data_3GKT # _entry.id 3GKT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3GKT pdb_00003gkt 10.2210/pdb3gkt/pdb RCSB RCSB051985 ? ? WWPDB D_1000051985 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3GK9 . unspecified PDB 3GLN . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3GKT _pdbx_database_status.recvd_initial_deposition_date 2009-03-11 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Moschetti, T.' 1 'Mueller, U.' 2 'Schultze, J.' 3 'Brunori, M.' 4 'Vallone, B.' 5 # _citation.id primary _citation.title 'The structure of neuroglobin at high Xe and Kr pressure reveals partial conservation of globin internal cavities.' _citation.journal_abbrev 'Biophys. J.' _citation.journal_volume 97 _citation.page_first 1700 _citation.page_last 1708 _citation.year 2009 _citation.journal_id_ASTM BIOJAU _citation.country US _citation.journal_id_ISSN 1542-0086 _citation.journal_id_CSD 0030 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19751675 _citation.pdbx_database_id_DOI 10.1016/j.bpj.2009.05.059 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Moschetti, T.' 1 ? primary 'Mueller, U.' 2 ? primary 'Schulze, J.' 3 ? primary 'Brunori, M.' 4 ? primary 'Vallone, B.' 5 ? # _cell.entry_id 3GKT _cell.length_a 88.800 _cell.length_b 88.800 _cell.length_c 113.500 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 18 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3GKT _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Neuroglobin 17306.572 1 ? 'C55S, C120S' ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer syn KRYPTON 83.798 2 ? ? ? ? 4 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? 5 water nat water 18.015 75 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMERPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRQFSSPEDSLSSPEFLDHIRKVMLVIDAAVT NVEDLSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEKSLGPDFTPATRTAWSRLYGAVVQAMSRGWDGE ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMERPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRQFSSPEDSLSSPEFLDHIRKVMLVIDAAVT NVEDLSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEKSLGPDFTPATRTAWSRLYGAVVQAMSRGWDGE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLU n 1 6 ARG n 1 7 PRO n 1 8 GLU n 1 9 SER n 1 10 GLU n 1 11 LEU n 1 12 ILE n 1 13 ARG n 1 14 GLN n 1 15 SER n 1 16 TRP n 1 17 ARG n 1 18 VAL n 1 19 VAL n 1 20 SER n 1 21 ARG n 1 22 SER n 1 23 PRO n 1 24 LEU n 1 25 GLU n 1 26 HIS n 1 27 GLY n 1 28 THR n 1 29 VAL n 1 30 LEU n 1 31 PHE n 1 32 ALA n 1 33 ARG n 1 34 LEU n 1 35 PHE n 1 36 ALA n 1 37 LEU n 1 38 GLU n 1 39 PRO n 1 40 SER n 1 41 LEU n 1 42 LEU n 1 43 PRO n 1 44 LEU n 1 45 PHE n 1 46 GLN n 1 47 TYR n 1 48 ASN n 1 49 GLY n 1 50 ARG n 1 51 GLN n 1 52 PHE n 1 53 SER n 1 54 SER n 1 55 PRO n 1 56 GLU n 1 57 ASP n 1 58 SER n 1 59 LEU n 1 60 SER n 1 61 SER n 1 62 PRO n 1 63 GLU n 1 64 PHE n 1 65 LEU n 1 66 ASP n 1 67 HIS n 1 68 ILE n 1 69 ARG n 1 70 LYS n 1 71 VAL n 1 72 MET n 1 73 LEU n 1 74 VAL n 1 75 ILE n 1 76 ASP n 1 77 ALA n 1 78 ALA n 1 79 VAL n 1 80 THR n 1 81 ASN n 1 82 VAL n 1 83 GLU n 1 84 ASP n 1 85 LEU n 1 86 SER n 1 87 SER n 1 88 LEU n 1 89 GLU n 1 90 GLU n 1 91 TYR n 1 92 LEU n 1 93 THR n 1 94 SER n 1 95 LEU n 1 96 GLY n 1 97 ARG n 1 98 LYS n 1 99 HIS n 1 100 ARG n 1 101 ALA n 1 102 VAL n 1 103 GLY n 1 104 VAL n 1 105 ARG n 1 106 LEU n 1 107 SER n 1 108 SER n 1 109 PHE n 1 110 SER n 1 111 THR n 1 112 VAL n 1 113 GLY n 1 114 GLU n 1 115 SER n 1 116 LEU n 1 117 LEU n 1 118 TYR n 1 119 MET n 1 120 LEU n 1 121 GLU n 1 122 LYS n 1 123 SER n 1 124 LEU n 1 125 GLY n 1 126 PRO n 1 127 ASP n 1 128 PHE n 1 129 THR n 1 130 PRO n 1 131 ALA n 1 132 THR n 1 133 ARG n 1 134 THR n 1 135 ALA n 1 136 TRP n 1 137 SER n 1 138 ARG n 1 139 LEU n 1 140 TYR n 1 141 GLY n 1 142 ALA n 1 143 VAL n 1 144 VAL n 1 145 GLN n 1 146 ALA n 1 147 MET n 1 148 SER n 1 149 ARG n 1 150 GLY n 1 151 TRP n 1 152 ASP n 1 153 GLY n 1 154 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Ngb _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET14b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NGB_MOUSE _struct_ref.pdbx_db_accession Q9ER97 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MERPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVE DLSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEKCLGPDFTPATRTAWSRLYGAVVQAMSRGWDGE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3GKT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 154 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9ER97 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 151 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 151 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3GKT GLY A 1 ? UNP Q9ER97 ? ? 'expression tag' -2 1 1 3GKT SER A 2 ? UNP Q9ER97 ? ? 'expression tag' -1 2 1 3GKT HIS A 3 ? UNP Q9ER97 ? ? 'expression tag' 0 3 1 3GKT SER A 58 ? UNP Q9ER97 CYS 55 'engineered mutation' 55 4 1 3GKT SER A 123 ? UNP Q9ER97 CYS 120 'engineered mutation' 120 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 KR non-polymer . KRYPTON ? Kr 83.798 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3GKT _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.49 _exptl_crystal.density_percent_sol 50.56 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details '1.6M ammonium sulphate, 0.1M MES, pH6.5, 10% dioxane, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.pdbx_collection_date 2007-10-11 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.86437 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'BESSY BEAMLINE 14.1' _diffrn_source.pdbx_synchrotron_site BESSY _diffrn_source.pdbx_synchrotron_beamline 14.1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.86437 # _reflns.entry_id 3GKT _reflns.observed_criterion_sigma_I 3.0 _reflns.observed_criterion_sigma_F 3.0 _reflns.d_resolution_low 30 _reflns.d_resolution_high 1.86 _reflns.number_obs 14316 _reflns.number_all ? _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs 0.05 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 35.127 _reflns.pdbx_redundancy 6.17 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.86 _reflns_shell.d_res_low 2.1 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.35 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.03 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3GKT _refine.ls_number_reflns_obs 13599 _refine.ls_number_reflns_all 14315 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.55 _refine.ls_d_res_high 1.86 _refine.ls_percent_reflns_obs 100.00 _refine.ls_R_factor_obs 0.17451 _refine.ls_R_factor_all 0.256 _refine.ls_R_factor_R_work 0.17275 _refine.ls_R_factor_R_free 0.20839 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 716 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.964 _refine.correlation_coeff_Fo_to_Fc_free 0.950 _refine.B_iso_mean 28.535 _refine.aniso_B[1][1] -0.25 _refine.aniso_B[2][2] -0.25 _refine.aniso_B[3][3] 0.38 _refine.aniso_B[1][2] -0.13 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'PDB ENTRY 1Q1F' _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.134 _refine.pdbx_overall_ESU_R_Free 0.125 _refine.overall_SU_ML 0.086 _refine.overall_SU_B 5.186 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1149 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 50 _refine_hist.number_atoms_solvent 75 _refine_hist.number_atoms_total 1274 _refine_hist.d_res_high 1.86 _refine_hist.d_res_low 19.55 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.016 0.022 ? 1342 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.452 2.171 ? 1867 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 4.539 5.000 ? 166 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 31.319 23.000 ? 50 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 13.731 15.000 ? 211 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 14.071 15.000 ? 8 'X-RAY DIFFRACTION' ? r_chiral_restr 0.089 0.200 ? 193 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.020 ? 1029 'X-RAY DIFFRACTION' ? r_nbd_refined 0.218 0.200 ? 647 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.298 0.200 ? 906 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.269 0.200 ? 80 'X-RAY DIFFRACTION' ? r_metal_ion_refined 0.113 0.200 ? 1 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.166 0.200 ? 46 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.184 0.200 ? 20 'X-RAY DIFFRACTION' ? r_mcbond_it 0.761 1.500 ? 773 'X-RAY DIFFRACTION' ? r_mcangle_it 1.283 2.000 ? 1257 'X-RAY DIFFRACTION' ? r_scbond_it 2.033 3.000 ? 638 'X-RAY DIFFRACTION' ? r_scangle_it 2.807 4.500 ? 597 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.864 _refine_ls_shell.d_res_low 1.912 _refine_ls_shell.number_reflns_R_work 759 _refine_ls_shell.R_factor_R_work 0.210 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.R_factor_R_free 0.284 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 40 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3GKT _struct.title 'Crystal structure of murine neuroglobin under Kr pressure' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3GKT _struct_keywords.pdbx_keywords 'OXYGEN STORAGE/TRANSPORT PROTEIN' _struct_keywords.text 'Ngb, neuroglobin, Krypton, OXYGEN STORAGE-TRANSPORT PROTEIN COMPLEX, Heme, Iron, Metal-binding, Oxygen transport, Transport' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 7 ? ARG A 21 ? PRO A 4 ARG A 18 1 ? 15 HELX_P HELX_P2 2 SER A 22 ? GLU A 38 ? SER A 19 GLU A 35 1 ? 17 HELX_P HELX_P3 3 PRO A 39 ? PHE A 45 ? PRO A 36 PHE A 42 5 ? 7 HELX_P HELX_P4 4 SER A 54 ? SER A 60 ? SER A 51 SER A 57 1 ? 7 HELX_P HELX_P5 5 SER A 61 ? ASN A 81 ? SER A 58 ASN A 78 1 ? 21 HELX_P HELX_P6 6 ASP A 84 ? SER A 87 ? ASP A 81 SER A 84 5 ? 4 HELX_P HELX_P7 7 LEU A 88 ? GLY A 103 ? LEU A 85 GLY A 100 1 ? 16 HELX_P HELX_P8 8 SER A 107 ? GLY A 125 ? SER A 104 GLY A 122 1 ? 19 HELX_P HELX_P9 9 PRO A 126 ? PHE A 128 ? PRO A 123 PHE A 125 5 ? 3 HELX_P HELX_P10 10 THR A 129 ? ARG A 149 ? THR A 126 ARG A 146 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 67 NE2 A ? ? 1_555 E HEM . FE A ? A HIS 64 A HEM 155 1_555 ? ? ? ? ? ? ? 1.887 ? ? metalc2 metalc ? ? A HIS 67 NE2 B ? ? 1_555 E HEM . FE B ? A HIS 64 A HEM 155 1_555 ? ? ? ? ? ? ? 2.521 ? ? metalc3 metalc ? ? A HIS 99 NE2 A ? ? 1_555 E HEM . FE A ? A HIS 96 A HEM 155 1_555 ? ? ? ? ? ? ? 2.155 ? ? metalc4 metalc ? ? A HIS 99 NE2 B ? ? 1_555 E HEM . FE B ? A HIS 96 A HEM 155 1_555 ? ? ? ? ? ? ? 2.042 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 152 ? 5 'BINDING SITE FOR RESIDUE SO4 A 152' AC2 Software A KR 154 ? 6 'BINDING SITE FOR RESIDUE KR A 154' AC3 Software A HEM 155 ? 20 'BINDING SITE FOR RESIDUE HEM A 155' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 SER A 22 ? SER A 19 . ? 1_555 ? 2 AC1 5 PRO A 23 ? PRO A 20 . ? 1_555 ? 3 AC1 5 LEU A 24 ? LEU A 21 . ? 1_555 ? 4 AC1 5 GLU A 25 ? GLU A 22 . ? 1_555 ? 5 AC1 5 ARG A 69 ? ARG A 66 . ? 1_555 ? 6 AC2 6 PHE A 31 ? PHE A 28 . ? 1_555 ? 7 AC2 6 ALA A 32 ? ALA A 29 . ? 1_555 ? 8 AC2 6 PHE A 35 ? PHE A 32 . ? 1_555 ? 9 AC2 6 SER A 58 ? SER A 55 . ? 1_555 ? 10 AC2 6 LEU A 59 ? LEU A 56 . ? 1_555 ? 11 AC2 6 HOH F . ? HOH A 226 . ? 1_555 ? 12 AC3 20 LEU A 41 ? LEU A 38 . ? 1_555 ? 13 AC3 20 LEU A 44 ? LEU A 41 . ? 1_555 ? 14 AC3 20 PHE A 45 ? PHE A 42 . ? 1_555 ? 15 AC3 20 TYR A 47 ? TYR A 44 . ? 1_555 ? 16 AC3 20 HIS A 67 ? HIS A 64 . ? 1_555 ? 17 AC3 20 LYS A 70 ? LYS A 67 . ? 18_655 ? 18 AC3 20 LYS A 70 ? LYS A 67 . ? 1_555 ? 19 AC3 20 VAL A 71 ? VAL A 68 . ? 1_555 ? 20 AC3 20 VAL A 74 ? VAL A 71 . ? 1_555 ? 21 AC3 20 TYR A 91 ? TYR A 88 . ? 1_555 ? 22 AC3 20 LEU A 95 ? LEU A 92 . ? 1_555 ? 23 AC3 20 LYS A 98 ? LYS A 95 . ? 1_555 ? 24 AC3 20 HIS A 99 ? HIS A 96 . ? 1_555 ? 25 AC3 20 VAL A 104 ? VAL A 101 . ? 1_555 ? 26 AC3 20 PHE A 109 ? PHE A 106 . ? 1_555 ? 27 AC3 20 VAL A 112 ? VAL A 109 . ? 1_555 ? 28 AC3 20 HOH F . ? HOH A 173 . ? 1_555 ? 29 AC3 20 HOH F . ? HOH A 176 . ? 1_555 ? 30 AC3 20 HOH F . ? HOH A 176 . ? 18_655 ? 31 AC3 20 HOH F . ? HOH A 197 . ? 1_555 ? # _database_PDB_matrix.entry_id 3GKT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3GKT _atom_sites.fract_transf_matrix[1][1] 0.011261 _atom_sites.fract_transf_matrix[1][2] 0.006502 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013003 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008811 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE KR N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 ? ? ? A . n A 1 5 GLU 5 2 ? ? ? A . n A 1 6 ARG 6 3 3 ARG ARG A . n A 1 7 PRO 7 4 4 PRO PRO A . n A 1 8 GLU 8 5 5 GLU GLU A . n A 1 9 SER 9 6 6 SER SER A . n A 1 10 GLU 10 7 7 GLU GLU A . n A 1 11 LEU 11 8 8 LEU LEU A . n A 1 12 ILE 12 9 9 ILE ILE A . n A 1 13 ARG 13 10 10 ARG ARG A . n A 1 14 GLN 14 11 11 GLN GLN A . n A 1 15 SER 15 12 12 SER SER A . n A 1 16 TRP 16 13 13 TRP TRP A . n A 1 17 ARG 17 14 14 ARG ARG A . n A 1 18 VAL 18 15 15 VAL VAL A . n A 1 19 VAL 19 16 16 VAL VAL A . n A 1 20 SER 20 17 17 SER SER A . n A 1 21 ARG 21 18 18 ARG ARG A . n A 1 22 SER 22 19 19 SER SER A . n A 1 23 PRO 23 20 20 PRO PRO A . n A 1 24 LEU 24 21 21 LEU LEU A . n A 1 25 GLU 25 22 22 GLU GLU A . n A 1 26 HIS 26 23 23 HIS HIS A . n A 1 27 GLY 27 24 24 GLY GLY A . n A 1 28 THR 28 25 25 THR THR A . n A 1 29 VAL 29 26 26 VAL VAL A . n A 1 30 LEU 30 27 27 LEU LEU A . n A 1 31 PHE 31 28 28 PHE PHE A . n A 1 32 ALA 32 29 29 ALA ALA A . n A 1 33 ARG 33 30 30 ARG ARG A . n A 1 34 LEU 34 31 31 LEU LEU A . n A 1 35 PHE 35 32 32 PHE PHE A . n A 1 36 ALA 36 33 33 ALA ALA A . n A 1 37 LEU 37 34 34 LEU LEU A . n A 1 38 GLU 38 35 35 GLU GLU A . n A 1 39 PRO 39 36 36 PRO PRO A . n A 1 40 SER 40 37 37 SER SER A . n A 1 41 LEU 41 38 38 LEU LEU A . n A 1 42 LEU 42 39 39 LEU LEU A . n A 1 43 PRO 43 40 40 PRO PRO A . n A 1 44 LEU 44 41 41 LEU LEU A . n A 1 45 PHE 45 42 42 PHE PHE A . n A 1 46 GLN 46 43 43 GLN GLN A . n A 1 47 TYR 47 44 44 TYR TYR A . n A 1 48 ASN 48 45 45 ASN ASN A . n A 1 49 GLY 49 46 46 GLY GLY A . n A 1 50 ARG 50 47 47 ARG ARG A . n A 1 51 GLN 51 48 48 GLN GLN A . n A 1 52 PHE 52 49 49 PHE PHE A . n A 1 53 SER 53 50 50 SER SER A . n A 1 54 SER 54 51 51 SER SER A . n A 1 55 PRO 55 52 52 PRO PRO A . n A 1 56 GLU 56 53 53 GLU GLU A . n A 1 57 ASP 57 54 54 ASP ASP A . n A 1 58 SER 58 55 55 SER SER A . n A 1 59 LEU 59 56 56 LEU LEU A . n A 1 60 SER 60 57 57 SER SER A . n A 1 61 SER 61 58 58 SER SER A . n A 1 62 PRO 62 59 59 PRO PRO A . n A 1 63 GLU 63 60 60 GLU GLU A . n A 1 64 PHE 64 61 61 PHE PHE A . n A 1 65 LEU 65 62 62 LEU LEU A . n A 1 66 ASP 66 63 63 ASP ASP A . n A 1 67 HIS 67 64 64 HIS HIS A . n A 1 68 ILE 68 65 65 ILE ILE A . n A 1 69 ARG 69 66 66 ARG ARG A . n A 1 70 LYS 70 67 67 LYS LYS A . n A 1 71 VAL 71 68 68 VAL VAL A . n A 1 72 MET 72 69 69 MET MET A . n A 1 73 LEU 73 70 70 LEU LEU A . n A 1 74 VAL 74 71 71 VAL VAL A . n A 1 75 ILE 75 72 72 ILE ILE A . n A 1 76 ASP 76 73 73 ASP ASP A . n A 1 77 ALA 77 74 74 ALA ALA A . n A 1 78 ALA 78 75 75 ALA ALA A . n A 1 79 VAL 79 76 76 VAL VAL A . n A 1 80 THR 80 77 77 THR THR A . n A 1 81 ASN 81 78 78 ASN ASN A . n A 1 82 VAL 82 79 79 VAL VAL A . n A 1 83 GLU 83 80 80 GLU GLU A . n A 1 84 ASP 84 81 81 ASP ASP A . n A 1 85 LEU 85 82 82 LEU LEU A . n A 1 86 SER 86 83 83 SER SER A . n A 1 87 SER 87 84 84 SER SER A . n A 1 88 LEU 88 85 85 LEU LEU A . n A 1 89 GLU 89 86 86 GLU GLU A . n A 1 90 GLU 90 87 87 GLU GLU A . n A 1 91 TYR 91 88 88 TYR TYR A . n A 1 92 LEU 92 89 89 LEU LEU A . n A 1 93 THR 93 90 90 THR THR A . n A 1 94 SER 94 91 91 SER SER A . n A 1 95 LEU 95 92 92 LEU LEU A . n A 1 96 GLY 96 93 93 GLY GLY A . n A 1 97 ARG 97 94 94 ARG ARG A . n A 1 98 LYS 98 95 95 LYS LYS A . n A 1 99 HIS 99 96 96 HIS HIS A . n A 1 100 ARG 100 97 97 ARG ARG A . n A 1 101 ALA 101 98 98 ALA ALA A . n A 1 102 VAL 102 99 99 VAL VAL A . n A 1 103 GLY 103 100 100 GLY GLY A . n A 1 104 VAL 104 101 101 VAL VAL A . n A 1 105 ARG 105 102 102 ARG ARG A . n A 1 106 LEU 106 103 103 LEU LEU A . n A 1 107 SER 107 104 104 SER SER A . n A 1 108 SER 108 105 105 SER SER A . n A 1 109 PHE 109 106 106 PHE PHE A . n A 1 110 SER 110 107 107 SER SER A . n A 1 111 THR 111 108 108 THR THR A . n A 1 112 VAL 112 109 109 VAL VAL A . n A 1 113 GLY 113 110 110 GLY GLY A . n A 1 114 GLU 114 111 111 GLU GLU A . n A 1 115 SER 115 112 112 SER SER A . n A 1 116 LEU 116 113 113 LEU LEU A . n A 1 117 LEU 117 114 114 LEU LEU A . n A 1 118 TYR 118 115 115 TYR TYR A . n A 1 119 MET 119 116 116 MET MET A . n A 1 120 LEU 120 117 117 LEU LEU A . n A 1 121 GLU 121 118 118 GLU GLU A . n A 1 122 LYS 122 119 119 LYS LYS A . n A 1 123 SER 123 120 120 SER SER A . n A 1 124 LEU 124 121 121 LEU LEU A . n A 1 125 GLY 125 122 122 GLY GLY A . n A 1 126 PRO 126 123 123 PRO PRO A . n A 1 127 ASP 127 124 124 ASP ASP A . n A 1 128 PHE 128 125 125 PHE PHE A . n A 1 129 THR 129 126 126 THR THR A . n A 1 130 PRO 130 127 127 PRO PRO A . n A 1 131 ALA 131 128 128 ALA ALA A . n A 1 132 THR 132 129 129 THR THR A . n A 1 133 ARG 133 130 130 ARG ARG A . n A 1 134 THR 134 131 131 THR THR A . n A 1 135 ALA 135 132 132 ALA ALA A . n A 1 136 TRP 136 133 133 TRP TRP A . n A 1 137 SER 137 134 134 SER SER A . n A 1 138 ARG 138 135 135 ARG ARG A . n A 1 139 LEU 139 136 136 LEU LEU A . n A 1 140 TYR 140 137 137 TYR TYR A . n A 1 141 GLY 141 138 138 GLY GLY A . n A 1 142 ALA 142 139 139 ALA ALA A . n A 1 143 VAL 143 140 140 VAL VAL A . n A 1 144 VAL 144 141 141 VAL VAL A . n A 1 145 GLN 145 142 142 GLN GLN A . n A 1 146 ALA 146 143 143 ALA ALA A . n A 1 147 MET 147 144 144 MET MET A . n A 1 148 SER 148 145 145 SER SER A . n A 1 149 ARG 149 146 146 ARG ARG A . n A 1 150 GLY 150 147 147 GLY GLY A . n A 1 151 TRP 151 148 148 TRP TRP A . n A 1 152 ASP 152 149 149 ASP ASP A . n A 1 153 GLY 153 150 150 GLY GLY A . n A 1 154 GLU 154 151 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 152 1 SO4 SO4 A . C 3 KR 1 153 1 KR KR A . D 3 KR 1 154 2 KR KR A . E 4 HEM 1 155 1 HEM HEM A . F 5 HOH 1 156 1 HOH HOH A . F 5 HOH 2 157 2 HOH HOH A . F 5 HOH 3 158 3 HOH HOH A . F 5 HOH 4 159 4 HOH HOH A . F 5 HOH 5 160 5 HOH HOH A . F 5 HOH 6 161 6 HOH HOH A . F 5 HOH 7 162 7 HOH HOH A . F 5 HOH 8 163 8 HOH HOH A . F 5 HOH 9 164 9 HOH HOH A . F 5 HOH 10 165 10 HOH HOH A . F 5 HOH 11 166 11 HOH HOH A . F 5 HOH 12 167 12 HOH HOH A . F 5 HOH 13 168 13 HOH HOH A . F 5 HOH 14 169 14 HOH HOH A . F 5 HOH 15 170 15 HOH HOH A . F 5 HOH 16 171 16 HOH HOH A . F 5 HOH 17 172 17 HOH HOH A . F 5 HOH 18 173 18 HOH HOH A . F 5 HOH 19 174 19 HOH HOH A . F 5 HOH 20 175 20 HOH HOH A . F 5 HOH 21 176 21 HOH HOH A . F 5 HOH 22 177 22 HOH HOH A . F 5 HOH 23 178 23 HOH HOH A . F 5 HOH 24 179 24 HOH HOH A . F 5 HOH 25 180 25 HOH HOH A . F 5 HOH 26 181 26 HOH HOH A . F 5 HOH 27 182 27 HOH HOH A . F 5 HOH 28 183 28 HOH HOH A . F 5 HOH 29 184 29 HOH HOH A . F 5 HOH 30 185 30 HOH HOH A . F 5 HOH 31 186 31 HOH HOH A . F 5 HOH 32 187 32 HOH HOH A . F 5 HOH 33 188 33 HOH HOH A . F 5 HOH 34 189 34 HOH HOH A . F 5 HOH 35 190 35 HOH HOH A . F 5 HOH 36 191 36 HOH HOH A . F 5 HOH 37 192 37 HOH HOH A . F 5 HOH 38 193 38 HOH HOH A . F 5 HOH 39 194 39 HOH HOH A . F 5 HOH 40 195 40 HOH HOH A . F 5 HOH 41 196 41 HOH HOH A . F 5 HOH 42 197 42 HOH HOH A . F 5 HOH 43 198 43 HOH HOH A . F 5 HOH 44 199 44 HOH HOH A . F 5 HOH 45 200 45 HOH HOH A . F 5 HOH 46 201 46 HOH HOH A . F 5 HOH 47 202 47 HOH HOH A . F 5 HOH 48 203 48 HOH HOH A . F 5 HOH 49 204 49 HOH HOH A . F 5 HOH 50 205 50 HOH HOH A . F 5 HOH 51 206 51 HOH HOH A . F 5 HOH 52 207 52 HOH HOH A . F 5 HOH 53 208 53 HOH HOH A . F 5 HOH 54 209 54 HOH HOH A . F 5 HOH 55 210 55 HOH HOH A . F 5 HOH 56 211 56 HOH HOH A . F 5 HOH 57 212 57 HOH HOH A . F 5 HOH 58 213 58 HOH HOH A . F 5 HOH 59 214 59 HOH HOH A . F 5 HOH 60 215 60 HOH HOH A . F 5 HOH 61 216 61 HOH HOH A . F 5 HOH 62 217 62 HOH HOH A . F 5 HOH 63 218 63 HOH HOH A . F 5 HOH 64 219 64 HOH HOH A . F 5 HOH 65 220 65 HOH HOH A . F 5 HOH 66 221 66 HOH HOH A . F 5 HOH 67 222 67 HOH HOH A . F 5 HOH 68 223 68 HOH HOH A . F 5 HOH 69 224 69 HOH HOH A . F 5 HOH 70 225 70 HOH HOH A . F 5 HOH 71 226 71 HOH HOH A . F 5 HOH 72 227 72 HOH HOH A . F 5 HOH 73 228 73 HOH HOH A . F 5 HOH 74 229 74 HOH HOH A . F 5 HOH 75 230 75 HOH HOH A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F 2 1,2 A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 4760 ? 2 MORE -90 ? 2 'SSA (A^2)' 14220 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 18_655 -x+4/3,-x+y+2/3,-z+2/3 -0.5000000000 -0.8660254038 0.0000000000 88.8000000000 -0.8660254038 0.5000000000 0.0000000000 51.2687039040 0.0000000000 0.0000000000 -1.0000000000 75.6666666667 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 210 ? F HOH . 2 1 A HOH 217 ? F HOH . 3 1 A HOH 224 ? F HOH . 4 1 A HOH 225 ? F HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 A A HIS 67 ? A HIS 64 ? 1_555 FE A E HEM . ? A HEM 155 ? 1_555 NA A E HEM . ? A HEM 155 ? 1_555 76.0 ? 2 NE2 A A HIS 67 ? A HIS 64 ? 1_555 FE A E HEM . ? A HEM 155 ? 1_555 NB A E HEM . ? A HEM 155 ? 1_555 95.1 ? 3 NA A E HEM . ? A HEM 155 ? 1_555 FE A E HEM . ? A HEM 155 ? 1_555 NB A E HEM . ? A HEM 155 ? 1_555 85.2 ? 4 NE2 A A HIS 67 ? A HIS 64 ? 1_555 FE A E HEM . ? A HEM 155 ? 1_555 NC A E HEM . ? A HEM 155 ? 1_555 103.9 ? 5 NA A E HEM . ? A HEM 155 ? 1_555 FE A E HEM . ? A HEM 155 ? 1_555 NC A E HEM . ? A HEM 155 ? 1_555 179.4 ? 6 NB A E HEM . ? A HEM 155 ? 1_555 FE A E HEM . ? A HEM 155 ? 1_555 NC A E HEM . ? A HEM 155 ? 1_555 95.4 ? 7 NE2 A A HIS 67 ? A HIS 64 ? 1_555 FE A E HEM . ? A HEM 155 ? 1_555 ND A E HEM . ? A HEM 155 ? 1_555 86.6 ? 8 NA A E HEM . ? A HEM 155 ? 1_555 FE A E HEM . ? A HEM 155 ? 1_555 ND A E HEM . ? A HEM 155 ? 1_555 91.4 ? 9 NB A E HEM . ? A HEM 155 ? 1_555 FE A E HEM . ? A HEM 155 ? 1_555 ND A E HEM . ? A HEM 155 ? 1_555 175.7 ? 10 NC A E HEM . ? A HEM 155 ? 1_555 FE A E HEM . ? A HEM 155 ? 1_555 ND A E HEM . ? A HEM 155 ? 1_555 88.0 ? 11 NE2 A A HIS 67 ? A HIS 64 ? 1_555 FE A E HEM . ? A HEM 155 ? 1_555 NE2 A A HIS 99 ? A HIS 96 ? 1_555 158.0 ? 12 NA A E HEM . ? A HEM 155 ? 1_555 FE A E HEM . ? A HEM 155 ? 1_555 NE2 A A HIS 99 ? A HIS 96 ? 1_555 83.6 ? 13 NB A E HEM . ? A HEM 155 ? 1_555 FE A E HEM . ? A HEM 155 ? 1_555 NE2 A A HIS 99 ? A HIS 96 ? 1_555 74.8 ? 14 NC A E HEM . ? A HEM 155 ? 1_555 FE A E HEM . ? A HEM 155 ? 1_555 NE2 A A HIS 99 ? A HIS 96 ? 1_555 96.5 ? 15 ND A E HEM . ? A HEM 155 ? 1_555 FE A E HEM . ? A HEM 155 ? 1_555 NE2 A A HIS 99 ? A HIS 96 ? 1_555 102.3 ? 16 NE2 B A HIS 67 ? A HIS 64 ? 1_555 FE B E HEM . ? A HEM 155 ? 1_555 NA B E HEM . ? A HEM 155 ? 1_555 101.0 ? 17 NE2 B A HIS 67 ? A HIS 64 ? 1_555 FE B E HEM . ? A HEM 155 ? 1_555 NB B E HEM . ? A HEM 155 ? 1_555 87.7 ? 18 NA B E HEM . ? A HEM 155 ? 1_555 FE B E HEM . ? A HEM 155 ? 1_555 NB B E HEM . ? A HEM 155 ? 1_555 87.2 ? 19 NE2 B A HIS 67 ? A HIS 64 ? 1_555 FE B E HEM . ? A HEM 155 ? 1_555 NC B E HEM . ? A HEM 155 ? 1_555 80.6 ? 20 NA B E HEM . ? A HEM 155 ? 1_555 FE B E HEM . ? A HEM 155 ? 1_555 NC B E HEM . ? A HEM 155 ? 1_555 178.4 ? 21 NB B E HEM . ? A HEM 155 ? 1_555 FE B E HEM . ? A HEM 155 ? 1_555 NC B E HEM . ? A HEM 155 ? 1_555 92.9 ? 22 NE2 B A HIS 67 ? A HIS 64 ? 1_555 FE B E HEM . ? A HEM 155 ? 1_555 ND B E HEM . ? A HEM 155 ? 1_555 96.4 ? 23 NA B E HEM . ? A HEM 155 ? 1_555 FE B E HEM . ? A HEM 155 ? 1_555 ND B E HEM . ? A HEM 155 ? 1_555 89.8 ? 24 NB B E HEM . ? A HEM 155 ? 1_555 FE B E HEM . ? A HEM 155 ? 1_555 ND B E HEM . ? A HEM 155 ? 1_555 175.3 ? 25 NC B E HEM . ? A HEM 155 ? 1_555 FE B E HEM . ? A HEM 155 ? 1_555 ND B E HEM . ? A HEM 155 ? 1_555 90.0 ? 26 NE2 B A HIS 67 ? A HIS 64 ? 1_555 FE B E HEM . ? A HEM 155 ? 1_555 NE2 B A HIS 99 ? A HIS 96 ? 1_555 157.7 ? 27 NA B E HEM . ? A HEM 155 ? 1_555 FE B E HEM . ? A HEM 155 ? 1_555 NE2 B A HIS 99 ? A HIS 96 ? 1_555 79.2 ? 28 NB B E HEM . ? A HEM 155 ? 1_555 FE B E HEM . ? A HEM 155 ? 1_555 NE2 B A HIS 99 ? A HIS 96 ? 1_555 70.0 ? 29 NC B E HEM . ? A HEM 155 ? 1_555 FE B E HEM . ? A HEM 155 ? 1_555 NE2 B A HIS 99 ? A HIS 96 ? 1_555 99.3 ? 30 ND B E HEM . ? A HEM 155 ? 1_555 FE B E HEM . ? A HEM 155 ? 1_555 NE2 B A HIS 99 ? A HIS 96 ? 1_555 105.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-09-22 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2018-10-17 4 'Structure model' 1 3 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' citation_author 3 3 'Structure model' pdbx_struct_special_symmetry 4 4 'Structure model' database_2 5 4 'Structure model' struct_ref_seq_dif 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_abbrev' 2 3 'Structure model' '_citation.journal_id_ISSN' 3 3 'Structure model' '_citation.pdbx_database_id_DOI' 4 3 'Structure model' '_citation.pdbx_database_id_PubMed' 5 3 'Structure model' '_citation.title' 6 3 'Structure model' '_citation_author.name' 7 4 'Structure model' '_database_2.pdbx_DOI' 8 4 'Structure model' '_database_2.pdbx_database_accession' 9 4 'Structure model' '_struct_ref_seq_dif.details' 10 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 11 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 12 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.pdbx_refine_id 1 ? refined 27.3100 35.2590 33.1510 0.0030 -0.0444 0.1686 0.0842 -0.0698 0.1150 17.6629 36.3058 27.2384 4.8615 -3.2790 -26.9587 0.7045 -0.8625 -1.2788 0.4925 -1.2365 -0.9941 0.8860 1.6101 0.5320 'X-RAY DIFFRACTION' 2 ? refined 14.4450 53.8640 27.0060 -0.0480 -0.0058 -0.1105 -0.0264 -0.0710 -0.0040 6.6906 4.5285 2.7709 -0.9887 -1.4736 0.1910 -0.0038 -0.2039 0.1847 0.1632 -0.0187 -0.3181 -0.0765 0.0550 0.0225 'X-RAY DIFFRACTION' 3 ? refined 21.2240 52.4890 31.6710 -0.0429 -0.0107 -0.0383 -0.0696 -0.1186 -0.0147 4.5954 2.9979 2.7748 -0.7975 1.0986 -1.2498 0.1965 -0.3040 -0.0911 0.3783 -0.2126 -0.4925 -0.0118 0.1978 0.0161 'X-RAY DIFFRACTION' 4 ? refined 15.3750 48.0900 36.8340 0.0849 0.0827 -0.0227 -0.0923 -0.1074 0.0455 1.6523 1.6073 2.0763 0.8234 0.0191 -1.0556 0.3215 -0.4348 -0.0576 0.5357 -0.2670 -0.2664 -0.2356 -0.0493 -0.0545 'X-RAY DIFFRACTION' 5 ? refined 15.9890 41.5570 40.9630 0.0728 0.0687 -0.0215 -0.1111 -0.1469 0.1706 3.7050 18.8855 8.3998 -1.4727 -2.8734 6.4033 0.0171 -0.6657 -0.2617 1.0451 -0.4455 0.2957 0.0698 0.3364 0.4284 'X-RAY DIFFRACTION' # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.pdbx_refine_id 1 1 A 4 ? ? A 17 ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 18 ? ? A 47 ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 48 ? ? A 85 ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 86 ? ? A 124 ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 125 ? ? A 150 ? ? ? ? 'X-RAY DIFFRACTION' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 REFMAC refinement 5.2.0019 ? 2 XDS 'data reduction' . ? 3 XSCALE 'data scaling' . ? 4 REFMAC phasing 5.2.0019 ? 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 158 ? ? O A HOH 227 ? ? 1.81 2 1 O A SER 12 ? ? O A HOH 185 ? ? 2.01 3 1 KR A KR 154 ? ? O A HOH 226 ? ? 2.12 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 228 ? ? 1_555 O A HOH 230 ? ? 11_565 2.06 2 1 O A HOH 229 ? ? 1_555 O A HOH 230 ? ? 11_565 2.15 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 87 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 A _pdbx_validate_rmsd_bond.auth_atom_id_2 OE1 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 87 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 A _pdbx_validate_rmsd_bond.bond_value 1.392 _pdbx_validate_rmsd_bond.bond_target_value 1.252 _pdbx_validate_rmsd_bond.bond_deviation 0.140 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.011 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 81 ? ? -164.92 93.52 2 1 ASP A 149 ? ? 44.45 23.62 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 3 ? CZ ? A ARG 6 CZ 2 1 Y 1 A ARG 3 ? NH1 ? A ARG 6 NH1 3 1 Y 1 A ARG 3 ? NH2 ? A ARG 6 NH2 4 1 Y 1 A ARG 14 ? CG ? A ARG 17 CG 5 1 Y 1 A ARG 14 ? CD ? A ARG 17 CD 6 1 Y 1 A ARG 14 ? NE ? A ARG 17 NE 7 1 Y 1 A ARG 14 ? CZ ? A ARG 17 CZ 8 1 Y 1 A ARG 14 ? NH1 ? A ARG 17 NH1 9 1 Y 1 A ARG 14 ? NH2 ? A ARG 17 NH2 10 1 Y 1 A GLN 43 ? OE1 ? A GLN 46 OE1 11 1 Y 1 A GLN 43 ? NE2 ? A GLN 46 NE2 12 1 Y 1 A ARG 47 ? NE ? A ARG 50 NE 13 1 Y 1 A ARG 47 ? CZ ? A ARG 50 CZ 14 1 Y 1 A ARG 47 ? NH1 ? A ARG 50 NH1 15 1 Y 1 A ARG 47 ? NH2 ? A ARG 50 NH2 16 1 Y 1 A ARG 130 ? CZ ? A ARG 133 CZ 17 1 Y 1 A ARG 130 ? NH1 ? A ARG 133 NH1 18 1 Y 1 A ARG 130 ? NH2 ? A ARG 133 NH2 19 1 Y 1 A ARG 135 ? CZ ? A ARG 138 CZ 20 1 Y 1 A ARG 135 ? NH1 ? A ARG 138 NH1 21 1 Y 1 A ARG 135 ? NH2 ? A ARG 138 NH2 22 1 Y 1 A GLN 142 ? OE1 ? A GLN 145 OE1 23 1 Y 1 A GLN 142 ? NE2 ? A GLN 145 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 1 Y 1 A MET 1 ? A MET 4 5 1 Y 1 A GLU 2 ? A GLU 5 6 1 Y 1 A GLU 151 ? A GLU 154 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 KRYPTON KR 4 'PROTOPORPHYRIN IX CONTAINING FE' HEM 5 water HOH #