data_3GW7 # _entry.id 3GW7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.313 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3GW7 RCSB RCSB052383 WWPDB D_1000052383 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id ER63 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 3GW7 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-03-31 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Forouhar, F.' 1 'Abashidze, M.' 2 'Seetharaman, J.' 3 'Janjua, J.' 4 'Xiao, R.' 5 'Cunningham, K.' 6 'Ma, L.' 7 'Zhao, L.' 8 'Everett, J.K.' 9 'Nair, R.' 10 'Acton, T.B.' 11 'Rost, B.' 12 'Montelione, G.T.' 13 'Hunt, J.F.' 14 'Tong, L.' 15 'Northeast Structural Genomics Consortium (NESG)' 16 # _citation.id primary _citation.title ;Crystal structure of a metal-dependent phosphohydrolase with conserved HD domain (yedJ) from Escherichia coli in complex with nickel ions. Northeast Structural Genomics Consortium Target ER63 ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Forouhar, F.' 1 ? primary 'Abashidze, M.' 2 ? primary 'Seetharaman, J.' 3 ? primary 'Janjua, J.' 4 ? primary 'Xiao, R.' 5 ? primary 'Cunningham, K.' 6 ? primary 'Ma, L.' 7 ? primary 'Zhao, L.' 8 ? primary 'Everett, J.K.' 9 ? primary 'Nair, R.' 10 ? primary 'Acton, T.B.' 11 ? primary 'Rost, B.' 12 ? primary 'Montelione, G.T.' 13 ? primary 'Hunt, J.F.' 14 ? primary 'Tong, L.' 15 ? # _cell.entry_id 3GW7 _cell.length_a 99.408 _cell.length_b 99.408 _cell.length_c 130.629 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.pdbx_unique_axis ? _cell.Z_PDB 12 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3GW7 _symmetry.space_group_name_H-M 'P 63' _symmetry.Int_Tables_number 173 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized protein yedJ' 27013.457 2 ? ? ? ? 2 non-polymer syn 'NICKEL (II) ION' 58.693 8 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDLQHWQAQFENWLKNHHQHQDAAHDVCHFRRVWATAQKLAADDDVDMLVILTACYFHDIVSLAKNHPQRQRSSILAAEE TRRLLREEFEQFPAEKIEAVCHAIAAHSFSAQIAPLTTEAKIVQDADRLEALGAIGLARVFAVSGALGVALFDGEDPFAQ HRPLDDKRYALDHFQTKLLKLPQTMQTARGKQLAQHNAHFLVEFMAKLSAELAGENEGVDHKVIDAFSSAGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDLQHWQAQFENWLKNHHQHQDAAHDVCHFRRVWATAQKLAADDDVDMLVILTACYFHDIVSLAKNHPQRQRSSILAAEE TRRLLREEFEQFPAEKIEAVCHAIAAHSFSAQIAPLTTEAKIVQDADRLEALGAIGLARVFAVSGALGVALFDGEDPFAQ HRPLDDKRYALDHFQTKLLKLPQTMQTARGKQLAQHNAHFLVEFMAKLSAELAGENEGVDHKVIDAFSSAGLEHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ER63 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 LEU n 1 4 GLN n 1 5 HIS n 1 6 TRP n 1 7 GLN n 1 8 ALA n 1 9 GLN n 1 10 PHE n 1 11 GLU n 1 12 ASN n 1 13 TRP n 1 14 LEU n 1 15 LYS n 1 16 ASN n 1 17 HIS n 1 18 HIS n 1 19 GLN n 1 20 HIS n 1 21 GLN n 1 22 ASP n 1 23 ALA n 1 24 ALA n 1 25 HIS n 1 26 ASP n 1 27 VAL n 1 28 CYS n 1 29 HIS n 1 30 PHE n 1 31 ARG n 1 32 ARG n 1 33 VAL n 1 34 TRP n 1 35 ALA n 1 36 THR n 1 37 ALA n 1 38 GLN n 1 39 LYS n 1 40 LEU n 1 41 ALA n 1 42 ALA n 1 43 ASP n 1 44 ASP n 1 45 ASP n 1 46 VAL n 1 47 ASP n 1 48 MET n 1 49 LEU n 1 50 VAL n 1 51 ILE n 1 52 LEU n 1 53 THR n 1 54 ALA n 1 55 CYS n 1 56 TYR n 1 57 PHE n 1 58 HIS n 1 59 ASP n 1 60 ILE n 1 61 VAL n 1 62 SER n 1 63 LEU n 1 64 ALA n 1 65 LYS n 1 66 ASN n 1 67 HIS n 1 68 PRO n 1 69 GLN n 1 70 ARG n 1 71 GLN n 1 72 ARG n 1 73 SER n 1 74 SER n 1 75 ILE n 1 76 LEU n 1 77 ALA n 1 78 ALA n 1 79 GLU n 1 80 GLU n 1 81 THR n 1 82 ARG n 1 83 ARG n 1 84 LEU n 1 85 LEU n 1 86 ARG n 1 87 GLU n 1 88 GLU n 1 89 PHE n 1 90 GLU n 1 91 GLN n 1 92 PHE n 1 93 PRO n 1 94 ALA n 1 95 GLU n 1 96 LYS n 1 97 ILE n 1 98 GLU n 1 99 ALA n 1 100 VAL n 1 101 CYS n 1 102 HIS n 1 103 ALA n 1 104 ILE n 1 105 ALA n 1 106 ALA n 1 107 HIS n 1 108 SER n 1 109 PHE n 1 110 SER n 1 111 ALA n 1 112 GLN n 1 113 ILE n 1 114 ALA n 1 115 PRO n 1 116 LEU n 1 117 THR n 1 118 THR n 1 119 GLU n 1 120 ALA n 1 121 LYS n 1 122 ILE n 1 123 VAL n 1 124 GLN n 1 125 ASP n 1 126 ALA n 1 127 ASP n 1 128 ARG n 1 129 LEU n 1 130 GLU n 1 131 ALA n 1 132 LEU n 1 133 GLY n 1 134 ALA n 1 135 ILE n 1 136 GLY n 1 137 LEU n 1 138 ALA n 1 139 ARG n 1 140 VAL n 1 141 PHE n 1 142 ALA n 1 143 VAL n 1 144 SER n 1 145 GLY n 1 146 ALA n 1 147 LEU n 1 148 GLY n 1 149 VAL n 1 150 ALA n 1 151 LEU n 1 152 PHE n 1 153 ASP n 1 154 GLY n 1 155 GLU n 1 156 ASP n 1 157 PRO n 1 158 PHE n 1 159 ALA n 1 160 GLN n 1 161 HIS n 1 162 ARG n 1 163 PRO n 1 164 LEU n 1 165 ASP n 1 166 ASP n 1 167 LYS n 1 168 ARG n 1 169 TYR n 1 170 ALA n 1 171 LEU n 1 172 ASP n 1 173 HIS n 1 174 PHE n 1 175 GLN n 1 176 THR n 1 177 LYS n 1 178 LEU n 1 179 LEU n 1 180 LYS n 1 181 LEU n 1 182 PRO n 1 183 GLN n 1 184 THR n 1 185 MET n 1 186 GLN n 1 187 THR n 1 188 ALA n 1 189 ARG n 1 190 GLY n 1 191 LYS n 1 192 GLN n 1 193 LEU n 1 194 ALA n 1 195 GLN n 1 196 HIS n 1 197 ASN n 1 198 ALA n 1 199 HIS n 1 200 PHE n 1 201 LEU n 1 202 VAL n 1 203 GLU n 1 204 PHE n 1 205 MET n 1 206 ALA n 1 207 LYS n 1 208 LEU n 1 209 SER n 1 210 ALA n 1 211 GLU n 1 212 LEU n 1 213 ALA n 1 214 GLY n 1 215 GLU n 1 216 ASN n 1 217 GLU n 1 218 GLY n 1 219 VAL n 1 220 ASP n 1 221 HIS n 1 222 LYS n 1 223 VAL n 1 224 ILE n 1 225 ASP n 1 226 ALA n 1 227 PHE n 1 228 SER n 1 229 SER n 1 230 ALA n 1 231 GLY n 1 232 LEU n 1 233 GLU n 1 234 HIS n 1 235 HIS n 1 236 HIS n 1 237 HIS n 1 238 HIS n 1 239 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'b1962, JW1945, yedJ' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'K-12 / MG1655' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli K-12' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 47076 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YEDJ_ECOLI _struct_ref.pdbx_db_accession P46144 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDLQHWQAQFENWLKNHHQHQDAAHDVCHFRRVWATAQKLAADDDVDMLVILTACYFHDIVSLAKNHPQRQRSSILAAEE TRRLLREEFEQFPAEKIEAVCHAIAAHSFSAQIAPLTTEAKIVQDADRLEALGAIGLARVFAVSGALGVALFDGEDPFAQ HRPLDDKRYALDHFQTKLLKLPQTMQTARGKQLAQHNAHFLVEFMAKLSAELAGENEGVDHKVIDAFSSAG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 3GW7 A 1 ? 231 ? P46144 1 ? 231 ? 1 231 2 1 3GW7 B 1 ? 231 ? P46144 1 ? 231 ? 1 231 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3GW7 LEU A 232 ? UNP P46144 ? ? 'EXPRESSION TAG' 232 1 1 3GW7 GLU A 233 ? UNP P46144 ? ? 'EXPRESSION TAG' 233 2 1 3GW7 HIS A 234 ? UNP P46144 ? ? 'EXPRESSION TAG' 234 3 1 3GW7 HIS A 235 ? UNP P46144 ? ? 'EXPRESSION TAG' 235 4 1 3GW7 HIS A 236 ? UNP P46144 ? ? 'EXPRESSION TAG' 236 5 1 3GW7 HIS A 237 ? UNP P46144 ? ? 'EXPRESSION TAG' 237 6 1 3GW7 HIS A 238 ? UNP P46144 ? ? 'EXPRESSION TAG' 238 7 1 3GW7 HIS A 239 ? UNP P46144 ? ? 'EXPRESSION TAG' 239 8 2 3GW7 LEU B 232 ? UNP P46144 ? ? 'EXPRESSION TAG' 232 9 2 3GW7 GLU B 233 ? UNP P46144 ? ? 'EXPRESSION TAG' 233 10 2 3GW7 HIS B 234 ? UNP P46144 ? ? 'EXPRESSION TAG' 234 11 2 3GW7 HIS B 235 ? UNP P46144 ? ? 'EXPRESSION TAG' 235 12 2 3GW7 HIS B 236 ? UNP P46144 ? ? 'EXPRESSION TAG' 236 13 2 3GW7 HIS B 237 ? UNP P46144 ? ? 'EXPRESSION TAG' 237 14 2 3GW7 HIS B 238 ? UNP P46144 ? ? 'EXPRESSION TAG' 238 15 2 3GW7 HIS B 239 ? UNP P46144 ? ? 'EXPRESSION TAG' 239 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NI non-polymer . 'NICKEL (II) ION' ? 'Ni 2' 58.693 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 3GW7 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 3.45 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 64.33 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.temp 291 _exptl_crystal_grow.pdbx_details ;Protein solution: 100mM NaCl, 5mM DTT, 0.02% NaN3, 10mM Tris-HCl pH 7.5. Reservoir solution: 100mM Tris-HCl, 1M Lithium sulfate, 10mM Nickel chloride, VAPOR DIFFUSION, HANGING DROP, temperature 291K ; _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2005-09-23 _diffrn_detector.details Mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Si(111) CHANNEL' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.1000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X29A' _diffrn_source.pdbx_wavelength_list 1.1000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X29A # _reflns.entry_id 3GW7 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 3.30 _reflns.d_resolution_low 30.0 _reflns.number_all 21299 _reflns.number_obs 21299 _reflns.percent_possible_obs 97.4 _reflns.pdbx_Rmerge_I_obs 0.054 _reflns.pdbx_Rsym_value 0.040 _reflns.pdbx_netI_over_sigmaI 24.13 _reflns.B_iso_Wilson_estimate 91.3 _reflns.pdbx_redundancy 3.8 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 3.30 _reflns_shell.d_res_low 3.42 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 91.3 _reflns_shell.Rmerge_I_obs 0.338 _reflns_shell.meanI_over_sigI_obs 2.32 _reflns_shell.pdbx_Rsym_value 0.297 _reflns_shell.pdbx_redundancy 3.2 _reflns_shell.number_unique_all 2180 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3GW7 _refine.ls_d_res_high 3.30 _refine.ls_d_res_low 20.0 _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 265144.250 _refine.pdbx_data_cutoff_low_absF 0.000 _refine.ls_percent_reflns_obs 83.400 _refine.ls_number_reflns_obs 18064 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.ls_R_factor_R_work 0.260 _refine.ls_R_factor_R_free 0.294 _refine.ls_percent_reflns_R_free 7.500 _refine.ls_number_reflns_R_free 1627 _refine.ls_R_factor_R_free_error 0.007 _refine.B_iso_mean 121.100 _refine.solvent_model_param_bsol 87.958 _refine.solvent_model_param_ksol 0.300 _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.aniso_B[1][1] 10.697 _refine.aniso_B[2][2] 10.697 _refine.aniso_B[3][3] -21.394 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.solvent_model_details 'FLAT MODEL' _refine.pdbx_ls_sigma_I 2.00 _refine.ls_number_reflns_all 21299 _refine.ls_R_factor_all 0.266 _refine.ls_R_factor_obs 0.263 _refine.ls_redundancy_reflns_obs ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.occupancy_max ? _refine.occupancy_min ? _refine.details 'Program XtalView has also been used in refinement' _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3GW7 _refine_analyze.Luzzati_coordinate_error_obs 0.450 _refine_analyze.Luzzati_sigma_a_obs 0.670 _refine_analyze.Luzzati_d_res_low_obs 5.000 _refine_analyze.Luzzati_coordinate_error_free 0.520 _refine_analyze.Luzzati_sigma_a_free 0.740 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 3398 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 3406 _refine_hist.d_res_high 3.30 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d ? 0.010 ? ? 'X-RAY DIFFRACTION' ? c_angle_deg ? 1.400 ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d ? 23.500 1.500 ? 'X-RAY DIFFRACTION' ? c_improper_angle_d ? 0.910 2.000 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 3.300 _refine_ls_shell.d_res_low 3.420 _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.percent_reflns_obs 50.300 _refine_ls_shell.number_reflns_R_work 1006 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.353 _refine_ls_shell.R_factor_R_free 0.346 _refine_ls_shell.percent_reflns_R_free 8.600 _refine_ls_shell.number_reflns_R_free 95 _refine_ls_shell.R_factor_R_free_error 0.036 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 1101 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 CNS_TOPPAR:protein_rep.param CNS_TOPPAR:protein.top 'X-RAY DIFFRACTION' 2 CNS_TOPPAR:dna-rna_rep.param CNS_TOPPAR:dna-rna.top 'X-RAY DIFFRACTION' 3 CNS_TOPPAR:water_rep.param CNS_TOPPAR:water.top 'X-RAY DIFFRACTION' 4 CNS_TOPPAR:ion.param CNS_TOPPAR:ion.top 'X-RAY DIFFRACTION' # _struct.entry_id 3GW7 _struct.title ;Crystal structure of a metal-dependent phosphohydrolase with conserved HD domain (yedJ) from Escherichia coli in complex with nickel ions. Northeast Structural Genomics Consortium Target ER63 ; _struct.pdbx_descriptor 'Uncharacterized protein yedJ' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3GW7 _struct_keywords.text ;All alpha-helical protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, HYDROLASE ; _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 2 ? J N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 7 ? GLU A 11 ? GLN A 7 GLU A 11 5 ? 5 HELX_P HELX_P2 2 CYS A 28 ? ALA A 41 ? CYS A 28 ALA A 41 1 ? 14 HELX_P HELX_P3 3 LEU A 49 ? HIS A 58 ? LEU A 49 HIS A 58 1 ? 10 HELX_P HELX_P4 4 SER A 74 ? ARG A 86 ? SER A 74 ARG A 86 1 ? 13 HELX_P HELX_P5 5 HIS A 102 ? ALA A 106 ? HIS A 102 ALA A 106 5 ? 5 HELX_P HELX_P6 6 THR A 117 ? ASP A 127 ? THR A 117 ASP A 127 1 ? 11 HELX_P HELX_P7 7 ARG A 128 ? ALA A 131 ? ARG A 128 ALA A 131 5 ? 4 HELX_P HELX_P8 8 LEU A 132 ? LEU A 147 ? LEU A 132 LEU A 147 1 ? 16 HELX_P HELX_P9 9 PHE A 152 ? GLN A 160 ? PHE A 152 GLN A 160 5 ? 9 HELX_P HELX_P10 10 TYR A 169 ? GLN A 175 ? TYR A 169 GLN A 175 1 ? 7 HELX_P HELX_P11 11 LYS A 177 ? LEU A 181 ? LYS A 177 LEU A 181 5 ? 5 HELX_P HELX_P12 12 THR A 187 ? ALA A 213 ? THR A 187 ALA A 213 1 ? 27 HELX_P HELX_P13 13 VAL A 223 ? SER A 228 ? VAL A 223 SER A 228 1 ? 6 HELX_P HELX_P14 14 GLN B 7 ? GLU B 11 ? GLN B 7 GLU B 11 5 ? 5 HELX_P HELX_P15 15 CYS B 28 ? ALA B 41 ? CYS B 28 ALA B 41 1 ? 14 HELX_P HELX_P16 16 LEU B 49 ? HIS B 58 ? LEU B 49 HIS B 58 1 ? 10 HELX_P HELX_P17 17 SER B 74 ? ARG B 86 ? SER B 74 ARG B 86 1 ? 13 HELX_P HELX_P18 18 HIS B 102 ? ALA B 106 ? HIS B 102 ALA B 106 5 ? 5 HELX_P HELX_P19 19 THR B 117 ? ASP B 127 ? THR B 117 ASP B 127 1 ? 11 HELX_P HELX_P20 20 ARG B 128 ? ALA B 131 ? ARG B 128 ALA B 131 5 ? 4 HELX_P HELX_P21 21 LEU B 132 ? LEU B 147 ? LEU B 132 LEU B 147 1 ? 16 HELX_P HELX_P22 22 PHE B 152 ? GLN B 160 ? PHE B 152 GLN B 160 5 ? 9 HELX_P HELX_P23 23 TYR B 169 ? GLN B 175 ? TYR B 169 GLN B 175 1 ? 7 HELX_P HELX_P24 24 LYS B 177 ? LEU B 181 ? LYS B 177 LEU B 181 5 ? 5 HELX_P HELX_P25 25 THR B 187 ? ALA B 213 ? THR B 187 ALA B 213 1 ? 27 HELX_P HELX_P26 26 VAL B 223 ? SER B 228 ? VAL B 223 SER B 228 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A HIS 29 NE2 ? ? ? 1_555 C NI . NI ? ? A HIS 29 A NI 301 1_555 ? ? ? ? ? ? ? 2.542 ? metalc2 metalc ? ? A HIS 196 NE2 ? ? ? 1_555 D NI . NI ? ? A HIS 196 A NI 302 1_555 ? ? ? ? ? ? ? 2.515 ? metalc3 metalc ? ? A HIS 235 NE2 ? ? ? 1_555 E NI . NI ? ? A HIS 235 A NI 303 1_555 ? ? ? ? ? ? ? 2.078 ? metalc4 metalc ? ? A HIS 237 NE2 ? ? ? 1_555 E NI . NI ? ? A HIS 237 A NI 303 1_555 ? ? ? ? ? ? ? 2.281 ? metalc5 metalc ? ? B HIS 196 NE2 ? ? ? 1_555 H NI . NI ? ? B HIS 196 B NI 304 1_555 ? ? ? ? ? ? ? 2.423 ? metalc6 metalc ? ? B HIS 235 NE2 ? ? ? 1_555 I NI . NI ? ? B HIS 235 B NI 305 1_555 ? ? ? ? ? ? ? 2.144 ? metalc7 metalc ? ? B HIS 237 NE2 ? ? ? 1_555 I NI . NI ? ? B HIS 237 B NI 305 1_555 ? ? ? ? ? ? ? 2.232 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NI A 301' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NI B 301' AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NI A 302' AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NI A 303' AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NI B 304' AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NI B 305' AC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NI A 306' AC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NI B 307' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 29 ? HIS A 29 . ? 1_555 ? 2 AC1 4 HIS A 58 ? HIS A 58 . ? 1_555 ? 3 AC1 4 ASP A 59 ? ASP A 59 . ? 1_555 ? 4 AC1 4 ASP A 127 ? ASP A 127 . ? 1_555 ? 5 AC2 4 HIS B 29 ? HIS B 29 . ? 1_555 ? 6 AC2 4 HIS B 58 ? HIS B 58 . ? 1_555 ? 7 AC2 4 ASP B 59 ? ASP B 59 . ? 1_555 ? 8 AC2 4 ASP B 127 ? ASP B 127 . ? 1_555 ? 9 AC3 5 ARG A 189 ? ARG A 189 . ? 1_555 ? 10 AC3 5 HIS A 196 ? HIS A 196 . ? 1_555 ? 11 AC3 5 HIS A 236 ? HIS A 236 . ? 2_655 ? 12 AC3 5 HIS A 238 ? HIS A 238 . ? 2_655 ? 13 AC3 5 GLU B 217 ? GLU B 217 . ? 1_555 ? 14 AC4 6 HIS A 235 ? HIS A 235 . ? 2_655 ? 15 AC4 6 HIS A 235 ? HIS A 235 . ? 1_555 ? 16 AC4 6 HIS A 235 ? HIS A 235 . ? 3_665 ? 17 AC4 6 HIS A 237 ? HIS A 237 . ? 2_655 ? 18 AC4 6 HIS A 237 ? HIS A 237 . ? 1_555 ? 19 AC4 6 HIS A 237 ? HIS A 237 . ? 3_665 ? 20 AC5 5 GLU A 217 ? GLU A 217 . ? 1_555 ? 21 AC5 5 ARG B 189 ? ARG B 189 . ? 1_555 ? 22 AC5 5 HIS B 196 ? HIS B 196 . ? 1_555 ? 23 AC5 5 HIS B 236 ? HIS B 236 . ? 3_665 ? 24 AC5 5 HIS B 238 ? HIS B 238 . ? 3_665 ? 25 AC6 6 HIS B 235 ? HIS B 235 . ? 1_555 ? 26 AC6 6 HIS B 235 ? HIS B 235 . ? 3_665 ? 27 AC6 6 HIS B 235 ? HIS B 235 . ? 2_655 ? 28 AC6 6 HIS B 237 ? HIS B 237 . ? 3_665 ? 29 AC6 6 HIS B 237 ? HIS B 237 . ? 2_655 ? 30 AC6 6 HIS B 237 ? HIS B 237 . ? 1_555 ? 31 AC7 3 NI J . ? NI B 307 . ? 1_555 ? 32 AC7 3 NI J . ? NI B 307 . ? 2_655 ? 33 AC7 3 NI J . ? NI B 307 . ? 3_665 ? 34 AC8 3 NI F . ? NI A 306 . ? 1_555 ? 35 AC8 3 NI F . ? NI A 306 . ? 2_655 ? 36 AC8 3 NI F . ? NI A 306 . ? 3_665 ? # _database_PDB_matrix.entry_id 3GW7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.000000 _database_PDB_matrix.origx_vector[2] 0.000000 _database_PDB_matrix.origx_vector[3] 0.000000 # _atom_sites.entry_id 3GW7 _atom_sites.fract_transf_matrix[1][1] 0.010060 _atom_sites.fract_transf_matrix[1][2] 0.005808 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011616 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007655 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N NI O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 TRP 6 6 6 TRP TRP A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 TRP 13 13 13 TRP TRP A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 HIS 18 18 ? ? ? A . n A 1 19 GLN 19 19 ? ? ? A . n A 1 20 HIS 20 20 ? ? ? A . n A 1 21 GLN 21 21 ? ? ? A . n A 1 22 ASP 22 22 ? ? ? A . n A 1 23 ALA 23 23 ? ? ? A . n A 1 24 ALA 24 24 ? ? ? A . n A 1 25 HIS 25 25 ? ? ? A . n A 1 26 ASP 26 26 ? ? ? A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 TRP 34 34 34 TRP TRP A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 LEU 63 63 ? ? ? A . n A 1 64 ALA 64 64 ? ? ? A . n A 1 65 LYS 65 65 ? ? ? A . n A 1 66 ASN 66 66 ? ? ? A . n A 1 67 HIS 67 67 ? ? ? A . n A 1 68 PRO 68 68 ? ? ? A . n A 1 69 GLN 69 69 ? ? ? A . n A 1 70 ARG 70 70 ? ? ? A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 GLN 124 124 124 GLN GLN A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 PHE 152 152 152 PHE PHE A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 PHE 158 158 158 PHE PHE A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 GLN 160 160 160 GLN GLN A . n A 1 161 HIS 161 161 161 HIS HIS A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 PRO 163 163 163 PRO PRO A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 LYS 167 167 ? ? ? A . n A 1 168 ARG 168 168 ? ? ? A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 PHE 174 174 174 PHE PHE A . n A 1 175 GLN 175 175 175 GLN GLN A . n A 1 176 THR 176 176 176 THR THR A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 LYS 180 180 180 LYS LYS A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 GLN 183 183 183 GLN GLN A . n A 1 184 THR 184 184 184 THR THR A . n A 1 185 MET 185 185 185 MET MET A . n A 1 186 GLN 186 186 186 GLN GLN A . n A 1 187 THR 187 187 187 THR THR A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 GLN 192 192 192 GLN GLN A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 ALA 194 194 194 ALA ALA A . n A 1 195 GLN 195 195 195 GLN GLN A . n A 1 196 HIS 196 196 196 HIS HIS A . n A 1 197 ASN 197 197 197 ASN ASN A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 HIS 199 199 199 HIS HIS A . n A 1 200 PHE 200 200 200 PHE PHE A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 PHE 204 204 204 PHE PHE A . n A 1 205 MET 205 205 205 MET MET A . n A 1 206 ALA 206 206 206 ALA ALA A . n A 1 207 LYS 207 207 207 LYS LYS A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 SER 209 209 209 SER SER A . n A 1 210 ALA 210 210 210 ALA ALA A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 ALA 213 213 213 ALA ALA A . n A 1 214 GLY 214 214 214 GLY GLY A . n A 1 215 GLU 215 215 215 GLU GLU A . n A 1 216 ASN 216 216 216 ASN ASN A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 VAL 219 219 219 VAL VAL A . n A 1 220 ASP 220 220 220 ASP ASP A . n A 1 221 HIS 221 221 221 HIS HIS A . n A 1 222 LYS 222 222 222 LYS LYS A . n A 1 223 VAL 223 223 223 VAL VAL A . n A 1 224 ILE 224 224 224 ILE ILE A . n A 1 225 ASP 225 225 225 ASP ASP A . n A 1 226 ALA 226 226 226 ALA ALA A . n A 1 227 PHE 227 227 227 PHE PHE A . n A 1 228 SER 228 228 228 SER SER A . n A 1 229 SER 229 229 229 SER SER A . n A 1 230 ALA 230 230 230 ALA ALA A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 GLU 233 233 233 GLU GLU A . n A 1 234 HIS 234 234 ? ? ? A . n A 1 235 HIS 235 235 235 HIS HIS A . n A 1 236 HIS 236 236 236 HIS HIS A . n A 1 237 HIS 237 237 237 HIS HIS A . n A 1 238 HIS 238 238 238 HIS HIS A . n A 1 239 HIS 239 239 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 ASP 2 2 ? ? ? B . n B 1 3 LEU 3 3 ? ? ? B . n B 1 4 GLN 4 4 4 GLN GLN B . n B 1 5 HIS 5 5 5 HIS HIS B . n B 1 6 TRP 6 6 6 TRP TRP B . n B 1 7 GLN 7 7 7 GLN GLN B . n B 1 8 ALA 8 8 8 ALA ALA B . n B 1 9 GLN 9 9 9 GLN GLN B . n B 1 10 PHE 10 10 10 PHE PHE B . n B 1 11 GLU 11 11 11 GLU GLU B . n B 1 12 ASN 12 12 12 ASN ASN B . n B 1 13 TRP 13 13 13 TRP TRP B . n B 1 14 LEU 14 14 14 LEU LEU B . n B 1 15 LYS 15 15 15 LYS LYS B . n B 1 16 ASN 16 16 16 ASN ASN B . n B 1 17 HIS 17 17 17 HIS HIS B . n B 1 18 HIS 18 18 ? ? ? B . n B 1 19 GLN 19 19 ? ? ? B . n B 1 20 HIS 20 20 ? ? ? B . n B 1 21 GLN 21 21 ? ? ? B . n B 1 22 ASP 22 22 ? ? ? B . n B 1 23 ALA 23 23 ? ? ? B . n B 1 24 ALA 24 24 ? ? ? B . n B 1 25 HIS 25 25 ? ? ? B . n B 1 26 ASP 26 26 ? ? ? B . n B 1 27 VAL 27 27 27 VAL VAL B . n B 1 28 CYS 28 28 28 CYS CYS B . n B 1 29 HIS 29 29 29 HIS HIS B . n B 1 30 PHE 30 30 30 PHE PHE B . n B 1 31 ARG 31 31 31 ARG ARG B . n B 1 32 ARG 32 32 32 ARG ARG B . n B 1 33 VAL 33 33 33 VAL VAL B . n B 1 34 TRP 34 34 34 TRP TRP B . n B 1 35 ALA 35 35 35 ALA ALA B . n B 1 36 THR 36 36 36 THR THR B . n B 1 37 ALA 37 37 37 ALA ALA B . n B 1 38 GLN 38 38 38 GLN GLN B . n B 1 39 LYS 39 39 39 LYS LYS B . n B 1 40 LEU 40 40 40 LEU LEU B . n B 1 41 ALA 41 41 41 ALA ALA B . n B 1 42 ALA 42 42 42 ALA ALA B . n B 1 43 ASP 43 43 43 ASP ASP B . n B 1 44 ASP 44 44 44 ASP ASP B . n B 1 45 ASP 45 45 45 ASP ASP B . n B 1 46 VAL 46 46 46 VAL VAL B . n B 1 47 ASP 47 47 47 ASP ASP B . n B 1 48 MET 48 48 48 MET MET B . n B 1 49 LEU 49 49 49 LEU LEU B . n B 1 50 VAL 50 50 50 VAL VAL B . n B 1 51 ILE 51 51 51 ILE ILE B . n B 1 52 LEU 52 52 52 LEU LEU B . n B 1 53 THR 53 53 53 THR THR B . n B 1 54 ALA 54 54 54 ALA ALA B . n B 1 55 CYS 55 55 55 CYS CYS B . n B 1 56 TYR 56 56 56 TYR TYR B . n B 1 57 PHE 57 57 57 PHE PHE B . n B 1 58 HIS 58 58 58 HIS HIS B . n B 1 59 ASP 59 59 59 ASP ASP B . n B 1 60 ILE 60 60 60 ILE ILE B . n B 1 61 VAL 61 61 61 VAL VAL B . n B 1 62 SER 62 62 62 SER SER B . n B 1 63 LEU 63 63 ? ? ? B . n B 1 64 ALA 64 64 ? ? ? B . n B 1 65 LYS 65 65 ? ? ? B . n B 1 66 ASN 66 66 ? ? ? B . n B 1 67 HIS 67 67 ? ? ? B . n B 1 68 PRO 68 68 ? ? ? B . n B 1 69 GLN 69 69 ? ? ? B . n B 1 70 ARG 70 70 ? ? ? B . n B 1 71 GLN 71 71 71 GLN GLN B . n B 1 72 ARG 72 72 72 ARG ARG B . n B 1 73 SER 73 73 73 SER SER B . n B 1 74 SER 74 74 74 SER SER B . n B 1 75 ILE 75 75 75 ILE ILE B . n B 1 76 LEU 76 76 76 LEU LEU B . n B 1 77 ALA 77 77 77 ALA ALA B . n B 1 78 ALA 78 78 78 ALA ALA B . n B 1 79 GLU 79 79 79 GLU GLU B . n B 1 80 GLU 80 80 80 GLU GLU B . n B 1 81 THR 81 81 81 THR THR B . n B 1 82 ARG 82 82 82 ARG ARG B . n B 1 83 ARG 83 83 83 ARG ARG B . n B 1 84 LEU 84 84 84 LEU LEU B . n B 1 85 LEU 85 85 85 LEU LEU B . n B 1 86 ARG 86 86 86 ARG ARG B . n B 1 87 GLU 87 87 87 GLU GLU B . n B 1 88 GLU 88 88 88 GLU GLU B . n B 1 89 PHE 89 89 89 PHE PHE B . n B 1 90 GLU 90 90 90 GLU GLU B . n B 1 91 GLN 91 91 91 GLN GLN B . n B 1 92 PHE 92 92 92 PHE PHE B . n B 1 93 PRO 93 93 93 PRO PRO B . n B 1 94 ALA 94 94 94 ALA ALA B . n B 1 95 GLU 95 95 95 GLU GLU B . n B 1 96 LYS 96 96 96 LYS LYS B . n B 1 97 ILE 97 97 97 ILE ILE B . n B 1 98 GLU 98 98 98 GLU GLU B . n B 1 99 ALA 99 99 99 ALA ALA B . n B 1 100 VAL 100 100 100 VAL VAL B . n B 1 101 CYS 101 101 101 CYS CYS B . n B 1 102 HIS 102 102 102 HIS HIS B . n B 1 103 ALA 103 103 103 ALA ALA B . n B 1 104 ILE 104 104 104 ILE ILE B . n B 1 105 ALA 105 105 105 ALA ALA B . n B 1 106 ALA 106 106 106 ALA ALA B . n B 1 107 HIS 107 107 107 HIS HIS B . n B 1 108 SER 108 108 108 SER SER B . n B 1 109 PHE 109 109 109 PHE PHE B . n B 1 110 SER 110 110 110 SER SER B . n B 1 111 ALA 111 111 111 ALA ALA B . n B 1 112 GLN 112 112 112 GLN GLN B . n B 1 113 ILE 113 113 113 ILE ILE B . n B 1 114 ALA 114 114 114 ALA ALA B . n B 1 115 PRO 115 115 115 PRO PRO B . n B 1 116 LEU 116 116 116 LEU LEU B . n B 1 117 THR 117 117 117 THR THR B . n B 1 118 THR 118 118 118 THR THR B . n B 1 119 GLU 119 119 119 GLU GLU B . n B 1 120 ALA 120 120 120 ALA ALA B . n B 1 121 LYS 121 121 121 LYS LYS B . n B 1 122 ILE 122 122 122 ILE ILE B . n B 1 123 VAL 123 123 123 VAL VAL B . n B 1 124 GLN 124 124 124 GLN GLN B . n B 1 125 ASP 125 125 125 ASP ASP B . n B 1 126 ALA 126 126 126 ALA ALA B . n B 1 127 ASP 127 127 127 ASP ASP B . n B 1 128 ARG 128 128 128 ARG ARG B . n B 1 129 LEU 129 129 129 LEU LEU B . n B 1 130 GLU 130 130 130 GLU GLU B . n B 1 131 ALA 131 131 131 ALA ALA B . n B 1 132 LEU 132 132 132 LEU LEU B . n B 1 133 GLY 133 133 133 GLY GLY B . n B 1 134 ALA 134 134 134 ALA ALA B . n B 1 135 ILE 135 135 135 ILE ILE B . n B 1 136 GLY 136 136 136 GLY GLY B . n B 1 137 LEU 137 137 137 LEU LEU B . n B 1 138 ALA 138 138 138 ALA ALA B . n B 1 139 ARG 139 139 139 ARG ARG B . n B 1 140 VAL 140 140 140 VAL VAL B . n B 1 141 PHE 141 141 141 PHE PHE B . n B 1 142 ALA 142 142 142 ALA ALA B . n B 1 143 VAL 143 143 143 VAL VAL B . n B 1 144 SER 144 144 144 SER SER B . n B 1 145 GLY 145 145 145 GLY GLY B . n B 1 146 ALA 146 146 146 ALA ALA B . n B 1 147 LEU 147 147 147 LEU LEU B . n B 1 148 GLY 148 148 148 GLY GLY B . n B 1 149 VAL 149 149 149 VAL VAL B . n B 1 150 ALA 150 150 150 ALA ALA B . n B 1 151 LEU 151 151 151 LEU LEU B . n B 1 152 PHE 152 152 152 PHE PHE B . n B 1 153 ASP 153 153 153 ASP ASP B . n B 1 154 GLY 154 154 154 GLY GLY B . n B 1 155 GLU 155 155 155 GLU GLU B . n B 1 156 ASP 156 156 156 ASP ASP B . n B 1 157 PRO 157 157 157 PRO PRO B . n B 1 158 PHE 158 158 158 PHE PHE B . n B 1 159 ALA 159 159 159 ALA ALA B . n B 1 160 GLN 160 160 160 GLN GLN B . n B 1 161 HIS 161 161 161 HIS HIS B . n B 1 162 ARG 162 162 162 ARG ARG B . n B 1 163 PRO 163 163 163 PRO PRO B . n B 1 164 LEU 164 164 164 LEU LEU B . n B 1 165 ASP 165 165 165 ASP ASP B . n B 1 166 ASP 166 166 166 ASP ASP B . n B 1 167 LYS 167 167 ? ? ? B . n B 1 168 ARG 168 168 ? ? ? B . n B 1 169 TYR 169 169 169 TYR TYR B . n B 1 170 ALA 170 170 170 ALA ALA B . n B 1 171 LEU 171 171 171 LEU LEU B . n B 1 172 ASP 172 172 172 ASP ASP B . n B 1 173 HIS 173 173 173 HIS HIS B . n B 1 174 PHE 174 174 174 PHE PHE B . n B 1 175 GLN 175 175 175 GLN GLN B . n B 1 176 THR 176 176 176 THR THR B . n B 1 177 LYS 177 177 177 LYS LYS B . n B 1 178 LEU 178 178 178 LEU LEU B . n B 1 179 LEU 179 179 179 LEU LEU B . n B 1 180 LYS 180 180 180 LYS LYS B . n B 1 181 LEU 181 181 181 LEU LEU B . n B 1 182 PRO 182 182 182 PRO PRO B . n B 1 183 GLN 183 183 183 GLN GLN B . n B 1 184 THR 184 184 184 THR THR B . n B 1 185 MET 185 185 185 MET MET B . n B 1 186 GLN 186 186 186 GLN GLN B . n B 1 187 THR 187 187 187 THR THR B . n B 1 188 ALA 188 188 188 ALA ALA B . n B 1 189 ARG 189 189 189 ARG ARG B . n B 1 190 GLY 190 190 190 GLY GLY B . n B 1 191 LYS 191 191 191 LYS LYS B . n B 1 192 GLN 192 192 192 GLN GLN B . n B 1 193 LEU 193 193 193 LEU LEU B . n B 1 194 ALA 194 194 194 ALA ALA B . n B 1 195 GLN 195 195 195 GLN GLN B . n B 1 196 HIS 196 196 196 HIS HIS B . n B 1 197 ASN 197 197 197 ASN ASN B . n B 1 198 ALA 198 198 198 ALA ALA B . n B 1 199 HIS 199 199 199 HIS HIS B . n B 1 200 PHE 200 200 200 PHE PHE B . n B 1 201 LEU 201 201 201 LEU LEU B . n B 1 202 VAL 202 202 202 VAL VAL B . n B 1 203 GLU 203 203 203 GLU GLU B . n B 1 204 PHE 204 204 204 PHE PHE B . n B 1 205 MET 205 205 205 MET MET B . n B 1 206 ALA 206 206 206 ALA ALA B . n B 1 207 LYS 207 207 207 LYS LYS B . n B 1 208 LEU 208 208 208 LEU LEU B . n B 1 209 SER 209 209 209 SER SER B . n B 1 210 ALA 210 210 210 ALA ALA B . n B 1 211 GLU 211 211 211 GLU GLU B . n B 1 212 LEU 212 212 212 LEU LEU B . n B 1 213 ALA 213 213 213 ALA ALA B . n B 1 214 GLY 214 214 214 GLY GLY B . n B 1 215 GLU 215 215 215 GLU GLU B . n B 1 216 ASN 216 216 216 ASN ASN B . n B 1 217 GLU 217 217 217 GLU GLU B . n B 1 218 GLY 218 218 218 GLY GLY B . n B 1 219 VAL 219 219 219 VAL VAL B . n B 1 220 ASP 220 220 220 ASP ASP B . n B 1 221 HIS 221 221 221 HIS HIS B . n B 1 222 LYS 222 222 222 LYS LYS B . n B 1 223 VAL 223 223 223 VAL VAL B . n B 1 224 ILE 224 224 224 ILE ILE B . n B 1 225 ASP 225 225 225 ASP ASP B . n B 1 226 ALA 226 226 226 ALA ALA B . n B 1 227 PHE 227 227 227 PHE PHE B . n B 1 228 SER 228 228 228 SER SER B . n B 1 229 SER 229 229 229 SER SER B . n B 1 230 ALA 230 230 230 ALA ALA B . n B 1 231 GLY 231 231 231 GLY GLY B . n B 1 232 LEU 232 232 232 LEU LEU B . n B 1 233 GLU 233 233 233 GLU GLU B . n B 1 234 HIS 234 234 ? ? ? B . n B 1 235 HIS 235 235 235 HIS HIS B . n B 1 236 HIS 236 236 236 HIS HIS B . n B 1 237 HIS 237 237 237 HIS HIS B . n B 1 238 HIS 238 238 238 HIS HIS B . n B 1 239 HIS 239 239 ? ? ? B . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 NI 1 301 301 NI NI A . D 2 NI 1 302 302 NI NI A . E 2 NI 1 303 303 NI NI A . F 2 NI 1 306 306 NI NI A . G 2 NI 1 301 301 NI NI B . H 2 NI 1 304 304 NI NI B . I 2 NI 1 305 305 NI NI B . J 2 NI 1 307 307 NI NI B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2880 ? 1 MORE -21.8 ? 1 'SSA (A^2)' 22400 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A NI 303 ? E NI . 2 1 A NI 306 ? F NI . 3 1 B NI 305 ? I NI . 4 1 B NI 307 ? J NI . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 235 ? A HIS 235 ? 1_555 NI ? E NI . ? A NI 303 ? 1_555 NE2 ? A HIS 237 ? A HIS 237 ? 1_555 90.0 ? 2 NE2 ? B HIS 235 ? B HIS 235 ? 1_555 NI ? I NI . ? B NI 305 ? 1_555 NE2 ? B HIS 237 ? B HIS 237 ? 1_555 90.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-04-14 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2019-07-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 3 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.contact_author' 2 3 'Structure model' '_software.contact_author_email' 3 3 'Structure model' '_software.language' 4 3 'Structure model' '_software.location' 5 3 'Structure model' '_software.name' 6 3 'Structure model' '_software.type' 7 3 'Structure model' '_software.version' # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal CNS 1.2 ? ? ? ? refinement ? ? ? 1 PDB_EXTRACT 3.00 'March. 27, 2007' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 2 ADSC Quantum ? ? ? ? 'data collection' ? ? ? 3 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 4 SCALEPACK . ? ? ? ? 'data scaling' ? ? ? 5 SOLVE . ? ? ? ? phasing ? ? ? 6 RESOLVE . ? ? ? ? phasing ? ? ? 7 REFMAC . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran_77 ? 8 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH2 _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 189 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OE1 _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 GLN _pdbx_validate_close_contact.auth_seq_id_2 192 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 9 ? ? -61.35 0.82 2 1 ASN A 12 ? ? -89.11 -83.63 3 1 LEU A 14 ? ? -74.92 30.68 4 1 LYS A 15 ? ? 164.18 74.73 5 1 ASN A 16 ? ? -146.94 -109.88 6 1 ASP A 45 ? ? 51.47 76.31 7 1 ASP A 47 ? ? 161.90 55.42 8 1 MET A 48 ? ? -66.67 54.09 9 1 LEU A 49 ? ? -142.82 -34.91 10 1 PHE A 57 ? ? -140.07 -11.73 11 1 HIS A 58 ? ? -47.43 -9.58 12 1 SER A 73 ? ? -172.13 -19.24 13 1 GLU A 87 ? ? -147.51 -64.85 14 1 PRO A 93 ? ? -92.77 -69.76 15 1 ALA A 94 ? ? 57.43 -152.32 16 1 ILE A 97 ? ? -164.70 -16.72 17 1 ILE A 104 ? ? -69.06 39.23 18 1 ALA A 105 ? ? -156.52 -15.49 19 1 HIS A 107 ? ? -145.06 -35.19 20 1 PHE A 109 ? ? -72.54 30.60 21 1 SER A 144 ? ? -45.99 -19.89 22 1 ALA A 150 ? ? 66.73 -177.64 23 1 LEU A 151 ? ? -173.38 6.85 24 1 PHE A 152 ? ? -63.85 -178.49 25 1 ASP A 153 ? ? -38.96 -20.77 26 1 PRO A 157 ? ? -57.71 3.91 27 1 PHE A 158 ? ? -69.16 13.22 28 1 HIS A 161 ? ? -102.67 -164.88 29 1 ASP A 165 ? ? 47.68 -169.57 30 1 LEU A 171 ? ? -47.94 -11.64 31 1 HIS A 173 ? ? -49.67 -16.42 32 1 GLN A 175 ? ? -88.31 34.45 33 1 LYS A 177 ? ? -125.27 -59.89 34 1 ALA A 188 ? ? -11.99 -84.08 35 1 ASN A 216 ? ? 58.33 -6.38 36 1 GLU A 217 ? ? -123.42 -87.83 37 1 ASP A 220 ? ? -65.21 86.75 38 1 HIS A 221 ? ? -68.17 52.84 39 1 LYS A 222 ? ? -142.07 -27.63 40 1 GLN B 9 ? ? -61.52 1.02 41 1 ASN B 12 ? ? -89.15 -83.65 42 1 LEU B 14 ? ? -74.75 30.52 43 1 LYS B 15 ? ? 164.44 74.54 44 1 ASN B 16 ? ? -146.76 -109.84 45 1 ASP B 45 ? ? 51.57 76.52 46 1 ASP B 47 ? ? 162.23 55.35 47 1 MET B 48 ? ? -66.51 53.77 48 1 LEU B 49 ? ? -142.63 -34.47 49 1 PHE B 57 ? ? -140.28 -11.72 50 1 HIS B 58 ? ? -47.55 -9.80 51 1 SER B 73 ? ? -172.26 -19.18 52 1 GLU B 87 ? ? -147.46 -64.80 53 1 PRO B 93 ? ? -92.72 -69.77 54 1 ALA B 94 ? ? 57.29 -152.36 55 1 ILE B 97 ? ? -164.97 -16.73 56 1 ILE B 104 ? ? -69.06 39.39 57 1 ALA B 105 ? ? -156.50 -15.42 58 1 HIS B 107 ? ? -145.68 -35.53 59 1 PHE B 109 ? ? -72.40 30.57 60 1 SER B 144 ? ? -45.55 -19.30 61 1 ALA B 150 ? ? 66.35 -177.64 62 1 LEU B 151 ? ? -173.39 6.80 63 1 PHE B 152 ? ? -63.74 -178.61 64 1 ASP B 153 ? ? -39.06 -20.49 65 1 PRO B 157 ? ? -57.72 3.86 66 1 PHE B 158 ? ? -69.14 13.42 67 1 HIS B 161 ? ? -102.72 -164.85 68 1 ASP B 165 ? ? 47.70 -169.30 69 1 LEU B 171 ? ? -47.55 -12.18 70 1 HIS B 173 ? ? -49.55 -16.95 71 1 GLN B 175 ? ? -87.90 34.56 72 1 LYS B 177 ? ? -125.89 -59.35 73 1 ALA B 188 ? ? -12.04 -84.05 74 1 ASN B 216 ? ? 58.49 -6.81 75 1 GLU B 217 ? ? -123.18 -87.75 76 1 ASP B 220 ? ? -65.73 87.13 77 1 HIS B 221 ? ? -68.37 52.80 78 1 LYS B 222 ? ? -142.02 -27.58 79 1 HIS B 236 ? ? -113.66 -165.94 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASP 2 ? A ASP 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A HIS 18 ? A HIS 18 5 1 Y 1 A GLN 19 ? A GLN 19 6 1 Y 1 A HIS 20 ? A HIS 20 7 1 Y 1 A GLN 21 ? A GLN 21 8 1 Y 1 A ASP 22 ? A ASP 22 9 1 Y 1 A ALA 23 ? A ALA 23 10 1 Y 1 A ALA 24 ? A ALA 24 11 1 Y 1 A HIS 25 ? A HIS 25 12 1 Y 1 A ASP 26 ? A ASP 26 13 1 Y 1 A LEU 63 ? A LEU 63 14 1 Y 1 A ALA 64 ? A ALA 64 15 1 Y 1 A LYS 65 ? A LYS 65 16 1 Y 1 A ASN 66 ? A ASN 66 17 1 Y 1 A HIS 67 ? A HIS 67 18 1 Y 1 A PRO 68 ? A PRO 68 19 1 Y 1 A GLN 69 ? A GLN 69 20 1 Y 1 A ARG 70 ? A ARG 70 21 1 Y 1 A LYS 167 ? A LYS 167 22 1 Y 1 A ARG 168 ? A ARG 168 23 1 Y 1 A HIS 234 ? A HIS 234 24 1 Y 1 A HIS 239 ? A HIS 239 25 1 Y 1 B MET 1 ? B MET 1 26 1 Y 1 B ASP 2 ? B ASP 2 27 1 Y 1 B LEU 3 ? B LEU 3 28 1 Y 1 B HIS 18 ? B HIS 18 29 1 Y 1 B GLN 19 ? B GLN 19 30 1 Y 1 B HIS 20 ? B HIS 20 31 1 Y 1 B GLN 21 ? B GLN 21 32 1 Y 1 B ASP 22 ? B ASP 22 33 1 Y 1 B ALA 23 ? B ALA 23 34 1 Y 1 B ALA 24 ? B ALA 24 35 1 Y 1 B HIS 25 ? B HIS 25 36 1 Y 1 B ASP 26 ? B ASP 26 37 1 Y 1 B LEU 63 ? B LEU 63 38 1 Y 1 B ALA 64 ? B ALA 64 39 1 Y 1 B LYS 65 ? B LYS 65 40 1 Y 1 B ASN 66 ? B ASN 66 41 1 Y 1 B HIS 67 ? B HIS 67 42 1 Y 1 B PRO 68 ? B PRO 68 43 1 Y 1 B GLN 69 ? B GLN 69 44 1 Y 1 B ARG 70 ? B ARG 70 45 1 Y 1 B LYS 167 ? B LYS 167 46 1 Y 1 B ARG 168 ? B ARG 168 47 1 Y 1 B HIS 234 ? B HIS 234 48 1 Y 1 B HIS 239 ? B HIS 239 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'NICKEL (II) ION' _pdbx_entity_nonpoly.comp_id NI #