data_3HFI # _entry.id 3HFI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3HFI RCSB RCSB053071 WWPDB D_1000053071 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id APC88534 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3HFI _pdbx_database_status.recvd_initial_deposition_date 2009-05-11 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, R.' 1 'Xu, X.' 2 'Zheng, H.' 3 'Savchenko, A.' 4 'Edwards, A.' 5 'Joachimiak, A.' 6 'Midwest Center for Structural Genomics (MCSG)' 7 # _citation.id primary _citation.title 'The crystal structure of the putative regulator from Escherichia coli CFT073' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Zhang, R.' 1 primary 'Xu, X.' 2 primary 'Zheng, H.' 3 primary 'Savchenko, A.' 4 primary 'Edwards, A.' 5 primary 'Joachimiak, A.' 6 # _cell.entry_id 3HFI _cell.length_a 103.656 _cell.length_b 103.656 _cell.length_c 58.209 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3HFI _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative regulator' 19661.430 1 ? ? 'residues 82-251' ? 2 water nat water 18.015 40 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;NVAYPLGEGLLSFAESLESQKIHFTTEVITSRIEPANRYVAEKLRITPGQDILYLERLRSIGDEKAMLIENRINIELCPG IVEIDFNQHNLFPTIESLSKRKIRYSESRYAARLIGNERGHFLDISEDAPVLHLEQLVFFSRELPVEFGNVWLKGNKYYL GTVLQRRELS ; _entity_poly.pdbx_seq_one_letter_code_can ;NVAYPLGEGLLSFAESLESQKIHFTTEVITSRIEPANRYVAEKLRITPGQDILYLERLRSIGDEKAMLIENRINIELCPG IVEIDFNQHNLFPTIESLSKRKIRYSESRYAARLIGNERGHFLDISEDAPVLHLEQLVFFSRELPVEFGNVWLKGNKYYL GTVLQRRELS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier APC88534 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 VAL n 1 3 ALA n 1 4 TYR n 1 5 PRO n 1 6 LEU n 1 7 GLY n 1 8 GLU n 1 9 GLY n 1 10 LEU n 1 11 LEU n 1 12 SER n 1 13 PHE n 1 14 ALA n 1 15 GLU n 1 16 SER n 1 17 LEU n 1 18 GLU n 1 19 SER n 1 20 GLN n 1 21 LYS n 1 22 ILE n 1 23 HIS n 1 24 PHE n 1 25 THR n 1 26 THR n 1 27 GLU n 1 28 VAL n 1 29 ILE n 1 30 THR n 1 31 SER n 1 32 ARG n 1 33 ILE n 1 34 GLU n 1 35 PRO n 1 36 ALA n 1 37 ASN n 1 38 ARG n 1 39 TYR n 1 40 VAL n 1 41 ALA n 1 42 GLU n 1 43 LYS n 1 44 LEU n 1 45 ARG n 1 46 ILE n 1 47 THR n 1 48 PRO n 1 49 GLY n 1 50 GLN n 1 51 ASP n 1 52 ILE n 1 53 LEU n 1 54 TYR n 1 55 LEU n 1 56 GLU n 1 57 ARG n 1 58 LEU n 1 59 ARG n 1 60 SER n 1 61 ILE n 1 62 GLY n 1 63 ASP n 1 64 GLU n 1 65 LYS n 1 66 ALA n 1 67 MET n 1 68 LEU n 1 69 ILE n 1 70 GLU n 1 71 ASN n 1 72 ARG n 1 73 ILE n 1 74 ASN n 1 75 ILE n 1 76 GLU n 1 77 LEU n 1 78 CYS n 1 79 PRO n 1 80 GLY n 1 81 ILE n 1 82 VAL n 1 83 GLU n 1 84 ILE n 1 85 ASP n 1 86 PHE n 1 87 ASN n 1 88 GLN n 1 89 HIS n 1 90 ASN n 1 91 LEU n 1 92 PHE n 1 93 PRO n 1 94 THR n 1 95 ILE n 1 96 GLU n 1 97 SER n 1 98 LEU n 1 99 SER n 1 100 LYS n 1 101 ARG n 1 102 LYS n 1 103 ILE n 1 104 ARG n 1 105 TYR n 1 106 SER n 1 107 GLU n 1 108 SER n 1 109 ARG n 1 110 TYR n 1 111 ALA n 1 112 ALA n 1 113 ARG n 1 114 LEU n 1 115 ILE n 1 116 GLY n 1 117 ASN n 1 118 GLU n 1 119 ARG n 1 120 GLY n 1 121 HIS n 1 122 PHE n 1 123 LEU n 1 124 ASP n 1 125 ILE n 1 126 SER n 1 127 GLU n 1 128 ASP n 1 129 ALA n 1 130 PRO n 1 131 VAL n 1 132 LEU n 1 133 HIS n 1 134 LEU n 1 135 GLU n 1 136 GLN n 1 137 LEU n 1 138 VAL n 1 139 PHE n 1 140 PHE n 1 141 SER n 1 142 ARG n 1 143 GLU n 1 144 LEU n 1 145 PRO n 1 146 VAL n 1 147 GLU n 1 148 PHE n 1 149 GLY n 1 150 ASN n 1 151 VAL n 1 152 TRP n 1 153 LEU n 1 154 LYS n 1 155 GLY n 1 156 ASN n 1 157 LYS n 1 158 TYR n 1 159 TYR n 1 160 LEU n 1 161 GLY n 1 162 THR n 1 163 VAL n 1 164 LEU n 1 165 GLN n 1 166 ARG n 1 167 ARG n 1 168 GLU n 1 169 LEU n 1 170 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'c4276, GI:26250098' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain CFT073 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli O6' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 217992 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMCSG7 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8FCM7_ECOL6 _struct_ref.pdbx_db_accession Q8FCM7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NVAYPLGEGLLSFAESLESQKIHFTTEVITSRIEPANRYVAEKLRITPGQDILYLERLRSIGDEKAMLIENRINIELCPG IVEIDFNQHNLFPTIESLSKRKIRYSESRYAARLIGNERGHFLDISEDAPVLHLEQLVFFSRELPVEFGNVWLKGNKYYL GTVLQRRELS ; _struct_ref.pdbx_align_begin 82 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3HFI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 170 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8FCM7 _struct_ref_seq.db_align_beg 82 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 251 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 170 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3HFI _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.30 _exptl_crystal.density_percent_sol 46.42 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.1M Na(OAC), 3.5M NaFormate, 1/600 CHYMOTRYPSIN, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 289K' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2008-08-08 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 channel' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9794 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9794 # _reflns.entry_id 3HFI _reflns.observed_criterion_sigma_I 2 _reflns.observed_criterion_sigma_F 2 _reflns.d_resolution_low 89.80 _reflns.d_resolution_high 2.2 _reflns.number_obs 9325 _reflns.number_all 9339 _reflns.percent_possible_obs 99.85 _reflns.pdbx_Rmerge_I_obs 0.096 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 51.9 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 27.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.2 _reflns_shell.d_res_low 2.257 _reflns_shell.percent_possible_all 99.30 _reflns_shell.Rmerge_I_obs 0.734 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.4 _reflns_shell.pdbx_redundancy 26.6 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 3HFI _refine.ls_number_reflns_obs 9325 _refine.ls_number_reflns_all 9339 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 89.80 _refine.ls_d_res_high 2.20 _refine.ls_percent_reflns_obs 99.85 _refine.ls_R_factor_obs 0.20335 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.20058 _refine.ls_R_factor_R_free 0.25558 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 471 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.954 _refine.correlation_coeff_Fo_to_Fc_free 0.935 _refine.B_iso_mean 21.470 _refine.aniso_B[1][1] -0.31 _refine.aniso_B[2][2] -0.31 _refine.aniso_B[3][3] 0.47 _refine.aniso_B[1][2] -0.16 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.224 _refine.pdbx_overall_ESU_R_Free 0.202 _refine.overall_SU_ML 0.140 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 12.140 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1106 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 40 _refine_hist.number_atoms_total 1146 _refine_hist.d_res_high 2.20 _refine_hist.d_res_low 89.80 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.021 0.022 ? 1138 'X-RAY DIFFRACTION' ? r_bond_other_d 0.001 0.020 ? 805 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.876 1.974 ? 1537 'X-RAY DIFFRACTION' ? r_angle_other_deg 1.057 3.000 ? 1948 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 8.807 5.000 ? 136 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 37.501 23.276 ? 58 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 18.205 15.000 ? 208 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 19.117 15.000 ? 12 'X-RAY DIFFRACTION' ? r_chiral_restr 0.116 0.200 ? 171 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.021 ? 1252 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 239 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.202 1.500 ? 682 'X-RAY DIFFRACTION' ? r_mcbond_other 0.236 1.500 ? 275 'X-RAY DIFFRACTION' ? r_mcangle_it 2.246 2.000 ? 1106 'X-RAY DIFFRACTION' ? r_scbond_it 3.265 3.000 ? 456 'X-RAY DIFFRACTION' ? r_scangle_it 5.661 4.500 ? 431 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.200 _refine_ls_shell.d_res_low 2.257 _refine_ls_shell.number_reflns_R_work 683 _refine_ls_shell.R_factor_R_work 0.259 _refine_ls_shell.percent_reflns_obs 99.30 _refine_ls_shell.R_factor_R_free 0.354 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 22 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? # _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.entry_id 3HFI _pdbx_refine.R_factor_all_no_cutoff ? _pdbx_refine.R_factor_obs_no_cutoff ? _pdbx_refine.free_R_factor_no_cutoff ? _pdbx_refine.free_R_error_no_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff ? _pdbx_refine.free_R_val_test_set_ct_no_cutoff ? _pdbx_refine.R_factor_all_4sig_cutoff ? _pdbx_refine.R_factor_obs_4sig_cutoff ? _pdbx_refine.free_R_factor_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff ? _pdbx_refine.number_reflns_obs_4sig_cutoff ? # _struct.entry_id 3HFI _struct.title 'The crystal structure of the putative regulator from Escherichia coli CFT073' _struct.pdbx_descriptor 'Putative regulator' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3HFI _struct_keywords.pdbx_keywords 'structural genomics, unknown function' _struct_keywords.text ;regulator, structural geonomics, PSI, MCSG, Structural Genomics, Protein Structure Initiative, Midwest Center for Structural Genomics, DNA-binding, Transcription, Transcription regulation, unknown function ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ;This protein exists as dimer. The second part of the biological assembly is generated by the axis: Y,X,-Z ; # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 37 ? ARG A 45 ? ASN A 37 ARG A 45 1 ? 9 HELX_P HELX_P2 2 ILE A 75 ? CYS A 78 ? ILE A 75 CYS A 78 5 ? 4 HELX_P HELX_P3 3 GLY A 80 ? ILE A 84 ? GLY A 80 ILE A 84 5 ? 5 HELX_P HELX_P4 4 ASN A 90 ? LYS A 100 ? ASN A 90 LYS A 100 1 ? 11 HELX_P HELX_P5 5 GLY A 116 ? ASP A 124 ? GLY A 116 ASP A 124 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 26 ? PRO A 35 ? THR A 26 PRO A 35 A 2 ASP A 51 ? SER A 60 ? ASP A 51 SER A 60 A 3 LYS A 65 ? ILE A 73 ? LYS A 65 ILE A 73 A 4 LEU A 144 ? LEU A 153 ? LEU A 144 LEU A 153 A 5 PRO A 130 ? SER A 141 ? PRO A 130 SER A 141 A 6 TYR A 105 ? LEU A 114 ? TYR A 105 LEU A 114 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 32 ? N ARG A 32 O TYR A 54 ? O TYR A 54 A 2 3 N ARG A 57 ? N ARG A 57 O ILE A 69 ? O ILE A 69 A 3 4 N GLU A 70 ? N GLU A 70 O ASN A 150 ? O ASN A 150 A 4 5 O LEU A 153 ? O LEU A 153 N LEU A 132 ? N LEU A 132 A 5 6 O HIS A 133 ? O HIS A 133 N ALA A 111 ? N ALA A 111 # _database_PDB_matrix.entry_id 3HFI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3HFI _atom_sites.fract_transf_matrix[1][1] 0.009647 _atom_sites.fract_transf_matrix[1][2] 0.005570 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011140 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017179 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 1 ? ? ? A . n A 1 2 VAL 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 TYR 4 4 ? ? ? A . n A 1 5 PRO 5 5 ? ? ? A . n A 1 6 LEU 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 GLU 8 8 ? ? ? A . n A 1 9 GLY 9 9 ? ? ? A . n A 1 10 LEU 10 10 ? ? ? A . n A 1 11 LEU 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 PHE 13 13 ? ? ? A . n A 1 14 ALA 14 14 ? ? ? A . n A 1 15 GLU 15 15 ? ? ? A . n A 1 16 SER 16 16 ? ? ? A . n A 1 17 LEU 17 17 ? ? ? A . n A 1 18 GLU 18 18 ? ? ? A . n A 1 19 SER 19 19 ? ? ? A . n A 1 20 GLN 20 20 ? ? ? A . n A 1 21 LYS 21 21 ? ? ? A . n A 1 22 ILE 22 22 ? ? ? A . n A 1 23 HIS 23 23 ? ? ? A . n A 1 24 PHE 24 24 ? ? ? A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 MET 67 67 67 MET MET A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 HIS 89 89 89 HIS HIS A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 HIS 121 121 121 HIS HIS A . n A 1 122 PHE 122 122 122 PHE PHE A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 PHE 139 139 139 PHE PHE A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 ASN 150 150 150 ASN ASN A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 TRP 152 152 152 TRP TRP A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 TYR 158 158 158 TYR TYR A . n A 1 159 TYR 159 159 159 TYR TYR A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 THR 162 162 ? ? ? A . n A 1 163 VAL 163 163 ? ? ? A . n A 1 164 LEU 164 164 ? ? ? A . n A 1 165 GLN 165 165 ? ? ? A . n A 1 166 ARG 166 166 ? ? ? A . n A 1 167 ARG 167 167 ? ? ? A . n A 1 168 GLU 168 168 ? ? ? A . n A 1 169 LEU 169 169 ? ? ? A . n A 1 170 SER 170 170 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1830 ? 1 MORE -7 ? 1 'SSA (A^2)' 14070 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 185 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-05-26 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Version format compliance' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 40.8970 _pdbx_refine_tls.origin_y 46.5830 _pdbx_refine_tls.origin_z 3.8070 _pdbx_refine_tls.T[1][1] 0.1736 _pdbx_refine_tls.T[2][2] 0.1820 _pdbx_refine_tls.T[3][3] 0.2744 _pdbx_refine_tls.T[1][2] 0.0536 _pdbx_refine_tls.T[1][3] -0.0062 _pdbx_refine_tls.T[2][3] 0.0098 _pdbx_refine_tls.L[1][1] 5.4407 _pdbx_refine_tls.L[2][2] 3.2844 _pdbx_refine_tls.L[3][3] 3.0475 _pdbx_refine_tls.L[1][2] -1.9552 _pdbx_refine_tls.L[1][3] 0.8133 _pdbx_refine_tls.L[2][3] 0.5777 _pdbx_refine_tls.S[1][1] -0.0860 _pdbx_refine_tls.S[1][2] -0.0324 _pdbx_refine_tls.S[1][3] 0.3146 _pdbx_refine_tls.S[2][1] 0.0127 _pdbx_refine_tls.S[2][2] 0.0306 _pdbx_refine_tls.S[2][3] -0.4446 _pdbx_refine_tls.S[3][1] -0.4055 _pdbx_refine_tls.S[3][2] -0.0905 _pdbx_refine_tls.S[3][3] 0.0554 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 25 A 60 ? . . . . ? 'X-RAY DIFFRACTION' 2 1 A 61 A 90 ? . . . . ? 'X-RAY DIFFRACTION' 3 1 A 91 A 120 ? . . . . ? 'X-RAY DIFFRACTION' 4 1 A 121 A 157 ? . . . . ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SBC-Collect 'data collection' . ? 1 HKL-3000 phasing . ? 2 REFMAC refinement 5.5.0054 ? 3 HKL-3000 'data reduction' . ? 4 HKL-3000 'data scaling' . ? 5 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A GLU 42 ? ? CD A GLU 42 ? ? 1.605 1.515 0.090 0.015 N 2 1 CB A SER 106 ? ? OG A SER 106 ? ? 1.305 1.418 -0.113 0.013 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 57 ? ? CZ A ARG 57 ? ? NH1 A ARG 57 ? ? 124.19 120.30 3.89 0.50 N 2 1 CB A LEU 134 ? ? CG A LEU 134 ? ? CD1 A LEU 134 ? ? 99.72 111.00 -11.28 1.70 N 3 1 CB A LEU 153 ? ? CA A LEU 153 ? ? C A LEU 153 ? ? 91.25 110.20 -18.95 1.90 N 4 1 N A LYS 154 ? ? CA A LYS 154 ? ? CB A LYS 154 ? ? 77.03 110.60 -33.57 1.80 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 115 ? ? -25.94 -56.77 2 1 ASP A 124 ? ? 77.26 -30.28 3 1 ILE A 125 ? ? -30.60 146.86 4 1 GLU A 127 ? ? -46.88 164.17 5 1 ASP A 128 ? ? 59.31 -1.42 6 1 LYS A 157 ? ? -31.34 150.93 7 1 TYR A 158 ? ? -179.57 11.76 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS 121 ? NE2 ? A HIS 121 NE2 2 1 Y 1 A ILE 125 ? CG1 ? A ILE 125 CG1 3 1 Y 1 A ILE 125 ? CG2 ? A ILE 125 CG2 4 1 Y 1 A ILE 125 ? CD1 ? A ILE 125 CD1 5 1 Y 1 A TYR 158 ? CG ? A TYR 158 CG 6 1 Y 1 A TYR 158 ? CD1 ? A TYR 158 CD1 7 1 Y 1 A TYR 158 ? CD2 ? A TYR 158 CD2 8 1 Y 1 A TYR 158 ? CE1 ? A TYR 158 CE1 9 1 Y 1 A TYR 158 ? CE2 ? A TYR 158 CE2 10 1 Y 1 A TYR 158 ? CZ ? A TYR 158 CZ 11 1 Y 1 A TYR 158 ? OH ? A TYR 158 OH 12 1 Y 1 A TYR 159 ? CG ? A TYR 159 CG 13 1 Y 1 A TYR 159 ? CD1 ? A TYR 159 CD1 14 1 Y 1 A TYR 159 ? CD2 ? A TYR 159 CD2 15 1 Y 1 A TYR 159 ? CE1 ? A TYR 159 CE1 16 1 Y 1 A TYR 159 ? CE2 ? A TYR 159 CE2 17 1 Y 1 A TYR 159 ? CZ ? A TYR 159 CZ 18 1 Y 1 A TYR 159 ? OH ? A TYR 159 OH # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 1 ? A ASN 1 2 1 Y 1 A VAL 2 ? A VAL 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A TYR 4 ? A TYR 4 5 1 Y 1 A PRO 5 ? A PRO 5 6 1 Y 1 A LEU 6 ? A LEU 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 1 Y 1 A GLU 8 ? A GLU 8 9 1 Y 1 A GLY 9 ? A GLY 9 10 1 Y 1 A LEU 10 ? A LEU 10 11 1 Y 1 A LEU 11 ? A LEU 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A PHE 13 ? A PHE 13 14 1 Y 1 A ALA 14 ? A ALA 14 15 1 Y 1 A GLU 15 ? A GLU 15 16 1 Y 1 A SER 16 ? A SER 16 17 1 Y 1 A LEU 17 ? A LEU 17 18 1 Y 1 A GLU 18 ? A GLU 18 19 1 Y 1 A SER 19 ? A SER 19 20 1 Y 1 A GLN 20 ? A GLN 20 21 1 Y 1 A LYS 21 ? A LYS 21 22 1 Y 1 A ILE 22 ? A ILE 22 23 1 Y 1 A HIS 23 ? A HIS 23 24 1 Y 1 A PHE 24 ? A PHE 24 25 1 Y 1 A THR 162 ? A THR 162 26 1 Y 1 A VAL 163 ? A VAL 163 27 1 Y 1 A LEU 164 ? A LEU 164 28 1 Y 1 A GLN 165 ? A GLN 165 29 1 Y 1 A ARG 166 ? A ARG 166 30 1 Y 1 A ARG 167 ? A ARG 167 31 1 Y 1 A GLU 168 ? A GLU 168 32 1 Y 1 A LEU 169 ? A LEU 169 33 1 Y 1 A SER 170 ? A SER 170 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 171 1 HOH HOH A . B 2 HOH 2 172 4 HOH HOH A . B 2 HOH 3 173 5 HOH HOH A . B 2 HOH 4 174 6 HOH HOH A . B 2 HOH 5 175 7 HOH HOH A . B 2 HOH 6 176 10 HOH HOH A . B 2 HOH 7 177 11 HOH HOH A . B 2 HOH 8 178 12 HOH HOH A . B 2 HOH 9 179 13 HOH HOH A . B 2 HOH 10 180 14 HOH HOH A . B 2 HOH 11 181 15 HOH HOH A . B 2 HOH 12 182 16 HOH HOH A . B 2 HOH 13 183 17 HOH HOH A . B 2 HOH 14 184 18 HOH HOH A . B 2 HOH 15 185 19 HOH HOH A . B 2 HOH 16 186 20 HOH HOH A . B 2 HOH 17 187 21 HOH HOH A . B 2 HOH 18 188 22 HOH HOH A . B 2 HOH 19 189 23 HOH HOH A . B 2 HOH 20 190 24 HOH HOH A . B 2 HOH 21 191 25 HOH HOH A . B 2 HOH 22 192 26 HOH HOH A . B 2 HOH 23 193 27 HOH HOH A . B 2 HOH 24 194 28 HOH HOH A . B 2 HOH 25 195 30 HOH HOH A . B 2 HOH 26 196 31 HOH HOH A . B 2 HOH 27 197 32 HOH HOH A . B 2 HOH 28 198 35 HOH HOH A . B 2 HOH 29 199 36 HOH HOH A . B 2 HOH 30 200 38 HOH HOH A . B 2 HOH 31 201 39 HOH HOH A . B 2 HOH 32 202 41 HOH HOH A . B 2 HOH 33 203 42 HOH HOH A . B 2 HOH 34 204 44 HOH HOH A . B 2 HOH 35 205 47 HOH HOH A . B 2 HOH 36 206 48 HOH HOH A . B 2 HOH 37 207 49 HOH HOH A . B 2 HOH 38 208 55 HOH HOH A . B 2 HOH 39 209 56 HOH HOH A . B 2 HOH 40 210 57 HOH HOH A . #