL VAL A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 ARG 230 230 230 ARG ARG A . n A 1 231 THR 231 231 231 THR THR A . n A 1 232 PHE 232 232 232 PHE PHE A . n A 1 233 TYR 233 233 233 TYR TYR A . n A 1 234 GLN 234 234 234 GLN GLN A . n A 1 235 LYS 235 235 235 LYS LYS A . n A 1 236 ASN 236 236 236 ASN ASN A . n A 1 237 HIS 237 237 237 HIS HIS A . n A 1 238 VAL 238 238 ? ? ? A . n A 1 239 LEU 239 239 ? ? ? A . n A 1 240 GLU 240 240 ? ? ? A . n A 1 241 HIS 241 241 ? ? ? A . n A 1 242 HIS 242 242 ? ? ? A . n A 1 243 HIS 243 243 ? ? ? A . n A 1 244 HIS 244 244 ? ? ? A . n A 1 245 HIS 245 245 ? ? ? A . n A 1 246 HIS 246 246 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 301 HOH HOH A . B 2 HOH 2 302 302 HOH HOH A . B 2 HOH 3 303 303 HOH HOH A . B 2 HOH 4 304 304 HOH HOH A . B 2 HOH 5 305 305 HOH HOH A . B 2 HOH 6 306 306 HOH HOH A . B 2 HOH 7 307 307 HOH HOH A . B 2 HOH 8 308 308 HOH HOH A . B 2 HOH 9 309 309 HOH HOH A . B 2 HOH 10 310 310 HOH HOH A . B 2 HOH 11 311 311 HOH HOH A . B 2 HOH 12 312 312 HOH HOH A . B 2 HOH 13 313 313 HOH HOH A . B 2 HOH 14 314 314 HOH HOH A . B 2 HOH 15 315 315 HOH HOH A . B 2 HOH 16 316 316 HOH HOH A . B 2 HOH 17 317 317 HOH HOH A . B 2 HOH 18 318 318 HOH HOH A . B 2 HOH 19 319 319 HOH HOH A . B 2 HOH 20 320 320 HOH HOH A . B 2 HOH 21 321 321 HOH HOH A . B 2 HOH 22 322 322 HOH HOH A . B 2 HOH 23 323 323 HOH HOH A . B 2 HOH 24 324 324 HOH HOH A . B 2 HOH 25 325 325 HOH HOH A . B 2 HOH 26 326 326 HOH HOH A . B 2 HOH 27 327 327 HOH HOH A . B 2 HOH 28 328 328 HOH HOH A . B 2 HOH 29 329 329 HOH HOH A . B 2 HOH 30 330 330 HOH HOH A . B 2 HOH 31 331 331 HOH HOH A . B 2 HOH 32 332 332 HOH HOH A . B 2 HOH 33 333 333 HOH HOH A . B 2 HOH 34 334 334 HOH HOH A . B 2 HOH 35 335 335 HOH HOH A . B 2 HOH 36 336 336 HOH HOH A . B 2 HOH 37 337 337 HOH HOH A . B 2 HOH 38 338 338 HOH HOH A . B 2 HOH 39 339 339 HOH HOH A . B 2 HOH 40 340 340 HOH HOH A . B 2 HOH 41 341 341 HOH HOH A . B 2 HOH 42 342 342 HOH HOH A . B 2 HOH 43 343 343 HOH HOH A . B 2 HOH 44 344 344 HOH HOH A . B 2 HOH 45 345 345 HOH HOH A . B 2 HOH 46 346 346 HOH HOH A . B 2 HOH 47 347 347 HOH HOH A . B 2 HOH 48 348 348 HOH HOH A . B 2 HOH 49 349 349 HOH HOH A . B 2 HOH 50 350 350 HOH HOH A . B 2 HOH 51 351 351 HOH HOH A . B 2 HOH 52 352 352 HOH HOH A . B 2 HOH 53 353 353 HOH HOH A . B 2 HOH 54 354 354 HOH HOH A . B 2 HOH 55 355 355 HOH HOH A . B 2 HOH 56 356 356 HOH HOH A . B 2 HOH 57 357 357 HOH HOH A . B 2 HOH 58 358 358 HOH HOH A . B 2 HOH 59 359 359 HOH HOH A . B 2 HOH 60 360 360 HOH HOH A . B 2 HOH 61 361 361 HOH HOH A . B 2 HOH 62 362 362 HOH HOH A . B 2 HOH 63 363 363 HOH HOH A . B 2 HOH 64 364 364 HOH HOH A . B 2 HOH 65 365 365 HOH HOH A . B 2 HOH 66 366 366 HOH HOH A . B 2 HOH 67 367 367 HOH HOH A . B 2 HOH 68 368 368 HOH HOH A . B 2 HOH 69 369 369 HOH HOH A . B 2 HOH 70 370 370 HOH HOH A . B 2 HOH 71 371 371 HOH HOH A . B 2 HOH 72 372 372 HOH HOH A . B 2 HOH 73 373 373 HOH HOH A . B 2 HOH 74 374 374 HOH HOH A . B 2 HOH 75 375 375 HOH HOH A . B 2 HOH 76 376 376 HOH HOH A . B 2 HOH 77 377 377 HOH HOH A . B 2 HOH 78 378 378 HOH HOH A . B 2 HOH 79 379 379 HOH HOH A . B 2 HOH 80 380 380 HOH HOH A . B 2 HOH 81 381 381 HOH HOH A . B 2 HOH 82 382 382 HOH HOH A . B 2 HOH 83 383 383 HOH HOH A . B 2 HOH 84 384 384 HOH HOH A . B 2 HOH 85 385 385 HOH HOH A . B 2 HOH 86 386 386 HOH HOH A . B 2 HOH 87 387 387 HOH HOH A . B 2 HOH 88 388 388 HOH HOH A . B 2 HOH 89 389 389 HOH HOH A . B 2 HOH 90 390 390 HOH HOH A . B 2 HOH 91 391 391 HOH HOH A . B 2 HOH 92 392 392 HOH HOH A . B 2 HOH 93 393 393 HOH HOH A . B 2 HOH 94 394 394 HOH HOH A . B 2 HOH 95 395 395 HOH HOH A . B 2 HOH 96 396 396 HOH HOH A . B 2 HOH 97 397 397 HOH HOH A . B 2 HOH 98 398 398 HOH HOH A . B 2 HOH 99 399 399 HOH HOH A . B 2 HOH 100 400 400 HOH HOH A . B 2 HOH 101 401 401 HOH HOH A . B 2 HOH 102 402 402 HOH HOH A . B 2 HOH 103 403 403 HOH HOH A . B 2 HOH 104 404 404 HOH HOH A . B 2 HOH 105 405 405 HOH HOH A . B 2 HOH 106 406 406 HOH HOH A . B 2 HOH 107 407 407 HOH HOH A . B 2 HOH 108 408 408 HOH HOH A . B 2 HOH 109 409 409 HOH HOH A . B 2 HOH 110 410 410 HOH HOH A . B 2 HOH 111 411 411 HOH HOH A . B 2 HOH 112 412 412 HOH HOH A . B 2 HOH 113 413 413 HOH HOH A . B 2 HOH 114 414 414 HOH HOH A . B 2 HOH 115 415 415 HOH HOH A . B 2 HOH 116 416 416 HOH HOH A . B 2 HOH 117 417 417 HOH HOH A . B 2 HOH 118 418 418 HOH HOH A . B 2 HOH 119 419 419 HOH HOH A . B 2 HOH 120 420 420 HOH HOH A . B 2 HOH 121 421 421 HOH HOH A . B 2 HOH 122 422 422 HOH HOH A . B 2 HOH 123 423 423 HOH HOH A . B 2 HOH 124 424 424 HOH HOH A . B 2 HOH 125 425 425 HOH HOH A . B 2 HOH 126 426 426 HOH HOH A . B 2 HOH 127 427 427 HOH HOH A . B 2 HOH 128 428 428 HOH HOH A . B 2 HOH 129 429 429 HOH HOH A . B 2 HOH 130 430 430 HOH HOH A . B 2 HOH 131 431 431 HOH HOH A . B 2 HOH 132 432 432 HOH HOH A . B 2 HOH 133 433 433 HOH HOH A . B 2 HOH 134 434 434 HOH HOH A . B 2 HOH 135 435 435 HOH HOH A . B 2 HOH 136 436 436 HOH HOH A . B 2 HOH 137 437 437 HOH HOH A . B 2 HOH 138 438 438 HOH HOH A . B 2 HOH 139 439 439 HOH HOH A . B 2 HOH 140 440 440 HOH HOH A . B 2 HOH 141 441 441 HOH HOH A . B 2 HOH 142 442 442 HOH HOH A . B 2 HOH 143 443 443 HOH HOH A . B 2 HOH 144 444 444 HOH HOH A . B 2 HOH 145 445 445 HOH HOH A . B 2 HOH 146 446 446 HOH HOH A . B 2 HOH 147 447 447 HOH HOH A . B 2 HOH 148 448 448 HOH HOH A . B 2 HOH 149 449 449 HOH HOH A . B 2 HOH 150 450 450 HOH HOH A . B 2 HOH 151 451 451 HOH HOH A . B 2 HOH 152 452 452 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 11 A MSE 11 ? MET SELENOMETHIONINE 3 A MSE 79 A MSE 79 ? MET SELENOMETHIONINE 4 A MSE 126 A MSE 126 ? MET SELENOMETHIONINE 5 A MSE 206 A MSE 206 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-02-24 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-11-01 4 'Structure model' 1 3 2018-01-24 5 'Structure model' 1 4 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Source and taxonomy' 5 4 'Structure model' 'Structure summary' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' audit_author 3 4 'Structure model' citation_author 4 4 'Structure model' entity_src_gen 5 5 'Structure model' database_2 6 5 'Structure model' struct_conn 7 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_audit_author.name' 2 4 'Structure model' '_citation_author.name' 3 4 'Structure model' '_entity_src_gen.pdbx_gene_src_gene' 4 5 'Structure model' '_database_2.pdbx_DOI' 5 5 'Structure model' '_database_2.pdbx_database_accession' 6 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 7 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal ADSC 'data collection' Quantum ? 1 SnB phasing 'then SOLVE/RESOLVE' ? 2 CNS refinement '1.2 & XtalView' ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 9 ? ? -112.72 57.97 2 1 LYS A 12 ? ? -110.54 -81.96 3 1 ASP A 184 ? ? 68.77 -24.52 4 1 GLU A 212 ? ? -131.53 -32.60 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 238 ? A VAL 238 2 1 Y 1 A LEU 239 ? A LEU 239 3 1 Y 1 A GLU 240 ? A GLU 240 4 1 Y 1 A HIS 241 ? A HIS 241 5 1 Y 1 A HIS 242 ? A HIS 242 6 1 Y 1 A HIS 243 ? A HIS 243 7 1 Y 1 A HIS 244 ? A HIS 244 8 1 Y 1 A HIS 245 ? A HIS 245 9 1 Y 1 A HIS 246 ? A HIS 246 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #