data_3H9N # _entry.id 3H9N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3H9N RCSB RCSB052866 WWPDB D_1000052866 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id IR66 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 3H9N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-04-30 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kuzin, A.' 1 'Su, M.' 2 'Seetharaman, J.' 3 'Mao, M.' 4 'Xiao, R.' 5 'Maglaqui, M.' 6 'Zhao, L.' 7 'Everett, J.K.' 8 'Nair, R.' 9 'Acton, T.B.' 10 'Rost, B.' 11 'Montelione, G.T.' 12 'Hunt, J.F.' 13 'Tong, L.' 14 'Northeast Structural Genomics Consortium (NESG)' 15 # _citation.id primary _citation.title 'Northeast Structural Genomics Consortium Target IR66' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kuzin, A.' 1 primary 'Su, M.' 2 primary 'Seetharaman, J.' 3 primary 'Mao, M.' 4 primary 'Xiao, R.' 5 primary 'Maglaqui, M.' 6 primary 'Zhao, L.' 7 primary 'Everett, J.K.' 8 primary 'Nair, R.' 9 primary 'Acton, T.B.' 10 primary 'Rost, B.' 11 primary 'Montelione, G.T.' 12 primary 'Hunt, J.F.' 13 primary 'Tong, L.' 14 # _cell.entry_id 3H9N _cell.length_a 129.642 _cell.length_b 129.642 _cell.length_c 129.642 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.pdbx_unique_axis ? _cell.Z_PDB 24 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3H9N _symmetry.space_group_name_H-M 'I 21 3' _symmetry.Int_Tables_number 199 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ribosome maturation factor rimM' 20636.738 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 4 ? ? ? ? 3 water nat water 18.015 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;HIEVVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQSIELENWRYHNHEIIVKLKGVDDREAAQILANVEI GVDLSVFPELEEGDYYWHDLIGCTVVNLEGYT(MSE)GTVTE(MSE)(MSE)ETGSNDVLVVKANTKDAFGKQERLIPFL YEQVVKRVDLTTKTIEVDWDAGFLEHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;HIEVVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQSIELENWRYHNHEIIVKLKGVDDREAAQILANVEI GVDLSVFPELEEGDYYWHDLIGCTVVNLEGYTMGTVTEMMETGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTT KTIEVDWDAGFLEHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier IR66 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 ILE n 1 3 GLU n 1 4 VAL n 1 5 VAL n 1 6 GLY n 1 7 LYS n 1 8 LEU n 1 9 GLY n 1 10 SER n 1 11 THR n 1 12 TYR n 1 13 GLY n 1 14 ILE n 1 15 ARG n 1 16 GLY n 1 17 TRP n 1 18 LEU n 1 19 ARG n 1 20 ILE n 1 21 TYR n 1 22 SER n 1 23 SER n 1 24 THR n 1 25 GLU n 1 26 GLN n 1 27 ALA n 1 28 GLU n 1 29 SER n 1 30 ILE n 1 31 PHE n 1 32 ASP n 1 33 TYR n 1 34 GLN n 1 35 PRO n 1 36 TRP n 1 37 PHE n 1 38 LEU n 1 39 LYS n 1 40 ILE n 1 41 LYS n 1 42 GLY n 1 43 GLU n 1 44 TRP n 1 45 GLN n 1 46 SER n 1 47 ILE n 1 48 GLU n 1 49 LEU n 1 50 GLU n 1 51 ASN n 1 52 TRP n 1 53 ARG n 1 54 TYR n 1 55 HIS n 1 56 ASN n 1 57 HIS n 1 58 GLU n 1 59 ILE n 1 60 ILE n 1 61 VAL n 1 62 LYS n 1 63 LEU n 1 64 LYS n 1 65 GLY n 1 66 VAL n 1 67 ASP n 1 68 ASP n 1 69 ARG n 1 70 GLU n 1 71 ALA n 1 72 ALA n 1 73 GLN n 1 74 ILE n 1 75 LEU n 1 76 ALA n 1 77 ASN n 1 78 VAL n 1 79 GLU n 1 80 ILE n 1 81 GLY n 1 82 VAL n 1 83 ASP n 1 84 LEU n 1 85 SER n 1 86 VAL n 1 87 PHE n 1 88 PRO n 1 89 GLU n 1 90 LEU n 1 91 GLU n 1 92 GLU n 1 93 GLY n 1 94 ASP n 1 95 TYR n 1 96 TYR n 1 97 TRP n 1 98 HIS n 1 99 ASP n 1 100 LEU n 1 101 ILE n 1 102 GLY n 1 103 CYS n 1 104 THR n 1 105 VAL n 1 106 VAL n 1 107 ASN n 1 108 LEU n 1 109 GLU n 1 110 GLY n 1 111 TYR n 1 112 THR n 1 113 MSE n 1 114 GLY n 1 115 THR n 1 116 VAL n 1 117 THR n 1 118 GLU n 1 119 MSE n 1 120 MSE n 1 121 GLU n 1 122 THR n 1 123 GLY n 1 124 SER n 1 125 ASN n 1 126 ASP n 1 127 VAL n 1 128 LEU n 1 129 VAL n 1 130 VAL n 1 131 LYS n 1 132 ALA n 1 133 ASN n 1 134 THR n 1 135 LYS n 1 136 ASP n 1 137 ALA n 1 138 PHE n 1 139 GLY n 1 140 LYS n 1 141 GLN n 1 142 GLU n 1 143 ARG n 1 144 LEU n 1 145 ILE n 1 146 PRO n 1 147 PHE n 1 148 LEU n 1 149 TYR n 1 150 GLU n 1 151 GLN n 1 152 VAL n 1 153 VAL n 1 154 LYS n 1 155 ARG n 1 156 VAL n 1 157 ASP n 1 158 LEU n 1 159 THR n 1 160 THR n 1 161 LYS n 1 162 THR n 1 163 ILE n 1 164 GLU n 1 165 VAL n 1 166 ASP n 1 167 TRP n 1 168 ASP n 1 169 ALA n 1 170 GLY n 1 171 PHE n 1 172 LEU n 1 173 GLU n 1 174 HIS n 1 175 HIS n 1 176 HIS n 1 177 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HI0203, rimM' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Haemophilus influenzae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 727 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+ Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RIMM_HAEIN _struct_ref.pdbx_db_accession P44568 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;HIEVVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQSIELENWRYHNHEIIVKLKGVDDREAAQILANVEI GVDLSVFPELEEGDYYWHDLIGCTVVNLEGYTMGTVTEMMETGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTT KTIEVDWDAGF ; _struct_ref.pdbx_align_begin 8 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3H9N _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 171 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P44568 _struct_ref_seq.db_align_beg 8 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 178 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 178 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3H9N LEU A 172 ? UNP P44568 ? ? 'expression tag' 179 1 1 3H9N GLU A 173 ? UNP P44568 ? ? 'expression tag' 180 2 1 3H9N HIS A 174 ? UNP P44568 ? ? 'expression tag' 181 3 1 3H9N HIS A 175 ? UNP P44568 ? ? 'expression tag' 182 4 1 3H9N HIS A 176 ? UNP P44568 ? ? 'expression tag' 183 5 1 3H9N HIS A 177 ? UNP P44568 ? ? 'expression tag' 184 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 3H9N _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 4.40 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 72.04 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.temp ? _exptl_crystal_grow.pdbx_details ;0.4M Li2SO4, 0.1M Na3Citrate, 0.2M NH42SO4, ph 5.6, VAPOR DIFFUSION, HANGING DROP ; _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2009-04-02 _diffrn_detector.details mirror # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97901 1.0 2 0.97927 1.0 3 0.96790 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_wavelength_list '0.97901 0.97927 0.96790' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A # _reflns.entry_id 3H9N _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3.0 _reflns.d_resolution_high 2.7 _reflns.d_resolution_low 50 _reflns.number_all ? _reflns.number_obs 19211 _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs 0.091 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 46.3 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 34.6 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low 2.8 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.523 _reflns_shell.meanI_over_sigI_obs 5.0 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3H9N _refine.ls_d_res_high 2.700 _refine.ls_d_res_low 20.000 _refine.pdbx_ls_sigma_F 2 _refine.ls_percent_reflns_obs 89.800 _refine.ls_number_reflns_obs 17302 _refine.ls_R_factor_R_work 0.211 _refine.ls_R_factor_R_free 0.237 _refine.ls_percent_reflns_R_free 4.500 _refine.ls_number_reflns_R_free 872 _refine.B_iso_mean 59.099 _refine.solvent_model_param_bsol 30.952 _refine.aniso_B[1][1] 0.000 _refine.aniso_B[2][2] 0.000 _refine.aniso_B[3][3] 0.000 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1448 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 2 _refine_hist.number_atoms_total 1470 _refine_hist.d_res_high 2.700 _refine_hist.d_res_low 20.000 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d ? 0.007 ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? 1.300 ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? 1.420 1.500 ? 'X-RAY DIFFRACTION' ? c_scbond_it ? 1.944 2.000 ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? 2.490 2.000 ? 'X-RAY DIFFRACTION' ? c_scangle_it ? 2.993 2.500 ? 'X-RAY DIFFRACTION' ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 CNS_TOPPAR:protein_rep.param CNS_TOPPAR:protein.top 'X-RAY DIFFRACTION' 2 CNS_TOPPAR:dna-rna_rep.param CNS_TOPPAR:dna-rna.top 'X-RAY DIFFRACTION' 3 CNS_TOPPAR:water_rep.param CNS_TOPPAR:water.top 'X-RAY DIFFRACTION' 4 CNS_TOPPAR:ion.param CNS_TOPPAR:ion.top 'X-RAY DIFFRACTION' # _struct.entry_id 3H9N _struct.title ;Crystal structure of the ribosome maturation factor rimm (hi0203) from h.influenzae. northeast structural genomics consortium target IR66. ; _struct.pdbx_descriptor 'Ribosome maturation factor rimM' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3H9N _struct_keywords.text ;Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, IR66, rimM, Chaperone, Cytoplasm, Ribosome biogenesis, RIBOSOMAL PROTEIN ; _struct_keywords.pdbx_keywords 'RIBOSOMAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 27 ? TYR A 33 ? ALA A 34 TYR A 40 5 ? 7 HELX_P HELX_P2 2 ASP A 68 ? ILE A 74 ? ASP A 75 ILE A 81 1 ? 7 HELX_P HELX_P3 3 ASP A 94 ? LEU A 100 ? ASP A 101 LEU A 107 5 ? 7 HELX_P HELX_P4 4 LEU A 158 ? THR A 160 ? LEU A 165 THR A 167 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A THR 112 C ? ? ? 1_555 A MSE 113 N ? ? A THR 119 A MSE 120 1_555 ? ? ? ? ? ? ? 1.325 ? covale2 covale ? ? A MSE 113 C ? ? ? 1_555 A GLY 114 N ? ? A MSE 120 A GLY 121 1_555 ? ? ? ? ? ? ? 1.329 ? covale3 covale ? ? A GLU 118 C ? ? ? 1_555 A MSE 119 N ? ? A GLU 125 A MSE 126 1_555 ? ? ? ? ? ? ? 1.328 ? covale4 covale ? ? A MSE 119 C ? ? ? 1_555 A MSE 120 N ? ? A MSE 126 A MSE 127 1_555 ? ? ? ? ? ? ? 1.321 ? covale5 covale ? ? A MSE 120 C ? ? ? 1_555 A GLU 121 N ? ? A MSE 127 A GLU 128 1_555 ? ? ? ? ? ? ? 1.326 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLN _struct_mon_prot_cis.label_seq_id 34 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLN _struct_mon_prot_cis.auth_seq_id 41 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 35 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 42 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.25 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? parallel B 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 43 ? ILE A 47 ? GLU A 50 ILE A 54 A 2 TRP A 36 ? ILE A 40 ? TRP A 43 ILE A 47 A 3 GLU A 79 ? ASP A 83 ? GLU A 86 ASP A 90 A 4 ILE A 2 ? THR A 11 ? ILE A 9 THR A 18 A 5 LEU A 18 ? SER A 22 ? LEU A 25 SER A 29 A 6 ILE A 59 ? LEU A 63 ? ILE A 66 LEU A 70 A 7 LEU A 49 ? TYR A 54 ? LEU A 56 TYR A 61 B 1 GLU A 142 ? PRO A 146 ? GLU A 149 PRO A 153 B 2 ASP A 126 ? LYS A 131 ? ASP A 133 LYS A 138 B 3 THR A 112 ? GLU A 121 ? THR A 119 GLU A 128 B 4 THR A 104 ? ASN A 107 ? THR A 111 ASN A 114 B 5 THR A 162 ? VAL A 165 ? THR A 169 VAL A 172 B 6 VAL A 153 ? ASP A 157 ? VAL A 160 ASP A 164 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 45 ? O GLN A 52 N LEU A 38 ? N LEU A 45 A 2 3 N PHE A 37 ? N PHE A 44 O GLY A 81 ? O GLY A 88 A 3 4 O ILE A 80 ? O ILE A 87 N VAL A 5 ? N VAL A 12 A 4 5 N SER A 10 ? N SER A 17 O ARG A 19 ? O ARG A 26 A 5 6 N LEU A 18 ? N LEU A 25 O VAL A 61 ? O VAL A 68 A 6 7 O LYS A 62 ? O LYS A 69 N GLU A 50 ? N GLU A 57 B 1 2 O ILE A 145 ? O ILE A 152 N LEU A 128 ? N LEU A 135 B 2 3 O VAL A 129 ? O VAL A 136 N GLU A 118 ? N GLU A 125 B 3 4 O MSE A 113 ? O MSE A 120 N VAL A 105 ? N VAL A 112 B 4 5 N THR A 104 ? N THR A 111 O ILE A 163 ? O ILE A 170 B 5 6 O THR A 162 ? O THR A 169 N ASP A 157 ? N ASP A 164 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 1' AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 2' AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 3' AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 4' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 LYS A 140 ? LYS A 147 . ? 1_555 ? 2 AC1 3 GLY A 170 ? GLY A 177 . ? 1_555 ? 3 AC1 3 PHE A 171 ? PHE A 178 . ? 1_555 ? 4 AC2 3 TYR A 12 ? TYR A 19 . ? 1_555 ? 5 AC2 3 ARG A 53 ? ARG A 60 . ? 1_555 ? 6 AC2 3 HIS A 55 ? HIS A 62 . ? 1_555 ? 7 AC3 4 LYS A 140 ? LYS A 147 . ? 1_555 ? 8 AC3 4 ARG A 143 ? ARG A 150 . ? 1_555 ? 9 AC3 4 LEU A 144 ? LEU A 151 . ? 1_555 ? 10 AC3 4 TRP A 167 ? TRP A 174 . ? 1_555 ? 11 AC4 4 GLY A 139 ? GLY A 146 . ? 1_555 ? 12 AC4 4 LYS A 140 ? LYS A 147 . ? 1_555 ? 13 AC4 4 GLN A 141 ? GLN A 148 . ? 1_555 ? 14 AC4 4 GLU A 142 ? GLU A 149 . ? 1_555 ? # _atom_sites.entry_id 3H9N _atom_sites.fract_transf_matrix[1][1] 0.007714 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007714 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007714 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 8 8 HIS HIS A . n A 1 2 ILE 2 9 9 ILE ILE A . n A 1 3 GLU 3 10 10 GLU GLU A . n A 1 4 VAL 4 11 11 VAL VAL A . n A 1 5 VAL 5 12 12 VAL VAL A . n A 1 6 GLY 6 13 13 GLY GLY A . n A 1 7 LYS 7 14 14 LYS LYS A . n A 1 8 LEU 8 15 15 LEU LEU A . n A 1 9 GLY 9 16 16 GLY GLY A . n A 1 10 SER 10 17 17 SER SER A . n A 1 11 THR 11 18 18 THR THR A . n A 1 12 TYR 12 19 19 TYR TYR A . n A 1 13 GLY 13 20 20 GLY GLY A . n A 1 14 ILE 14 21 21 ILE ILE A . n A 1 15 ARG 15 22 22 ARG ARG A . n A 1 16 GLY 16 23 23 GLY GLY A . n A 1 17 TRP 17 24 24 TRP TRP A . n A 1 18 LEU 18 25 25 LEU LEU A . n A 1 19 ARG 19 26 26 ARG ARG A . n A 1 20 ILE 20 27 27 ILE ILE A . n A 1 21 TYR 21 28 28 TYR TYR A . n A 1 22 SER 22 29 29 SER SER A . n A 1 23 SER 23 30 30 SER SER A . n A 1 24 THR 24 31 31 THR THR A . n A 1 25 GLU 25 32 32 GLU GLU A . n A 1 26 GLN 26 33 33 GLN GLN A . n A 1 27 ALA 27 34 34 ALA ALA A . n A 1 28 GLU 28 35 35 GLU GLU A . n A 1 29 SER 29 36 36 SER SER A . n A 1 30 ILE 30 37 37 ILE ILE A . n A 1 31 PHE 31 38 38 PHE PHE A . n A 1 32 ASP 32 39 39 ASP ASP A . n A 1 33 TYR 33 40 40 TYR TYR A . n A 1 34 GLN 34 41 41 GLN GLN A . n A 1 35 PRO 35 42 42 PRO PRO A . n A 1 36 TRP 36 43 43 TRP TRP A . n A 1 37 PHE 37 44 44 PHE PHE A . n A 1 38 LEU 38 45 45 LEU LEU A . n A 1 39 LYS 39 46 46 LYS LYS A . n A 1 40 ILE 40 47 47 ILE ILE A . n A 1 41 LYS 41 48 48 LYS LYS A . n A 1 42 GLY 42 49 49 GLY GLY A . n A 1 43 GLU 43 50 50 GLU GLU A . n A 1 44 TRP 44 51 51 TRP TRP A . n A 1 45 GLN 45 52 52 GLN GLN A . n A 1 46 SER 46 53 53 SER SER A . n A 1 47 ILE 47 54 54 ILE ILE A . n A 1 48 GLU 48 55 55 GLU GLU A . n A 1 49 LEU 49 56 56 LEU LEU A . n A 1 50 GLU 50 57 57 GLU GLU A . n A 1 51 ASN 51 58 58 ASN ASN A . n A 1 52 TRP 52 59 59 TRP TRP A . n A 1 53 ARG 53 60 60 ARG ARG A . n A 1 54 TYR 54 61 61 TYR TYR A . n A 1 55 HIS 55 62 62 HIS HIS A . n A 1 56 ASN 56 63 63 ASN ASN A . n A 1 57 HIS 57 64 64 HIS HIS A . n A 1 58 GLU 58 65 65 GLU GLU A . n A 1 59 ILE 59 66 66 ILE ILE A . n A 1 60 ILE 60 67 67 ILE ILE A . n A 1 61 VAL 61 68 68 VAL VAL A . n A 1 62 LYS 62 69 69 LYS LYS A . n A 1 63 LEU 63 70 70 LEU LEU A . n A 1 64 LYS 64 71 71 LYS LYS A . n A 1 65 GLY 65 72 72 GLY GLY A . n A 1 66 VAL 66 73 73 VAL VAL A . n A 1 67 ASP 67 74 74 ASP ASP A . n A 1 68 ASP 68 75 75 ASP ASP A . n A 1 69 ARG 69 76 76 ARG ARG A . n A 1 70 GLU 70 77 77 GLU GLU A . n A 1 71 ALA 71 78 78 ALA ALA A . n A 1 72 ALA 72 79 79 ALA ALA A . n A 1 73 GLN 73 80 80 GLN GLN A . n A 1 74 ILE 74 81 81 ILE ILE A . n A 1 75 LEU 75 82 82 LEU LEU A . n A 1 76 ALA 76 83 83 ALA ALA A . n A 1 77 ASN 77 84 84 ASN ASN A . n A 1 78 VAL 78 85 85 VAL VAL A . n A 1 79 GLU 79 86 86 GLU GLU A . n A 1 80 ILE 80 87 87 ILE ILE A . n A 1 81 GLY 81 88 88 GLY GLY A . n A 1 82 VAL 82 89 89 VAL VAL A . n A 1 83 ASP 83 90 90 ASP ASP A . n A 1 84 LEU 84 91 91 LEU LEU A . n A 1 85 SER 85 92 92 SER SER A . n A 1 86 VAL 86 93 93 VAL VAL A . n A 1 87 PHE 87 94 94 PHE PHE A . n A 1 88 PRO 88 95 95 PRO PRO A . n A 1 89 GLU 89 96 96 GLU GLU A . n A 1 90 LEU 90 97 97 LEU LEU A . n A 1 91 GLU 91 98 98 GLU GLU A . n A 1 92 GLU 92 99 99 GLU GLU A . n A 1 93 GLY 93 100 100 GLY GLY A . n A 1 94 ASP 94 101 101 ASP ASP A . n A 1 95 TYR 95 102 102 TYR TYR A . n A 1 96 TYR 96 103 103 TYR TYR A . n A 1 97 TRP 97 104 104 TRP TRP A . n A 1 98 HIS 98 105 105 HIS HIS A . n A 1 99 ASP 99 106 106 ASP ASP A . n A 1 100 LEU 100 107 107 LEU LEU A . n A 1 101 ILE 101 108 108 ILE ILE A . n A 1 102 GLY 102 109 109 GLY GLY A . n A 1 103 CYS 103 110 110 CYS CYS A . n A 1 104 THR 104 111 111 THR THR A . n A 1 105 VAL 105 112 112 VAL VAL A . n A 1 106 VAL 106 113 113 VAL VAL A . n A 1 107 ASN 107 114 114 ASN ASN A . n A 1 108 LEU 108 115 115 LEU LEU A . n A 1 109 GLU 109 116 116 GLU GLU A . n A 1 110 GLY 110 117 117 GLY GLY A . n A 1 111 TYR 111 118 118 TYR TYR A . n A 1 112 THR 112 119 119 THR THR A . n A 1 113 MSE 113 120 120 MSE MSE A . n A 1 114 GLY 114 121 121 GLY GLY A . n A 1 115 THR 115 122 122 THR THR A . n A 1 116 VAL 116 123 123 VAL VAL A . n A 1 117 THR 117 124 124 THR THR A . n A 1 118 GLU 118 125 125 GLU GLU A . n A 1 119 MSE 119 126 126 MSE MSE A . n A 1 120 MSE 120 127 127 MSE MSE A . n A 1 121 GLU 121 128 128 GLU GLU A . n A 1 122 THR 122 129 129 THR THR A . n A 1 123 GLY 123 130 130 GLY GLY A . n A 1 124 SER 124 131 131 SER SER A . n A 1 125 ASN 125 132 132 ASN ASN A . n A 1 126 ASP 126 133 133 ASP ASP A . n A 1 127 VAL 127 134 134 VAL VAL A . n A 1 128 LEU 128 135 135 LEU LEU A . n A 1 129 VAL 129 136 136 VAL VAL A . n A 1 130 VAL 130 137 137 VAL VAL A . n A 1 131 LYS 131 138 138 LYS LYS A . n A 1 132 ALA 132 139 139 ALA ALA A . n A 1 133 ASN 133 140 140 ASN ASN A . n A 1 134 THR 134 141 141 THR THR A . n A 1 135 LYS 135 142 142 LYS LYS A . n A 1 136 ASP 136 143 143 ASP ASP A . n A 1 137 ALA 137 144 144 ALA ALA A . n A 1 138 PHE 138 145 145 PHE PHE A . n A 1 139 GLY 139 146 146 GLY GLY A . n A 1 140 LYS 140 147 147 LYS LYS A . n A 1 141 GLN 141 148 148 GLN GLN A . n A 1 142 GLU 142 149 149 GLU GLU A . n A 1 143 ARG 143 150 150 ARG ARG A . n A 1 144 LEU 144 151 151 LEU LEU A . n A 1 145 ILE 145 152 152 ILE ILE A . n A 1 146 PRO 146 153 153 PRO PRO A . n A 1 147 PHE 147 154 154 PHE PHE A . n A 1 148 LEU 148 155 155 LEU LEU A . n A 1 149 TYR 149 156 156 TYR TYR A . n A 1 150 GLU 150 157 157 GLU GLU A . n A 1 151 GLN 151 158 158 GLN GLN A . n A 1 152 VAL 152 159 159 VAL VAL A . n A 1 153 VAL 153 160 160 VAL VAL A . n A 1 154 LYS 154 161 161 LYS LYS A . n A 1 155 ARG 155 162 162 ARG ARG A . n A 1 156 VAL 156 163 163 VAL VAL A . n A 1 157 ASP 157 164 164 ASP ASP A . n A 1 158 LEU 158 165 165 LEU LEU A . n A 1 159 THR 159 166 166 THR THR A . n A 1 160 THR 160 167 167 THR THR A . n A 1 161 LYS 161 168 168 LYS LYS A . n A 1 162 THR 162 169 169 THR THR A . n A 1 163 ILE 163 170 170 ILE ILE A . n A 1 164 GLU 164 171 171 GLU GLU A . n A 1 165 VAL 165 172 172 VAL VAL A . n A 1 166 ASP 166 173 173 ASP ASP A . n A 1 167 TRP 167 174 174 TRP TRP A . n A 1 168 ASP 168 175 175 ASP ASP A . n A 1 169 ALA 169 176 176 ALA ALA A . n A 1 170 GLY 170 177 177 GLY GLY A . n A 1 171 PHE 171 178 178 PHE PHE A . n A 1 172 LEU 172 179 179 LEU LEU A . n A 1 173 GLU 173 180 180 GLU GLU A . n A 1 174 HIS 174 181 181 HIS HIS A . n A 1 175 HIS 175 182 182 HIS HIS A . n A 1 176 HIS 176 183 183 HIS HIS A . n A 1 177 HIS 177 184 184 HIS HIS A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 113 A MSE 120 ? MET SELENOMETHIONINE 2 A MSE 119 A MSE 126 ? MET SELENOMETHIONINE 3 A MSE 120 A MSE 127 ? MET SELENOMETHIONINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA trimeric 3 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F 2 1,2,3 A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 12510 ? 2 MORE -176 ? 2 'SSA (A^2)' 23880 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 z+1/2,-x+1/2,-y 0.0000000000 0.0000000000 1.0000000000 64.8210000000 -1.0000000000 0.0000000000 0.0000000000 64.8210000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 12_554 -y+1/2,-z,x-1/2 0.0000000000 -1.0000000000 0.0000000000 64.8210000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -64.8210000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-05-19 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal REFMAC . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran_77 ? 1 PDB_EXTRACT 3.00 'March. 27, 2007' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 2 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 32 ? ? -30.05 -37.69 2 1 ALA A 34 ? ? 170.63 -83.52 3 1 ASN A 63 ? ? 62.60 75.96 4 1 LYS A 142 ? ? 49.98 71.10 5 1 ALA A 144 ? ? -36.66 -34.84 6 1 GLU A 157 ? ? 90.03 -59.53 7 1 VAL A 159 ? ? -122.16 -61.04 8 1 LYS A 168 ? ? 36.30 59.13 9 1 ASP A 173 ? ? -105.08 77.27 10 1 HIS A 183 ? ? 19.74 -93.57 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 1 1 SO4 SO4 A . C 2 SO4 1 2 2 SO4 SO4 A . D 2 SO4 1 3 3 SO4 SO4 A . E 2 SO4 1 4 4 SO4 SO4 A . F 3 HOH 1 185 1 HOH WAT A . F 3 HOH 2 186 2 HOH WAT A . #