data_3HDP # _entry.id 3HDP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.338 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3HDP RCSB RCSB053006 WWPDB D_1000053006 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2QH0 'Crystal structure of a glyoxalase from Clostridium acetobutylicum [Zn(II) bound].' unspecified TargetDB NYSGXRC-11003p . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3HDP _pdbx_database_status.recvd_initial_deposition_date 2009-05-07 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Satyanarayana, L.' 1 ? 'Eswaramoorthy, S.' 2 ? 'Burley, S.K.' 3 0000-0002-2487-9713 'Swaminathan, S.' 4 ? 'New York SGX Research Center for Structural Genomics (NYSGXRC)' 5 ? # _citation.id primary _citation.title 'Crystal structure of the NI(II)-bound Glyoxalase-I from Clostridium acetobutylicum.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Satyanarayana, L.' 1 ? primary 'Eswaramoorthy, S.' 2 ? primary 'Honek, J.' 3 ? primary 'Burley, S.K.' 4 0000-0002-2487-9713 primary 'Swaminathan, S.' 5 ? # _cell.entry_id 3HDP _cell.length_a 70.269 _cell.length_b 70.269 _cell.length_c 66.589 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3HDP _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Glyoxalase-I 15113.386 1 4.4.1.5 ? ? ? 2 non-polymer syn 'NICKEL (II) ION' 58.693 1 ? ? ? ? 3 water nat water 18.015 78 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Lactoylglutathione lyase, YQJC B.subtilis ortholog' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMSLKVHHIGYAVKNIDSALKKFKRLGYVEESEVVRDEVRKVYIQFVINGGYRVELVAPDGEDSPINKTIKKGSTPYH ICYEVEDIQKSIEEMSQIGYTLFKKAEIAPAIDNRKVAFLFSTDIGLIELLEK ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMSLKVHHIGYAVKNIDSALKKFKRLGYVEESEVVRDEVRKVYIQFVINGGYRVELVAPDGEDSPINKTIKKGSTPYH ICYEVEDIQKSIEEMSQIGYTLFKKAEIAPAIDNRKVAFLFSTDIGLIELLEK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGXRC-11003p # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 SER n 1 6 LEU n 1 7 LYS n 1 8 VAL n 1 9 HIS n 1 10 HIS n 1 11 ILE n 1 12 GLY n 1 13 TYR n 1 14 ALA n 1 15 VAL n 1 16 LYS n 1 17 ASN n 1 18 ILE n 1 19 ASP n 1 20 SER n 1 21 ALA n 1 22 LEU n 1 23 LYS n 1 24 LYS n 1 25 PHE n 1 26 LYS n 1 27 ARG n 1 28 LEU n 1 29 GLY n 1 30 TYR n 1 31 VAL n 1 32 GLU n 1 33 GLU n 1 34 SER n 1 35 GLU n 1 36 VAL n 1 37 VAL n 1 38 ARG n 1 39 ASP n 1 40 GLU n 1 41 VAL n 1 42 ARG n 1 43 LYS n 1 44 VAL n 1 45 TYR n 1 46 ILE n 1 47 GLN n 1 48 PHE n 1 49 VAL n 1 50 ILE n 1 51 ASN n 1 52 GLY n 1 53 GLY n 1 54 TYR n 1 55 ARG n 1 56 VAL n 1 57 GLU n 1 58 LEU n 1 59 VAL n 1 60 ALA n 1 61 PRO n 1 62 ASP n 1 63 GLY n 1 64 GLU n 1 65 ASP n 1 66 SER n 1 67 PRO n 1 68 ILE n 1 69 ASN n 1 70 LYS n 1 71 THR n 1 72 ILE n 1 73 LYS n 1 74 LYS n 1 75 GLY n 1 76 SER n 1 77 THR n 1 78 PRO n 1 79 TYR n 1 80 HIS n 1 81 ILE n 1 82 CYS n 1 83 TYR n 1 84 GLU n 1 85 VAL n 1 86 GLU n 1 87 ASP n 1 88 ILE n 1 89 GLN n 1 90 LYS n 1 91 SER n 1 92 ILE n 1 93 GLU n 1 94 GLU n 1 95 MET n 1 96 SER n 1 97 GLN n 1 98 ILE n 1 99 GLY n 1 100 TYR n 1 101 THR n 1 102 LEU n 1 103 PHE n 1 104 LYS n 1 105 LYS n 1 106 ALA n 1 107 GLU n 1 108 ILE n 1 109 ALA n 1 110 PRO n 1 111 ALA n 1 112 ILE n 1 113 ASP n 1 114 ASN n 1 115 ARG n 1 116 LYS n 1 117 VAL n 1 118 ALA n 1 119 PHE n 1 120 LEU n 1 121 PHE n 1 122 SER n 1 123 THR n 1 124 ASP n 1 125 ILE n 1 126 GLY n 1 127 LEU n 1 128 ILE n 1 129 GLU n 1 130 LEU n 1 131 LEU n 1 132 GLU n 1 133 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CAC2192, CA_C2192' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Clostridium acetobutylicum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1488 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-28 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q97H22_CLOAB _struct_ref.pdbx_db_accession Q97H22 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKVHHIGYAVKNIDSALKKFKRLGYVEESEVVRDEVRKVYIQFVINGGYRVELVAPDGEDSPINKTIKKGSTPYHICYEV EDIQKSIEEMSQIGYTLFKKAEIAPAIDNRKVAFLFSTDIGLIELLEK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3HDP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 133 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q97H22 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 128 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -3 _struct_ref_seq.pdbx_auth_seq_align_end 128 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3HDP SER A 5 ? UNP Q97H22 ? ? 'expression tag' -2 1 1 3HDP LEU A 6 ? UNP Q97H22 ? ? 'expression tag' -1 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NI non-polymer . 'NICKEL (II) ION' ? 'Ni 2' 58.693 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3HDP _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.77 _exptl_crystal.density_percent_sol 55.61 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '15% PEG 3350,7.5pH Hepes buffer (0.1M)and 5% Isopropanol., VAPOR DIFFUSION, SITTING DROP, temperature 293K' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2009-04-23 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X25' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X25 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9792 # _reflns.entry_id 3HDP _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.06 _reflns.number_obs 9650 _reflns.number_all 9650 _reflns.percent_possible_obs 88.3 _reflns.pdbx_Rmerge_I_obs 0.050 _reflns.pdbx_Rsym_value 0.050 _reflns.pdbx_netI_over_sigmaI 31.6 _reflns.B_iso_Wilson_estimate 15.9 _reflns.pdbx_redundancy 25.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.06 _reflns_shell.d_res_low 2.13 _reflns_shell.percent_possible_all 99.0 _reflns_shell.Rmerge_I_obs 0.172 _reflns_shell.pdbx_Rsym_value 0.172 _reflns_shell.meanI_over_sigI_obs 10.0 _reflns_shell.pdbx_redundancy 25.3 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 3HDP _refine.ls_number_reflns_obs 8993 _refine.ls_number_reflns_all 8993 _refine.pdbx_ls_sigma_I 0.0 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 24.17 _refine.ls_d_res_high 2.06 _refine.ls_percent_reflns_obs 88.1 _refine.ls_R_factor_obs 0.256 _refine.ls_R_factor_all 0.267 _refine.ls_R_factor_R_work 0.252 _refine.ls_R_factor_R_free 0.286 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 383 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 36.2 _refine.aniso_B[1][1] -9.02 _refine.aniso_B[2][2] -9.02 _refine.aniso_B[3][3] 18.04 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 2QH0' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model Isotropic _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.entry_id 3HDP _refine_analyze.Luzzati_coordinate_error_obs 0.30 _refine_analyze.Luzzati_sigma_a_obs 0.23 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.33 _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1060 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 78 _refine_hist.number_atoms_total 1139 _refine_hist.d_res_high 2.06 _refine_hist.d_res_low 24.17 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.2 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 24.9 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.d_res_high 2.06 _refine_ls_shell.d_res_low 2.19 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.R_factor_R_work 0.27 _refine_ls_shell.percent_reflns_obs 88.1 _refine_ls_shell.R_factor_R_free 0.299 _refine_ls_shell.R_factor_R_free_error 0.033 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 65 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 3HDP _struct.title 'Crystal structure of the NI(II)-bound Glyoxalase-I from Clostridium acetobutylicum' _struct.pdbx_descriptor 'Glyoxalase-I (E.C.4.4.1.5)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3HDP _struct_keywords.pdbx_keywords LYASE _struct_keywords.text ;Glutathione, Lyase, Glyoxalase, methylglyoxal, 11003p, PSI2, Structural genomic, NYSGXRC., Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 17 ? LEU A 28 ? ASN A 12 LEU A 23 1 ? 12 HELX_P HELX_P2 2 PRO A 67 ? ILE A 72 ? PRO A 62 ILE A 67 1 ? 6 HELX_P HELX_P3 3 ASP A 87 ? SER A 96 ? ASP A 82 SER A 91 1 ? 10 HELX_P HELX_P4 4 PRO A 110 ? ASP A 113 ? PRO A 105 ASP A 108 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 10 NE2 ? ? ? 1_555 B NI . NI ? ? A HIS 5 A NI 129 1_555 ? ? ? ? ? ? ? 2.278 ? ? metalc2 metalc ? ? A GLU 57 OE1 ? ? ? 1_555 B NI . NI ? ? A GLU 52 A NI 129 1_555 ? ? ? ? ? ? ? 2.052 ? ? metalc3 metalc ? ? A HIS 80 NE2 ? ? ? 1_555 B NI . NI ? ? A HIS 75 A NI 129 1_555 ? ? ? ? ? ? ? 2.281 ? ? metalc4 metalc ? ? A GLU 129 OE2 ? ? ? 1_555 B NI . NI ? ? A GLU 124 A NI 129 1_555 ? ? ? ? ? ? ? 2.055 ? ? metalc5 metalc ? ? B NI . NI ? ? ? 1_555 C HOH . O ? ? A NI 129 A HOH 130 1_555 ? ? ? ? ? ? ? 2.516 ? ? metalc6 metalc ? ? B NI . NI ? ? ? 1_555 C HOH . O ? ? A NI 129 A HOH 133 1_555 ? ? ? ? ? ? ? 2.320 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 8 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? parallel B 4 5 ? anti-parallel B 5 6 ? parallel B 6 7 ? anti-parallel B 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 31 ? GLU A 32 ? VAL A 26 GLU A 27 A 2 VAL A 44 ? ASN A 51 ? VAL A 39 ASN A 46 A 3 VAL A 37 ? ASP A 39 ? VAL A 32 ASP A 34 B 1 VAL A 31 ? GLU A 32 ? VAL A 26 GLU A 27 B 2 VAL A 44 ? ASN A 51 ? VAL A 39 ASN A 46 B 3 TYR A 54 ? PRO A 61 ? TYR A 49 PRO A 56 B 4 VAL A 8 ? ALA A 14 ? VAL A 3 ALA A 9 B 5 THR A 77 ? VAL A 85 ? THR A 72 VAL A 80 B 6 GLY A 126 ? GLU A 132 ? GLY A 121 GLU A 127 B 7 LYS A 116 ? SER A 122 ? LYS A 111 SER A 117 B 8 TYR A 100 ? ILE A 108 ? TYR A 95 ILE A 103 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 31 ? N VAL A 26 O ILE A 50 ? O ILE A 45 A 2 3 O ILE A 46 ? O ILE A 41 N VAL A 37 ? N VAL A 32 B 1 2 N VAL A 31 ? N VAL A 26 O ILE A 50 ? O ILE A 45 B 2 3 N VAL A 49 ? N VAL A 44 O VAL A 56 ? O VAL A 51 B 3 4 O GLU A 57 ? O GLU A 52 N TYR A 13 ? N TYR A 8 B 4 5 N GLY A 12 ? N GLY A 7 O HIS A 80 ? O HIS A 75 B 5 6 N TYR A 83 ? N TYR A 78 O GLU A 129 ? O GLU A 124 B 6 7 O GLY A 126 ? O GLY A 121 N SER A 122 ? N SER A 117 B 7 8 O PHE A 121 ? O PHE A 116 N THR A 101 ? N THR A 96 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NI _struct_site.pdbx_auth_seq_id 129 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'BINDING SITE FOR RESIDUE NI A 129' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HIS A 10 ? HIS A 5 . ? 1_555 ? 2 AC1 6 GLU A 57 ? GLU A 52 . ? 1_555 ? 3 AC1 6 HIS A 80 ? HIS A 75 . ? 1_555 ? 4 AC1 6 GLU A 129 ? GLU A 124 . ? 1_555 ? 5 AC1 6 HOH C . ? HOH A 130 . ? 1_555 ? 6 AC1 6 HOH C . ? HOH A 133 . ? 1_555 ? # _database_PDB_matrix.entry_id 3HDP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3HDP _atom_sites.fract_transf_matrix[1][1] 0.014231 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014231 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015017 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N NI O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -6 ? ? ? A . n A 1 2 SER 2 -5 -5 SER SER A . n A 1 3 HIS 3 -4 -4 HIS HIS A . n A 1 4 MET 4 -3 -3 MET MET A . n A 1 5 SER 5 -2 -2 SER SER A . n A 1 6 LEU 6 -1 -1 LEU LEU A . n A 1 7 LYS 7 2 2 LYS LYS A . n A 1 8 VAL 8 3 3 VAL VAL A . n A 1 9 HIS 9 4 4 HIS HIS A . n A 1 10 HIS 10 5 5 HIS HIS A . n A 1 11 ILE 11 6 6 ILE ILE A . n A 1 12 GLY 12 7 7 GLY GLY A . n A 1 13 TYR 13 8 8 TYR TYR A . n A 1 14 ALA 14 9 9 ALA ALA A . n A 1 15 VAL 15 10 10 VAL VAL A . n A 1 16 LYS 16 11 11 LYS LYS A . n A 1 17 ASN 17 12 12 ASN ASN A . n A 1 18 ILE 18 13 13 ILE ILE A . n A 1 19 ASP 19 14 14 ASP ASP A . n A 1 20 SER 20 15 15 SER SER A . n A 1 21 ALA 21 16 16 ALA ALA A . n A 1 22 LEU 22 17 17 LEU LEU A . n A 1 23 LYS 23 18 18 LYS LYS A . n A 1 24 LYS 24 19 19 LYS LYS A . n A 1 25 PHE 25 20 20 PHE PHE A . n A 1 26 LYS 26 21 21 LYS LYS A . n A 1 27 ARG 27 22 22 ARG ARG A . n A 1 28 LEU 28 23 23 LEU LEU A . n A 1 29 GLY 29 24 24 GLY GLY A . n A 1 30 TYR 30 25 25 TYR TYR A . n A 1 31 VAL 31 26 26 VAL VAL A . n A 1 32 GLU 32 27 27 GLU GLU A . n A 1 33 GLU 33 28 28 GLU GLU A . n A 1 34 SER 34 29 29 SER SER A . n A 1 35 GLU 35 30 30 GLU GLU A . n A 1 36 VAL 36 31 31 VAL VAL A . n A 1 37 VAL 37 32 32 VAL VAL A . n A 1 38 ARG 38 33 33 ARG ARG A . n A 1 39 ASP 39 34 34 ASP ASP A . n A 1 40 GLU 40 35 35 GLU GLU A . n A 1 41 VAL 41 36 36 VAL VAL A . n A 1 42 ARG 42 37 37 ARG ARG A . n A 1 43 LYS 43 38 38 LYS LYS A . n A 1 44 VAL 44 39 39 VAL VAL A . n A 1 45 TYR 45 40 40 TYR TYR A . n A 1 46 ILE 46 41 41 ILE ILE A . n A 1 47 GLN 47 42 42 GLN GLN A . n A 1 48 PHE 48 43 43 PHE PHE A . n A 1 49 VAL 49 44 44 VAL VAL A . n A 1 50 ILE 50 45 45 ILE ILE A . n A 1 51 ASN 51 46 46 ASN ASN A . n A 1 52 GLY 52 47 47 GLY GLY A . n A 1 53 GLY 53 48 48 GLY GLY A . n A 1 54 TYR 54 49 49 TYR TYR A . n A 1 55 ARG 55 50 50 ARG ARG A . n A 1 56 VAL 56 51 51 VAL VAL A . n A 1 57 GLU 57 52 52 GLU GLU A . n A 1 58 LEU 58 53 53 LEU LEU A . n A 1 59 VAL 59 54 54 VAL VAL A . n A 1 60 ALA 60 55 55 ALA ALA A . n A 1 61 PRO 61 56 56 PRO PRO A . n A 1 62 ASP 62 57 57 ASP ASP A . n A 1 63 GLY 63 58 58 GLY GLY A . n A 1 64 GLU 64 59 59 GLU GLU A . n A 1 65 ASP 65 60 60 ASP ASP A . n A 1 66 SER 66 61 61 SER SER A . n A 1 67 PRO 67 62 62 PRO PRO A . n A 1 68 ILE 68 63 63 ILE ILE A . n A 1 69 ASN 69 64 64 ASN ASN A . n A 1 70 LYS 70 65 65 LYS LYS A . n A 1 71 THR 71 66 66 THR THR A . n A 1 72 ILE 72 67 67 ILE ILE A . n A 1 73 LYS 73 68 68 LYS LYS A . n A 1 74 LYS 74 69 69 LYS LYS A . n A 1 75 GLY 75 70 70 GLY GLY A . n A 1 76 SER 76 71 71 SER SER A . n A 1 77 THR 77 72 72 THR THR A . n A 1 78 PRO 78 73 73 PRO PRO A . n A 1 79 TYR 79 74 74 TYR TYR A . n A 1 80 HIS 80 75 75 HIS HIS A . n A 1 81 ILE 81 76 76 ILE ILE A . n A 1 82 CYS 82 77 77 CYS CYS A . n A 1 83 TYR 83 78 78 TYR TYR A . n A 1 84 GLU 84 79 79 GLU GLU A . n A 1 85 VAL 85 80 80 VAL VAL A . n A 1 86 GLU 86 81 81 GLU GLU A . n A 1 87 ASP 87 82 82 ASP ASP A . n A 1 88 ILE 88 83 83 ILE ILE A . n A 1 89 GLN 89 84 84 GLN GLN A . n A 1 90 LYS 90 85 85 LYS LYS A . n A 1 91 SER 91 86 86 SER SER A . n A 1 92 ILE 92 87 87 ILE ILE A . n A 1 93 GLU 93 88 88 GLU GLU A . n A 1 94 GLU 94 89 89 GLU GLU A . n A 1 95 MET 95 90 90 MET MET A . n A 1 96 SER 96 91 91 SER SER A . n A 1 97 GLN 97 92 92 GLN GLN A . n A 1 98 ILE 98 93 93 ILE ILE A . n A 1 99 GLY 99 94 94 GLY GLY A . n A 1 100 TYR 100 95 95 TYR TYR A . n A 1 101 THR 101 96 96 THR THR A . n A 1 102 LEU 102 97 97 LEU LEU A . n A 1 103 PHE 103 98 98 PHE PHE A . n A 1 104 LYS 104 99 99 LYS LYS A . n A 1 105 LYS 105 100 100 LYS LYS A . n A 1 106 ALA 106 101 101 ALA ALA A . n A 1 107 GLU 107 102 102 GLU GLU A . n A 1 108 ILE 108 103 103 ILE ILE A . n A 1 109 ALA 109 104 104 ALA ALA A . n A 1 110 PRO 110 105 105 PRO PRO A . n A 1 111 ALA 111 106 106 ALA ALA A . n A 1 112 ILE 112 107 107 ILE ILE A . n A 1 113 ASP 113 108 108 ASP ASP A . n A 1 114 ASN 114 109 109 ASN ASN A . n A 1 115 ARG 115 110 110 ARG ARG A . n A 1 116 LYS 116 111 111 LYS LYS A . n A 1 117 VAL 117 112 112 VAL VAL A . n A 1 118 ALA 118 113 113 ALA ALA A . n A 1 119 PHE 119 114 114 PHE PHE A . n A 1 120 LEU 120 115 115 LEU LEU A . n A 1 121 PHE 121 116 116 PHE PHE A . n A 1 122 SER 122 117 117 SER SER A . n A 1 123 THR 123 118 118 THR THR A . n A 1 124 ASP 124 119 119 ASP ASP A . n A 1 125 ILE 125 120 120 ILE ILE A . n A 1 126 GLY 126 121 121 GLY GLY A . n A 1 127 LEU 127 122 122 LEU LEU A . n A 1 128 ILE 128 123 123 ILE ILE A . n A 1 129 GLU 129 124 124 GLU GLU A . n A 1 130 LEU 130 125 125 LEU LEU A . n A 1 131 LEU 131 126 126 LEU LEU A . n A 1 132 GLU 132 127 127 GLU GLU A . n A 1 133 LYS 133 128 128 LYS LYS A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'New York SGX Research Center for Structural Genomics' _pdbx_SG_project.initial_of_center NYSGXRC # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NI 1 129 129 NI NI A . C 3 HOH 1 1 1 HOH HOH A . C 3 HOH 2 130 130 HOH HOH A . C 3 HOH 3 132 132 HOH HOH A . C 3 HOH 4 133 133 HOH HOH A . C 3 HOH 5 134 134 HOH HOH A . C 3 HOH 6 135 135 HOH HOH A . C 3 HOH 7 137 137 HOH HOH A . C 3 HOH 8 138 138 HOH HOH A . C 3 HOH 9 139 139 HOH HOH A . C 3 HOH 10 140 140 HOH HOH A . C 3 HOH 11 141 141 HOH HOH A . C 3 HOH 12 143 143 HOH HOH A . C 3 HOH 13 144 144 HOH HOH A . C 3 HOH 14 145 145 HOH HOH A . C 3 HOH 15 146 146 HOH HOH A . C 3 HOH 16 147 147 HOH HOH A . C 3 HOH 17 149 149 HOH HOH A . C 3 HOH 18 150 150 HOH HOH A . C 3 HOH 19 151 151 HOH HOH A . C 3 HOH 20 152 152 HOH HOH A . C 3 HOH 21 153 153 HOH HOH A . C 3 HOH 22 154 154 HOH HOH A . C 3 HOH 23 155 155 HOH HOH A . C 3 HOH 24 156 156 HOH HOH A . C 3 HOH 25 157 157 HOH HOH A . C 3 HOH 26 158 158 HOH HOH A . C 3 HOH 27 159 159 HOH HOH A . C 3 HOH 28 160 160 HOH HOH A . C 3 HOH 29 161 161 HOH HOH A . C 3 HOH 30 162 162 HOH HOH A . C 3 HOH 31 163 163 HOH HOH A . C 3 HOH 32 164 164 HOH HOH A . C 3 HOH 33 165 165 HOH HOH A . C 3 HOH 34 166 166 HOH HOH A . C 3 HOH 35 167 167 HOH HOH A . C 3 HOH 36 168 168 HOH HOH A . C 3 HOH 37 169 169 HOH HOH A . C 3 HOH 38 170 170 HOH HOH A . C 3 HOH 39 171 171 HOH HOH A . C 3 HOH 40 172 172 HOH HOH A . C 3 HOH 41 173 173 HOH HOH A . C 3 HOH 42 174 174 HOH HOH A . C 3 HOH 43 175 175 HOH HOH A . C 3 HOH 44 176 176 HOH HOH A . C 3 HOH 45 177 177 HOH HOH A . C 3 HOH 46 178 178 HOH HOH A . C 3 HOH 47 179 179 HOH HOH A . C 3 HOH 48 180 180 HOH HOH A . C 3 HOH 49 181 181 HOH HOH A . C 3 HOH 50 182 182 HOH HOH A . C 3 HOH 51 183 183 HOH HOH A . C 3 HOH 52 184 184 HOH HOH A . C 3 HOH 53 185 185 HOH HOH A . C 3 HOH 54 186 186 HOH HOH A . C 3 HOH 55 187 187 HOH HOH A . C 3 HOH 56 188 188 HOH HOH A . C 3 HOH 57 190 190 HOH HOH A . C 3 HOH 58 191 191 HOH HOH A . C 3 HOH 59 194 194 HOH HOH A . C 3 HOH 60 195 195 HOH HOH A . C 3 HOH 61 196 196 HOH HOH A . C 3 HOH 62 197 197 HOH HOH A . C 3 HOH 63 198 198 HOH HOH A . C 3 HOH 64 199 199 HOH HOH A . C 3 HOH 65 200 200 HOH HOH A . C 3 HOH 66 201 201 HOH HOH A . C 3 HOH 67 202 202 HOH HOH A . C 3 HOH 68 203 203 HOH HOH A . C 3 HOH 69 204 204 HOH HOH A . C 3 HOH 70 205 205 HOH HOH A . C 3 HOH 71 206 206 HOH HOH A . C 3 HOH 72 207 207 HOH HOH A . C 3 HOH 73 208 208 HOH HOH A . C 3 HOH 74 209 209 HOH HOH A . C 3 HOH 75 210 210 HOH HOH A . C 3 HOH 76 211 211 HOH HOH A . C 3 HOH 77 212 212 HOH HOH A . C 3 HOH 78 213 213 HOH HOH A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C 2 1,2 A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 3760 ? 2 MORE -37 ? 2 'SSA (A^2)' 13140 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 10 ? A HIS 5 ? 1_555 NI ? B NI . ? A NI 129 ? 1_555 OE1 ? A GLU 57 ? A GLU 52 ? 1_555 80.3 ? 2 NE2 ? A HIS 10 ? A HIS 5 ? 1_555 NI ? B NI . ? A NI 129 ? 1_555 NE2 ? A HIS 80 ? A HIS 75 ? 1_555 103.1 ? 3 OE1 ? A GLU 57 ? A GLU 52 ? 1_555 NI ? B NI . ? A NI 129 ? 1_555 NE2 ? A HIS 80 ? A HIS 75 ? 1_555 102.4 ? 4 NE2 ? A HIS 10 ? A HIS 5 ? 1_555 NI ? B NI . ? A NI 129 ? 1_555 OE2 ? A GLU 129 ? A GLU 124 ? 1_555 96.1 ? 5 OE1 ? A GLU 57 ? A GLU 52 ? 1_555 NI ? B NI . ? A NI 129 ? 1_555 OE2 ? A GLU 129 ? A GLU 124 ? 1_555 172.2 ? 6 NE2 ? A HIS 80 ? A HIS 75 ? 1_555 NI ? B NI . ? A NI 129 ? 1_555 OE2 ? A GLU 129 ? A GLU 124 ? 1_555 85.1 ? 7 NE2 ? A HIS 10 ? A HIS 5 ? 1_555 NI ? B NI . ? A NI 129 ? 1_555 O ? C HOH . ? A HOH 130 ? 1_555 88.5 ? 8 OE1 ? A GLU 57 ? A GLU 52 ? 1_555 NI ? B NI . ? A NI 129 ? 1_555 O ? C HOH . ? A HOH 130 ? 1_555 84.0 ? 9 NE2 ? A HIS 80 ? A HIS 75 ? 1_555 NI ? B NI . ? A NI 129 ? 1_555 O ? C HOH . ? A HOH 130 ? 1_555 167.5 ? 10 OE2 ? A GLU 129 ? A GLU 124 ? 1_555 NI ? B NI . ? A NI 129 ? 1_555 O ? C HOH . ? A HOH 130 ? 1_555 89.0 ? 11 NE2 ? A HIS 10 ? A HIS 5 ? 1_555 NI ? B NI . ? A NI 129 ? 1_555 O ? C HOH . ? A HOH 133 ? 1_555 164.3 ? 12 OE1 ? A GLU 57 ? A GLU 52 ? 1_555 NI ? B NI . ? A NI 129 ? 1_555 O ? C HOH . ? A HOH 133 ? 1_555 91.9 ? 13 NE2 ? A HIS 80 ? A HIS 75 ? 1_555 NI ? B NI . ? A NI 129 ? 1_555 O ? C HOH . ? A HOH 133 ? 1_555 91.8 ? 14 OE2 ? A GLU 129 ? A GLU 124 ? 1_555 NI ? B NI . ? A NI 129 ? 1_555 O ? C HOH . ? A HOH 133 ? 1_555 90.0 ? 15 O ? C HOH . ? A HOH 130 ? 1_555 NI ? B NI . ? A NI 129 ? 1_555 O ? C HOH . ? A HOH 133 ? 1_555 77.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-05-26 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-02-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' audit_author 2 3 'Structure model' citation_author 3 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_audit_author.identifier_ORCID' 2 3 'Structure model' '_citation_author.identifier_ORCID' 3 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 4 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 5 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CBASS 'data collection' . ? 1 AMoRE phasing . ? 2 CNS refinement 1.1 ? 3 DENZO 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A -4 ? ? 80.27 -7.60 2 1 THR A 72 ? ? -170.73 149.62 3 1 LYS A 99 ? ? 25.98 90.53 4 1 LYS A 100 ? ? 52.10 -175.74 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id GLY _pdbx_unobs_or_zero_occ_residues.auth_seq_id -6 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id GLY _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'NICKEL (II) ION' NI 3 water HOH #