data_3H7E # _entry.id 3H7E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3H7E RCSB RCSB052785 WWPDB D_1000052785 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2011-06-01 _pdbx_database_PDB_obs_spr.pdb_id 3RK0 _pdbx_database_PDB_obs_spr.replace_pdb_id 3H7E _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1RU8 '1RU8 is the crystal structure of the apo enzyme' unspecified TargetDB PfR23 . unspecified # _pdbx_database_status.entry_id 3H7E _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-04-24 _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Forouhar, F.' 1 'Saadat, N.' 2 'Hussain, M.' 3 'Seetharaman, J.' 4 'Janjua, J.' 5 'Xiao, R.' 6 'Cunningham, K.' 7 'Ma, L.' 8 'Shastry, R.' 9 'Everett, J.K.' 10 'Nair, R.' 11 'Acton, T.B.' 12 'Rost, B.' 13 'Montelione, G.T.' 14 'Hunt, J.F.' 15 'Tong, L.' 16 'Northeast Structural Genomics Consortium (NESG)' 17 # _citation.id primary _citation.title 'Northeast Structural Genomics Consortium Target PfR23' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Forouhar, F.' 1 primary 'Saadat, N.' 2 primary 'Hussain, M.' 3 primary 'Seetharaman, J.' 4 primary 'Janjua, J.' 5 primary 'Xiao, R.' 6 primary 'Cunningham, K.' 7 primary 'Ma, L.' 8 primary 'Shastry, R.' 9 primary 'Everett, J.K.' 10 primary 'Nair, R.' 11 primary 'Acton, T.B.' 12 primary 'Rost, B.' 13 primary 'Montelione, G.T.' 14 primary 'Hunt, J.F.' 15 primary 'Tong, L.' 16 # _cell.entry_id 3H7E _cell.length_a 85.201 _cell.length_b 85.201 _cell.length_c 74.249 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.pdbx_unique_axis ? _cell.Z_PDB 8 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3H7E _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.Int_Tables_number 92 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'N-type ATP pyrophosphatase superfamily' 27107.328 1 ? ? ? ? 2 non-polymer syn 'ADENOSINE MONOPHOSPHATE' 347.221 1 ? ? ? ? 3 water nat water 18.015 19 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)VGLADVAVLYSGGKDSNYALYWAIKNRFSVKFLVT(MSE)VSENEESY(MSE)YHTINANLTDLQARALGIPLVK GFTQGEKEKEVEDLKRVLSGLKIQGIVAGALASKYQRKRIEKVAKELGLEVYTPAWGRDAKEY(MSE)RELLNLGFKI (MSE)VVGVSAYGLDESWLGRILDESALEELITLNEKYKVHVAGEGGEFETFVLD(MSE)PLFKYKIVVDKAKKVWEPCT SSGKLIIEEAHLESKLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MVGLADVAVLYSGGKDSNYALYWAIKNRFSVKFLVTMVSENEESYMYHTINANLTDLQARALGIPLVKGFTQGEKEKEVE DLKRVLSGLKIQGIVAGALASKYQRKRIEKVAKELGLEVYTPAWGRDAKEYMRELLNLGFKIMVVGVSAYGLDESWLGRI LDESALEELITLNEKYKVHVAGEGGEFETFVLDMPLFKYKIVVDKAKKVWEPCTSSGKLIIEEAHLESKLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier PfR23 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 VAL n 1 3 GLY n 1 4 LEU n 1 5 ALA n 1 6 ASP n 1 7 VAL n 1 8 ALA n 1 9 VAL n 1 10 LEU n 1 11 TYR n 1 12 SER n 1 13 GLY n 1 14 GLY n 1 15 LYS n 1 16 ASP n 1 17 SER n 1 18 ASN n 1 19 TYR n 1 20 ALA n 1 21 LEU n 1 22 TYR n 1 23 TRP n 1 24 ALA n 1 25 ILE n 1 26 LYS n 1 27 ASN n 1 28 ARG n 1 29 PHE n 1 30 SER n 1 31 VAL n 1 32 LYS n 1 33 PHE n 1 34 LEU n 1 35 VAL n 1 36 THR n 1 37 MSE n 1 38 VAL n 1 39 SER n 1 40 GLU n 1 41 ASN n 1 42 GLU n 1 43 GLU n 1 44 SER n 1 45 TYR n 1 46 MSE n 1 47 TYR n 1 48 HIS n 1 49 THR n 1 50 ILE n 1 51 ASN n 1 52 ALA n 1 53 ASN n 1 54 LEU n 1 55 THR n 1 56 ASP n 1 57 LEU n 1 58 GLN n 1 59 ALA n 1 60 ARG n 1 61 ALA n 1 62 LEU n 1 63 GLY n 1 64 ILE n 1 65 PRO n 1 66 LEU n 1 67 VAL n 1 68 LYS n 1 69 GLY n 1 70 PHE n 1 71 THR n 1 72 GLN n 1 73 GLY n 1 74 GLU n 1 75 LYS n 1 76 GLU n 1 77 LYS n 1 78 GLU n 1 79 VAL n 1 80 GLU n 1 81 ASP n 1 82 LEU n 1 83 LYS n 1 84 ARG n 1 85 VAL n 1 86 LEU n 1 87 SER n 1 88 GLY n 1 89 LEU n 1 90 LYS n 1 91 ILE n 1 92 GLN n 1 93 GLY n 1 94 ILE n 1 95 VAL n 1 96 ALA n 1 97 GLY n 1 98 ALA n 1 99 LEU n 1 100 ALA n 1 101 SER n 1 102 LYS n 1 103 TYR n 1 104 GLN n 1 105 ARG n 1 106 LYS n 1 107 ARG n 1 108 ILE n 1 109 GLU n 1 110 LYS n 1 111 VAL n 1 112 ALA n 1 113 LYS n 1 114 GLU n 1 115 LEU n 1 116 GLY n 1 117 LEU n 1 118 GLU n 1 119 VAL n 1 120 TYR n 1 121 THR n 1 122 PRO n 1 123 ALA n 1 124 TRP n 1 125 GLY n 1 126 ARG n 1 127 ASP n 1 128 ALA n 1 129 LYS n 1 130 GLU n 1 131 TYR n 1 132 MSE n 1 133 ARG n 1 134 GLU n 1 135 LEU n 1 136 LEU n 1 137 ASN n 1 138 LEU n 1 139 GLY n 1 140 PHE n 1 141 LYS n 1 142 ILE n 1 143 MSE n 1 144 VAL n 1 145 VAL n 1 146 GLY n 1 147 VAL n 1 148 SER n 1 149 ALA n 1 150 TYR n 1 151 GLY n 1 152 LEU n 1 153 ASP n 1 154 GLU n 1 155 SER n 1 156 TRP n 1 157 LEU n 1 158 GLY n 1 159 ARG n 1 160 ILE n 1 161 LEU n 1 162 ASP n 1 163 GLU n 1 164 SER n 1 165 ALA n 1 166 LEU n 1 167 GLU n 1 168 GLU n 1 169 LEU n 1 170 ILE n 1 171 THR n 1 172 LEU n 1 173 ASN n 1 174 GLU n 1 175 LYS n 1 176 TYR n 1 177 LYS n 1 178 VAL n 1 179 HIS n 1 180 VAL n 1 181 ALA n 1 182 GLY n 1 183 GLU n 1 184 GLY n 1 185 GLY n 1 186 GLU n 1 187 PHE n 1 188 GLU n 1 189 THR n 1 190 PHE n 1 191 VAL n 1 192 LEU n 1 193 ASP n 1 194 MSE n 1 195 PRO n 1 196 LEU n 1 197 PHE n 1 198 LYS n 1 199 TYR n 1 200 LYS n 1 201 ILE n 1 202 VAL n 1 203 VAL n 1 204 ASP n 1 205 LYS n 1 206 ALA n 1 207 LYS n 1 208 LYS n 1 209 VAL n 1 210 TRP n 1 211 GLU n 1 212 PRO n 1 213 CYS n 1 214 THR n 1 215 SER n 1 216 SER n 1 217 GLY n 1 218 LYS n 1 219 LEU n 1 220 ILE n 1 221 ILE n 1 222 GLU n 1 223 GLU n 1 224 ALA n 1 225 HIS n 1 226 LEU n 1 227 GLU n 1 228 SER n 1 229 LYS n 1 230 LEU n 1 231 GLU n 1 232 HIS n 1 233 HIS n 1 234 HIS n 1 235 HIS n 1 236 HIS n 1 237 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PF0828 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSM 3638' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus furiosus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2261 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+ Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pPIC3.5 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8U2K6_PYRFU _struct_ref.pdbx_db_accession Q8U2K6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVGLADVAVLYSGGKDSNYALYWAIKNRFSVKFLVTMVSENEESYMYHTINANLTDLQARALGIPLVKGFTQGEKEKEVE DLKRVLSGLKIQGIVAGALASKYQRKRIEKVAKELGLEVYTPAWGRDAKEYMRELLNLGFKIMVVGVSAYGLDESWLGRI LDESALEELITLNEKYKVHVAGEGGEFETFVLDMPLFKYKIVVDKAKKVWEPCTSSGKLIIEEAHLESK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3H7E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 229 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8U2K6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 229 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 229 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3H7E LEU A 230 ? UNP Q8U2K6 ? ? 'expression tag' 230 1 1 3H7E GLU A 231 ? UNP Q8U2K6 ? ? 'expression tag' 231 2 1 3H7E HIS A 232 ? UNP Q8U2K6 ? ? 'expression tag' 232 3 1 3H7E HIS A 233 ? UNP Q8U2K6 ? ? 'expression tag' 233 4 1 3H7E HIS A 234 ? UNP Q8U2K6 ? ? 'expression tag' 234 5 1 3H7E HIS A 235 ? UNP Q8U2K6 ? ? 'expression tag' 235 6 1 3H7E HIS A 236 ? UNP Q8U2K6 ? ? 'expression tag' 236 7 1 3H7E HIS A 237 ? UNP Q8U2K6 ? ? 'expression tag' 237 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 AMP non-polymer . 'ADENOSINE MONOPHOSPHATE' ? 'C10 H14 N5 O7 P' 347.221 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 3H7E _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.49 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 50.51 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.temp ? _exptl_crystal_grow.pdbx_details ;Protein solution: 10mM Tris-HCl (pH 7.5), 100mM NaCl, 5mM DTT, 0.02% NaN3, and 5mM dephospho-coenzyme . Reservoir solution: 0.1M Hepes (pH 7.5), 4.3M NaCl, and 5mM DTT , Microbatch, under oil ; _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MAR CCD 165 mm' _diffrn_detector.pdbx_collection_date 2008-07-31 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97915 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4C' _diffrn_source.pdbx_wavelength_list 0.97915 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4C # _reflns.entry_id 3H7E _reflns.B_iso_Wilson_estimate 19.700 _reflns.observed_criterion_sigma_F 2 _reflns.observed_criterion_sigma_I 2 _reflns.d_resolution_high 2.4 _reflns.d_resolution_low 30 _reflns.number_all 16586 _reflns.number_obs 17439 _reflns.percent_possible_obs 85.3 _reflns.pdbx_Rmerge_I_obs 0.050 _reflns.pdbx_Rsym_value 0.053 _reflns.pdbx_netI_over_sigmaI 41.8 _reflns.pdbx_redundancy 8.3 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.4 _reflns_shell.d_res_low 2.49 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 63.8 _reflns_shell.Rmerge_I_obs 0.120 _reflns_shell.meanI_over_sigI_obs 7.6 _reflns_shell.pdbx_Rsym_value 0.159 _reflns_shell.pdbx_redundancy 4.4 _reflns_shell.number_unique_all 2029 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3H7E _refine.ls_d_res_high 2.400 _refine.ls_d_res_low 19.940 _refine.pdbx_ls_sigma_F 2.00 _refine.pdbx_data_cutoff_high_absF 374630.781 _refine.pdbx_data_cutoff_low_absF 0.000 _refine.ls_percent_reflns_obs 85.300 _refine.ls_number_reflns_obs 17416 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.ls_R_factor_R_work 0.228 _refine.ls_R_factor_R_free 0.256 _refine.ls_percent_reflns_R_free 4.900 _refine.ls_number_reflns_R_free 857 _refine.ls_R_factor_R_free_error 0.009 _refine.B_iso_mean 47.700 _refine.solvent_model_param_bsol 37.548 _refine.solvent_model_param_ksol 0.350 _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.aniso_B[1][1] 2.140 _refine.aniso_B[2][2] 2.140 _refine.aniso_B[3][3] -4.270 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.solvent_model_details 'FLAT MODEL' _refine.pdbx_ls_sigma_I 2.00 _refine.ls_number_reflns_all 20417 _refine.ls_R_factor_all 0.231 _refine.ls_R_factor_obs 0.229 _refine.ls_redundancy_reflns_obs ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.occupancy_max ? _refine.occupancy_min ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3H7E _refine_analyze.Luzzati_coordinate_error_obs 0.300 _refine_analyze.Luzzati_sigma_a_obs 0.100 _refine_analyze.Luzzati_d_res_low_obs 5.000 _refine_analyze.Luzzati_coordinate_error_free 0.380 _refine_analyze.Luzzati_sigma_a_free 0.290 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1774 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.number_atoms_solvent 19 _refine_hist.number_atoms_total 1816 _refine_hist.d_res_high 2.400 _refine_hist.d_res_low 19.940 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d ? 0.007 ? ? 'X-RAY DIFFRACTION' ? c_angle_deg ? 1.000 ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d ? 23.100 ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d ? 0.650 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 2.400 _refine_ls_shell.d_res_low 2.490 _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.percent_reflns_obs 63.700 _refine_ls_shell.number_reflns_R_work 1229 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.222 _refine_ls_shell.R_factor_R_free 0.276 _refine_ls_shell.percent_reflns_R_free 4.900 _refine_ls_shell.number_reflns_R_free 64 _refine_ls_shell.R_factor_R_free_error 0.035 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 1293 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3H7E _struct.title ;Crystal Structure of an N-type ATP pyrophosphatase (PF0828) in complex with AMP from Pyrococcus furiosus, Northeast Structural Genomics Consortium Target PfR23 ; _struct.pdbx_descriptor 'N-type ATP pyrophosphatase superfamily' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3H7E _struct_keywords.text ;alpha-beta protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, HYDROLASE ; _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 14 ? ASN A 27 ? GLY A 14 ASN A 27 1 ? 14 HELX_P HELX_P2 2 ASN A 53 ? GLY A 63 ? ASN A 53 GLY A 63 1 ? 11 HELX_P HELX_P3 3 LYS A 77 ? SER A 87 ? LYS A 77 SER A 87 1 ? 11 HELX_P HELX_P4 4 SER A 101 ? TYR A 103 ? SER A 101 TYR A 103 5 ? 3 HELX_P HELX_P5 5 GLN A 104 ? GLY A 116 ? GLN A 104 GLY A 116 1 ? 13 HELX_P HELX_P6 6 ASP A 127 ? LEU A 138 ? ASP A 127 LEU A 138 1 ? 12 HELX_P HELX_P7 7 ASP A 153 ? LEU A 157 ? ASP A 153 LEU A 157 5 ? 5 HELX_P HELX_P8 8 ASP A 162 ? LYS A 177 ? ASP A 162 LYS A 177 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A THR 36 C ? ? ? 1_555 A MSE 37 N ? ? A THR 36 A MSE 37 1_555 ? ? ? ? ? ? ? 1.325 ? covale2 covale ? ? A MSE 37 C ? ? ? 1_555 A VAL 38 N ? ? A MSE 37 A VAL 38 1_555 ? ? ? ? ? ? ? 1.328 ? covale3 covale ? ? A TYR 45 C ? ? ? 1_555 A MSE 46 N ? ? A TYR 45 A MSE 46 1_555 ? ? ? ? ? ? ? 1.330 ? covale4 covale ? ? A MSE 46 C ? ? ? 1_555 A TYR 47 N ? ? A MSE 46 A TYR 47 1_555 ? ? ? ? ? ? ? 1.332 ? covale5 covale ? ? A TYR 131 C ? ? ? 1_555 A MSE 132 N ? ? A TYR 131 A MSE 132 1_555 ? ? ? ? ? ? ? 1.332 ? covale6 covale ? ? A MSE 132 C ? ? ? 1_555 A ARG 133 N ? ? A MSE 132 A ARG 133 1_555 ? ? ? ? ? ? ? 1.327 ? covale7 covale ? ? A ILE 142 C ? ? ? 1_555 A MSE 143 N ? ? A ILE 142 A MSE 143 1_555 ? ? ? ? ? ? ? 1.329 ? covale8 covale ? ? A MSE 143 C ? ? ? 1_555 A VAL 144 N ? ? A MSE 143 A VAL 144 1_555 ? ? ? ? ? ? ? 1.327 ? covale9 covale ? ? A ASP 193 C ? ? ? 1_555 A MSE 194 N ? ? A ASP 193 A MSE 194 1_555 ? ? ? ? ? ? ? 1.326 ? covale10 covale ? ? A MSE 194 C ? ? ? 1_555 A PRO 195 N ? ? A MSE 194 A PRO 195 1_555 ? ? ? ? ? ? ? 1.337 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 66 ? THR A 71 ? LEU A 66 THR A 71 A 2 SER A 30 ? SER A 39 ? SER A 30 SER A 39 A 3 ASP A 6 ? LEU A 10 ? ASP A 6 LEU A 10 A 4 GLY A 93 ? VAL A 95 ? GLY A 93 VAL A 95 A 5 GLU A 118 ? TYR A 120 ? GLU A 118 TYR A 120 B 1 PHE A 187 ? ASP A 193 ? PHE A 187 ASP A 193 B 2 LYS A 141 ? VAL A 147 ? LYS A 141 VAL A 147 B 3 GLY A 217 ? SER A 228 ? GLY A 217 SER A 228 B 4 TYR A 199 ? TRP A 210 ? TYR A 199 TRP A 210 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 67 ? O VAL A 67 N LEU A 34 ? N LEU A 34 A 2 3 O VAL A 35 ? O VAL A 35 N VAL A 9 ? N VAL A 9 A 3 4 N ALA A 8 ? N ALA A 8 O VAL A 95 ? O VAL A 95 A 4 5 N ILE A 94 ? N ILE A 94 O GLU A 118 ? O GLU A 118 B 1 2 O LEU A 192 ? O LEU A 192 N LYS A 141 ? N LYS A 141 B 2 3 N VAL A 145 ? N VAL A 145 O LEU A 219 ? O LEU A 219 B 3 4 O ILE A 220 ? O ILE A 220 N LYS A 207 ? N LYS A 207 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 12 _struct_site.details 'BINDING SITE FOR RESIDUE AMP A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 LEU A 10 ? LEU A 10 . ? 1_555 ? 2 AC1 12 SER A 12 ? SER A 12 . ? 1_555 ? 3 AC1 12 GLY A 14 ? GLY A 14 . ? 1_555 ? 4 AC1 12 LYS A 15 ? LYS A 15 . ? 1_555 ? 5 AC1 12 ASP A 16 ? ASP A 16 . ? 1_555 ? 6 AC1 12 SER A 17 ? SER A 17 . ? 1_555 ? 7 AC1 12 MSE A 37 ? MSE A 37 . ? 1_555 ? 8 AC1 12 ALA A 96 ? ALA A 96 . ? 1_555 ? 9 AC1 12 GLY A 97 ? GLY A 97 . ? 1_555 ? 10 AC1 12 ALA A 100 ? ALA A 100 . ? 1_555 ? 11 AC1 12 GLN A 104 ? GLN A 104 . ? 1_555 ? 12 AC1 12 HOH C . ? HOH A 238 . ? 1_555 ? # _database_PDB_matrix.entry_id 3H7E _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.000000 _database_PDB_matrix.origx_vector[2] 0.000000 _database_PDB_matrix.origx_vector[3] 0.000000 # _atom_sites.entry_id 3H7E _atom_sites.fract_transf_matrix[1][1] 0.011737 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011737 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013468 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O P SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 VAL 2 2 ? ? ? A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 MSE 37 37 37 MSE MSE A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLU 43 43 ? ? ? A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 MSE 46 46 46 MSE MSE A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 HIS 48 48 48 HIS GLY A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 TYR 120 120 120 TYR TYR A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 PRO 122 122 122 PRO PRO A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 TRP 124 124 ? ? ? A . n A 1 125 GLY 125 125 ? ? ? A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 TYR 131 131 131 TYR TYR A . n A 1 132 MSE 132 132 132 MSE MSE A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 MSE 143 143 143 MSE MSE A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 GLY 151 151 151 GLY GLY A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 TRP 156 156 156 TRP TRP A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 LYS 175 175 175 LYS LYS A . n A 1 176 TYR 176 176 176 TYR TYR A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 VAL 178 178 178 VAL VAL A . n A 1 179 HIS 179 179 179 HIS HIS A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 GLY 182 182 182 GLY GLY A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 PHE 187 187 187 PHE PHE A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 THR 189 189 189 THR THR A . n A 1 190 PHE 190 190 190 PHE PHE A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 ASP 193 193 193 ASP ASP A . n A 1 194 MSE 194 194 194 MSE MSE A . n A 1 195 PRO 195 195 195 PRO PRO A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 PHE 197 197 197 PHE PHE A . n A 1 198 LYS 198 198 198 LYS LYS A . n A 1 199 TYR 199 199 199 TYR TYR A . n A 1 200 LYS 200 200 200 LYS LYS A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 ASP 204 204 204 ASP ASP A . n A 1 205 LYS 205 205 205 LYS LYS A . n A 1 206 ALA 206 206 206 ALA ALA A . n A 1 207 LYS 207 207 207 LYS LYS A . n A 1 208 LYS 208 208 208 LYS LYS A . n A 1 209 VAL 209 209 209 VAL VAL A . n A 1 210 TRP 210 210 210 TRP TRP A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 PRO 212 212 212 PRO PRO A . n A 1 213 CYS 213 213 ? ? ? A . n A 1 214 THR 214 214 214 THR THR A . n A 1 215 SER 215 215 215 SER SER A . n A 1 216 SER 216 216 216 SER SER A . n A 1 217 GLY 217 217 217 GLY GLY A . n A 1 218 LYS 218 218 218 LYS LYS A . n A 1 219 LEU 219 219 219 LEU LEU A . n A 1 220 ILE 220 220 220 ILE ILE A . n A 1 221 ILE 221 221 221 ILE ILE A . n A 1 222 GLU 222 222 222 GLU GLU A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 ALA 224 224 224 ALA ALA A . n A 1 225 HIS 225 225 225 HIS HIS A . n A 1 226 LEU 226 226 226 LEU LEU A . n A 1 227 GLU 227 227 227 GLU GLU A . n A 1 228 SER 228 228 228 SER SER A . n A 1 229 LYS 229 229 229 LYS LYS A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 GLU 231 231 231 GLU GLU A . n A 1 232 HIS 232 232 ? ? ? A . n A 1 233 HIS 233 233 ? ? ? A . n A 1 234 HIS 234 234 ? ? ? A . n A 1 235 HIS 235 235 ? ? ? A . n A 1 236 HIS 236 236 ? ? ? A . n A 1 237 HIS 237 237 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 AMP 1 301 301 AMP AMP A . C 3 HOH 1 238 1 HOH HOH A . C 3 HOH 2 239 2 HOH HOH A . C 3 HOH 3 240 3 HOH HOH A . C 3 HOH 4 241 4 HOH HOH A . C 3 HOH 5 242 5 HOH HOH A . C 3 HOH 6 243 6 HOH HOH A . C 3 HOH 7 244 7 HOH HOH A . C 3 HOH 8 245 8 HOH HOH A . C 3 HOH 9 246 9 HOH HOH A . C 3 HOH 10 247 10 HOH HOH A . C 3 HOH 11 248 11 HOH HOH A . C 3 HOH 12 249 12 HOH HOH A . C 3 HOH 13 250 13 HOH HOH A . C 3 HOH 14 251 14 HOH HOH A . C 3 HOH 15 252 15 HOH HOH A . C 3 HOH 16 253 16 HOH HOH A . C 3 HOH 17 254 17 HOH HOH A . C 3 HOH 18 255 18 HOH HOH A . C 3 HOH 19 256 19 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 37 A MSE 37 ? MET SELENOMETHIONINE 2 A MSE 46 A MSE 46 ? MET SELENOMETHIONINE 3 A MSE 132 A MSE 132 ? MET SELENOMETHIONINE 4 A MSE 143 A MSE 143 ? MET SELENOMETHIONINE 5 A MSE 194 A MSE 194 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4020 ? 1 MORE -23 ? 1 'SSA (A^2)' 21550 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 85.2010000000 -1.0000000000 0.0000000000 0.0000000000 85.2010000000 0.0000000000 0.0000000000 -1.0000000000 37.1245000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-05-05 2 'Structure model' 1 1 2011-06-01 3 'Structure model' 1 2 2011-07-13 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 3 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal REFMAC5 . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran_77 ? 1 PDB_EXTRACT 3.00 'March. 27, 2007' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 2 MAR345dtb . ? ? ? ? 'data collection' ? ? ? 3 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 4 SCALEPACK . ? ? ? ? 'data scaling' ? ? ? 5 COMO . ? ? ? ? phasing ? ? ? 6 CNS '1.2 & XtalView' ? ? ? ? refinement ? ? ? 7 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 27 ? ? -102.84 40.00 2 1 ARG A 28 ? ? 58.59 6.55 3 1 GLN A 72 ? ? -80.11 -97.79 4 1 LYS A 75 ? ? -60.26 -92.00 5 1 VAL A 119 ? ? -110.34 78.59 6 1 SER A 148 ? ? -153.38 50.21 7 1 TYR A 150 ? ? -86.45 33.33 8 1 GLU A 174 ? ? -67.45 3.70 9 1 LYS A 175 ? ? -123.89 -64.48 10 1 GLU A 183 ? ? -52.11 104.30 11 1 GLU A 211 ? ? 58.87 92.86 12 1 SER A 215 ? ? -66.81 78.30 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS 48 ? CB ? A HIS 48 CB 2 1 Y 1 A HIS 48 ? CG ? A HIS 48 CG 3 1 Y 1 A HIS 48 ? ND1 ? A HIS 48 ND1 4 1 Y 1 A HIS 48 ? CD2 ? A HIS 48 CD2 5 1 Y 1 A HIS 48 ? CE1 ? A HIS 48 CE1 6 1 Y 1 A HIS 48 ? NE2 ? A HIS 48 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A VAL 2 ? A VAL 2 3 1 Y 1 A GLU 43 ? A GLU 43 4 1 Y 1 A TRP 124 ? A TRP 124 5 1 Y 1 A GLY 125 ? A GLY 125 6 1 Y 1 A CYS 213 ? A CYS 213 7 1 Y 1 A HIS 232 ? A HIS 232 8 1 Y 1 A HIS 233 ? A HIS 233 9 1 Y 1 A HIS 234 ? A HIS 234 10 1 Y 1 A HIS 235 ? A HIS 235 11 1 Y 1 A HIS 236 ? A HIS 236 12 1 Y 1 A HIS 237 ? A HIS 237 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ADENOSINE MONOPHOSPHATE' AMP 3 water HOH #