data_3HIK # _entry.id 3HIK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3HIK RCSB RCSB053177 WWPDB D_1000053177 # _pdbx_database_status.entry_id 3HIK _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-05-20 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wlodawer, A.' 1 ? 'Moulaei, T.' 2 ? # _citation.id primary _citation.title 'Structural and functional analyses of minimal phosphopeptides targeting the polo-box domain of polo-like kinase 1.' _citation.journal_abbrev Nat.Struct.Mol.Biol. _citation.journal_volume 16 _citation.page_first 876 _citation.page_last 882 _citation.year 2009 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1545-9993 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19597481 _citation.pdbx_database_id_DOI 10.1038/nsmb.1628 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Yun, S.M.' 1 primary 'Moulaei, T.' 2 primary 'Lim, D.' 3 primary 'Bang, J.K.' 4 primary 'Park, J.E.' 5 primary 'Shenoy, S.R.' 6 primary 'Liu, F.' 7 primary 'Kang, Y.H.' 8 primary 'Liao, C.' 9 primary 'Soung, N.K.' 10 primary 'Lee, S.' 11 primary 'Yoon, D.Y.' 12 primary 'Lim, Y.' 13 primary 'Lee, D.H.' 14 primary 'Otaka, A.' 15 primary 'Appella, E.' 16 primary 'McMahon, J.B.' 17 primary 'Nicklaus, M.C.' 18 primary 'Burke, T.R.' 19 primary 'Yaffe, M.B.' 20 primary 'Wlodawer, A.' 21 primary 'Lee, K.S.' 22 # _cell.entry_id 3HIK _cell.length_a 35.200 _cell.length_b 65.800 _cell.length_c 104.100 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3HIK _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Serine/threonine-protein kinase PLK1' 27272.113 1 2.7.11.21 ? 'UNP residues 367-603' ? 2 polymer syn 'Pentamer phosphopeptide' 660.634 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 4 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 5 water nat water 18.015 122 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Polo-like kinase 1, PLK-1, Serine/threonine-protein kinase 13, STPK13' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYN DGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLS NGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS ; ;GEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYN DGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLS NGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS ; A ? 2 'polypeptide(L)' no yes '(ACE)PLHS(TPO)' XPLHST B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLU n 1 3 VAL n 1 4 VAL n 1 5 ASP n 1 6 CYS n 1 7 HIS n 1 8 LEU n 1 9 SER n 1 10 ASP n 1 11 MET n 1 12 LEU n 1 13 GLN n 1 14 GLN n 1 15 LEU n 1 16 HIS n 1 17 SER n 1 18 VAL n 1 19 ASN n 1 20 ALA n 1 21 SER n 1 22 LYS n 1 23 PRO n 1 24 SER n 1 25 GLU n 1 26 ARG n 1 27 GLY n 1 28 LEU n 1 29 VAL n 1 30 ARG n 1 31 GLN n 1 32 GLU n 1 33 GLU n 1 34 ALA n 1 35 GLU n 1 36 ASP n 1 37 PRO n 1 38 ALA n 1 39 CYS n 1 40 ILE n 1 41 PRO n 1 42 ILE n 1 43 PHE n 1 44 TRP n 1 45 VAL n 1 46 SER n 1 47 LYS n 1 48 TRP n 1 49 VAL n 1 50 ASP n 1 51 TYR n 1 52 SER n 1 53 ASP n 1 54 LYS n 1 55 TYR n 1 56 GLY n 1 57 LEU n 1 58 GLY n 1 59 TYR n 1 60 GLN n 1 61 LEU n 1 62 CYS n 1 63 ASP n 1 64 ASN n 1 65 SER n 1 66 VAL n 1 67 GLY n 1 68 VAL n 1 69 LEU n 1 70 PHE n 1 71 ASN n 1 72 ASP n 1 73 SER n 1 74 THR n 1 75 ARG n 1 76 LEU n 1 77 ILE n 1 78 LEU n 1 79 TYR n 1 80 ASN n 1 81 ASP n 1 82 GLY n 1 83 ASP n 1 84 SER n 1 85 LEU n 1 86 GLN n 1 87 TYR n 1 88 ILE n 1 89 GLU n 1 90 ARG n 1 91 ASP n 1 92 GLY n 1 93 THR n 1 94 GLU n 1 95 SER n 1 96 TYR n 1 97 LEU n 1 98 THR n 1 99 VAL n 1 100 SER n 1 101 SER n 1 102 HIS n 1 103 PRO n 1 104 ASN n 1 105 SER n 1 106 LEU n 1 107 MET n 1 108 LYS n 1 109 LYS n 1 110 ILE n 1 111 THR n 1 112 LEU n 1 113 LEU n 1 114 LYS n 1 115 TYR n 1 116 PHE n 1 117 ARG n 1 118 ASN n 1 119 TYR n 1 120 MET n 1 121 SER n 1 122 GLU n 1 123 HIS n 1 124 LEU n 1 125 LEU n 1 126 LYS n 1 127 ALA n 1 128 GLY n 1 129 ALA n 1 130 ASN n 1 131 ILE n 1 132 THR n 1 133 PRO n 1 134 ARG n 1 135 GLU n 1 136 GLY n 1 137 ASP n 1 138 GLU n 1 139 LEU n 1 140 ALA n 1 141 ARG n 1 142 LEU n 1 143 PRO n 1 144 TYR n 1 145 LEU n 1 146 ARG n 1 147 THR n 1 148 TRP n 1 149 PHE n 1 150 ARG n 1 151 THR n 1 152 ARG n 1 153 SER n 1 154 ALA n 1 155 ILE n 1 156 ILE n 1 157 LEU n 1 158 HIS n 1 159 LEU n 1 160 SER n 1 161 ASN n 1 162 GLY n 1 163 SER n 1 164 VAL n 1 165 GLN n 1 166 ILE n 1 167 ASN n 1 168 PHE n 1 169 PHE n 1 170 GLN n 1 171 ASP n 1 172 HIS n 1 173 THR n 1 174 LYS n 1 175 LEU n 1 176 ILE n 1 177 LEU n 1 178 CYS n 1 179 PRO n 1 180 LEU n 1 181 MET n 1 182 ALA n 1 183 ALA n 1 184 VAL n 1 185 THR n 1 186 TYR n 1 187 ILE n 1 188 ASP n 1 189 GLU n 1 190 LYS n 1 191 ARG n 1 192 ASP n 1 193 PHE n 1 194 ARG n 1 195 THR n 1 196 TYR n 1 197 ARG n 1 198 LEU n 1 199 SER n 1 200 LEU n 1 201 LEU n 1 202 GLU n 1 203 GLU n 1 204 TYR n 1 205 GLY n 1 206 CYS n 1 207 CYS n 1 208 LYS n 1 209 GLU n 1 210 LEU n 1 211 ALA n 1 212 SER n 1 213 ARG n 1 214 LEU n 1 215 ARG n 1 216 TYR n 1 217 ALA n 1 218 ARG n 1 219 THR n 1 220 MET n 1 221 VAL n 1 222 ASP n 1 223 LYS n 1 224 LEU n 1 225 LEU n 1 226 SER n 1 227 SER n 1 228 ARG n 1 229 SER n 1 230 ALA n 1 231 SER n 1 232 ASN n 1 233 ARG n 1 234 LEU n 1 235 LYS n 1 236 ALA n 1 237 SER n 2 1 ACE n 2 2 PRO n 2 3 LEU n 2 4 HIS n 2 5 SER n 2 6 TPO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PLK, PLK1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pDEST-527 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PLK1_HUMAN _struct_ref.pdbx_db_accession P53350 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYN DGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLS NGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS ; _struct_ref.pdbx_align_begin 367 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3HIK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 237 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P53350 _struct_ref_seq.db_align_beg 367 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 603 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 367 _struct_ref_seq.pdbx_auth_seq_align_end 603 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3HIK _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.26 _exptl_crystal.density_percent_sol 45.66 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'hanging drop' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.2 M di potassium phosphate, 20% w/v PEG 3350, hanging drop, temperature 298K' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.pdbx_collection_date 2007-08-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.00 # _reflns.entry_id 3HIK _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.000 _reflns.d_resolution_high 1.570 _reflns.number_obs 28597 _reflns.number_all ? _reflns.percent_possible_obs 82.600 _reflns.pdbx_Rmerge_I_obs 0.051 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 22.583 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4.400 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_unique_obs _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 1.57 1.63 28.90 0.614 ? ? 2.80 ? ? ? ? ? ? 1 1 1.63 1.69 49.00 0.504 ? ? 3.20 ? ? ? ? ? ? 2 1 1.69 1.77 69.70 0.464 ? ? 3.60 ? ? ? ? ? ? 3 1 1.77 1.86 85.00 0.349 ? ? 4.20 ? ? ? ? ? ? 4 1 1.86 1.98 95.90 0.239 ? ? 4.60 ? ? ? ? ? ? 5 1 1.98 2.13 98.70 0.144 ? ? 4.90 ? ? ? ? ? ? 6 1 2.13 2.35 98.40 0.094 ? ? 4.90 ? ? ? ? ? ? 7 1 2.35 2.68 99.50 0.075 ? ? 4.80 ? ? ? ? ? ? 8 1 2.68 3.38 99.10 0.052 ? ? 4.60 ? ? ? ? ? ? 9 1 3.38 50.00 99.10 0.036 ? ? 4.20 ? ? ? ? ? ? 10 1 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 3HIK _refine.ls_number_reflns_obs 22482 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50.00 _refine.ls_d_res_high 1.77 _refine.ls_percent_reflns_obs 96.60 _refine.ls_R_factor_obs 0.20607 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.20460 _refine.ls_R_factor_R_free 0.23737 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.3 _refine.ls_number_reflns_R_free 1020 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min 0.50 _refine.occupancy_max 1.00 _refine.correlation_coeff_Fo_to_Fc 0.962 _refine.correlation_coeff_Fo_to_Fc_free 0.954 _refine.B_iso_mean 33.621 _refine.aniso_B[1][1] 1.88 _refine.aniso_B[2][2] -0.49 _refine.aniso_B[3][3] -1.39 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.137 _refine.pdbx_overall_ESU_R_Free 0.128 _refine.overall_SU_ML 0.102 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 3.317 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1826 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 16 _refine_hist.number_atoms_solvent 122 _refine_hist.number_atoms_total 1964 _refine_hist.d_res_high 1.77 _refine_hist.d_res_low 50.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.018 0.022 ? 1893 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.783 1.978 ? 2561 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.414 5.000 ? 227 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 28.478 22.911 ? 79 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 15.807 15.000 ? 331 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 21.237 15.000 ? 13 'X-RAY DIFFRACTION' ? r_chiral_restr 0.134 0.200 ? 292 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.008 0.020 ? 1378 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.226 0.200 ? 846 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.309 0.200 ? 1293 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.164 0.200 ? 119 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.211 0.200 ? 32 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.143 0.200 ? 8 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.219 1.500 ? 1185 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.011 2.000 ? 1864 'X-RAY DIFFRACTION' ? r_scbond_it 2.814 3.000 ? 811 'X-RAY DIFFRACTION' ? r_scangle_it 3.887 4.500 ? 697 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.770 _refine_ls_shell.d_res_low 1.816 _refine_ls_shell.number_reflns_R_work 1367 _refine_ls_shell.R_factor_R_work 0.307 _refine_ls_shell.percent_reflns_obs 82.09 _refine_ls_shell.R_factor_R_free 0.354 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 58 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 3HIK _struct.title 'Structure of human Plk1-PBD in complex with PLHSpT' _struct.pdbx_descriptor 'Serine/threonine-protein kinase PLK1 (E.C.2.7.11.21), Pentamer phosphopeptide' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3HIK _struct_keywords.text ;kinase, serine/threonine protein kinase, cell cycle, localization, ATP-binding, Cell division, Mitosis, Nucleotide-binding, Nucleus, Phosphoprotein, Serine/threonine-protein kinase, Transferase ; _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 3 ? F N N 5 ? G N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 5 ? ALA A 20 ? ASP A 371 ALA A 386 1 ? 16 HELX_P HELX_P2 2 SER A 21 ? ARG A 26 ? SER A 387 ARG A 392 5 ? 6 HELX_P HELX_P3 3 ARG A 30 ? GLU A 35 ? ARG A 396 GLU A 401 5 ? 6 HELX_P HELX_P4 4 ASP A 36 ? ILE A 40 ? ASP A 402 ILE A 406 5 ? 5 HELX_P HELX_P5 5 PRO A 103 ? SER A 105 ? PRO A 469 SER A 471 5 ? 3 HELX_P HELX_P6 6 LEU A 106 ? LEU A 124 ? LEU A 472 LEU A 490 1 ? 19 HELX_P HELX_P7 7 LEU A 198 ? GLY A 205 ? LEU A 564 GLY A 571 1 ? 8 HELX_P HELX_P8 8 CYS A 207 ? ARG A 228 ? CYS A 573 ARG A 594 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? B ACE 1 C ? ? ? 1_555 B PRO 2 N ? ? B ACE 0 B PRO 1 1_555 ? ? ? ? ? ? ? 1.352 ? covale2 covale ? ? B SER 5 C ? ? ? 1_555 B TPO 6 N ? ? B SER 4 B TPO 5 1_555 ? ? ? ? ? ? ? 1.344 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 45 ? ASP A 50 ? VAL A 411 ASP A 416 A 2 GLY A 56 ? LEU A 61 ? GLY A 422 LEU A 427 A 3 VAL A 66 ? PHE A 70 ? VAL A 432 PHE A 436 A 4 ARG A 75 ? LEU A 78 ? ARG A 441 LEU A 444 A 5 SER A 84 ? ILE A 88 ? SER A 450 ILE A 454 A 6 GLU A 94 ? THR A 98 ? GLU A 460 THR A 464 B 1 LEU A 145 ? ARG A 150 ? LEU A 511 ARG A 516 B 2 ALA A 154 ? LEU A 159 ? ALA A 520 LEU A 525 B 3 VAL A 164 ? PHE A 168 ? VAL A 530 PHE A 534 B 4 LYS A 174 ? CYS A 178 ? LYS A 540 CYS A 544 B 5 ALA A 183 ? ILE A 187 ? ALA A 549 ILE A 553 B 6 PHE A 193 ? ARG A 197 ? PHE A 559 ARG A 563 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 49 ? N VAL A 415 O GLY A 58 ? O GLY A 424 A 2 3 N LEU A 57 ? N LEU A 423 O LEU A 69 ? O LEU A 435 A 3 4 N VAL A 66 ? N VAL A 432 O LEU A 78 ? O LEU A 444 A 4 5 N ARG A 75 ? N ARG A 441 O ILE A 88 ? O ILE A 454 A 5 6 N LEU A 85 ? N LEU A 451 O LEU A 97 ? O LEU A 463 B 1 2 N PHE A 149 ? N PHE A 515 O ILE A 156 ? O ILE A 522 B 2 3 N LEU A 157 ? N LEU A 523 O GLN A 165 ? O GLN A 531 B 3 4 N VAL A 164 ? N VAL A 530 O LEU A 177 ? O LEU A 543 B 4 5 N LYS A 174 ? N LYS A 540 O ILE A 187 ? O ILE A 553 B 5 6 N TYR A 186 ? N TYR A 552 O ARG A 194 ? O ARG A 560 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE GOL A 2' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE EDO A 3' AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GOL B 6' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 HOH F . ? HOH A 114 . ? 1_555 ? 2 AC1 3 THR A 147 ? THR A 513 . ? 1_555 ? 3 AC1 3 TRP A 148 ? TRP A 514 . ? 1_555 ? 4 AC2 4 HOH F . ? HOH A 64 . ? 1_555 ? 5 AC2 4 TYR A 55 ? TYR A 421 . ? 1_555 ? 6 AC2 4 ASN A 71 ? ASN A 437 . ? 1_555 ? 7 AC2 4 ASP A 72 ? ASP A 438 . ? 1_555 ? 8 AC3 10 GLY A 92 ? GLY A 458 . ? 1_455 ? 9 AC3 10 THR A 93 ? THR A 459 . ? 1_455 ? 10 AC3 10 GLU A 94 ? GLU A 460 . ? 1_455 ? 11 AC3 10 PHE A 169 ? PHE A 535 . ? 1_555 ? 12 AC3 10 HIS A 172 ? HIS A 538 . ? 1_555 ? 13 AC3 10 PRO B 2 ? PRO B 1 . ? 1_555 ? 14 AC3 10 HIS B 4 ? HIS B 3 . ? 1_555 ? 15 AC3 10 TPO B 6 ? TPO B 5 . ? 1_555 ? 16 AC3 10 HOH G . ? HOH B 7 . ? 1_555 ? 17 AC3 10 HOH G . ? HOH B 115 . ? 1_555 ? # _atom_sites.entry_id 3HIK _atom_sites.fract_transf_matrix[1][1] 0.028409 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015198 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009606 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 367 ? ? ? A . n A 1 2 GLU 2 368 ? ? ? A . n A 1 3 VAL 3 369 ? ? ? A . n A 1 4 VAL 4 370 ? ? ? A . n A 1 5 ASP 5 371 371 ASP ASP A . n A 1 6 CYS 6 372 372 CYS CYS A . n A 1 7 HIS 7 373 373 HIS HIS A . n A 1 8 LEU 8 374 374 LEU LEU A . n A 1 9 SER 9 375 375 SER SER A . n A 1 10 ASP 10 376 376 ASP ASP A . n A 1 11 MET 11 377 377 MET MET A . n A 1 12 LEU 12 378 378 LEU LEU A . n A 1 13 GLN 13 379 379 GLN GLN A . n A 1 14 GLN 14 380 380 GLN GLN A . n A 1 15 LEU 15 381 381 LEU LEU A . n A 1 16 HIS 16 382 382 HIS HIS A . n A 1 17 SER 17 383 383 SER SER A . n A 1 18 VAL 18 384 384 VAL VAL A . n A 1 19 ASN 19 385 385 ASN ASN A . n A 1 20 ALA 20 386 386 ALA ALA A . n A 1 21 SER 21 387 387 SER SER A . n A 1 22 LYS 22 388 388 LYS LYS A . n A 1 23 PRO 23 389 389 PRO PRO A . n A 1 24 SER 24 390 390 SER SER A . n A 1 25 GLU 25 391 391 GLU GLU A . n A 1 26 ARG 26 392 392 ARG ARG A . n A 1 27 GLY 27 393 393 GLY GLY A . n A 1 28 LEU 28 394 394 LEU LEU A . n A 1 29 VAL 29 395 395 VAL VAL A . n A 1 30 ARG 30 396 396 ARG ARG A . n A 1 31 GLN 31 397 397 GLN GLN A . n A 1 32 GLU 32 398 398 GLU GLU A . n A 1 33 GLU 33 399 399 GLU GLU A . n A 1 34 ALA 34 400 400 ALA ALA A . n A 1 35 GLU 35 401 401 GLU GLU A . n A 1 36 ASP 36 402 402 ASP ASP A . n A 1 37 PRO 37 403 403 PRO PRO A . n A 1 38 ALA 38 404 404 ALA ALA A . n A 1 39 CYS 39 405 405 CYS CYS A . n A 1 40 ILE 40 406 406 ILE ILE A . n A 1 41 PRO 41 407 407 PRO PRO A . n A 1 42 ILE 42 408 408 ILE ILE A . n A 1 43 PHE 43 409 409 PHE PHE A . n A 1 44 TRP 44 410 410 TRP TRP A . n A 1 45 VAL 45 411 411 VAL VAL A . n A 1 46 SER 46 412 412 SER SER A . n A 1 47 LYS 47 413 413 LYS LYS A . n A 1 48 TRP 48 414 414 TRP TRP A . n A 1 49 VAL 49 415 415 VAL VAL A . n A 1 50 ASP 50 416 416 ASP ASP A . n A 1 51 TYR 51 417 417 TYR TYR A . n A 1 52 SER 52 418 418 SER SER A . n A 1 53 ASP 53 419 419 ASP ASP A . n A 1 54 LYS 54 420 420 LYS LYS A . n A 1 55 TYR 55 421 421 TYR TYR A . n A 1 56 GLY 56 422 422 GLY GLY A . n A 1 57 LEU 57 423 423 LEU LEU A . n A 1 58 GLY 58 424 424 GLY GLY A . n A 1 59 TYR 59 425 425 TYR TYR A . n A 1 60 GLN 60 426 426 GLN GLN A . n A 1 61 LEU 61 427 427 LEU LEU A . n A 1 62 CYS 62 428 428 CYS CYS A . n A 1 63 ASP 63 429 429 ASP ASP A . n A 1 64 ASN 64 430 430 ASN ASN A . n A 1 65 SER 65 431 431 SER SER A . n A 1 66 VAL 66 432 432 VAL VAL A . n A 1 67 GLY 67 433 433 GLY GLY A . n A 1 68 VAL 68 434 434 VAL VAL A . n A 1 69 LEU 69 435 435 LEU LEU A . n A 1 70 PHE 70 436 436 PHE PHE A . n A 1 71 ASN 71 437 437 ASN ASN A . n A 1 72 ASP 72 438 438 ASP ASP A . n A 1 73 SER 73 439 439 SER SER A . n A 1 74 THR 74 440 440 THR THR A . n A 1 75 ARG 75 441 441 ARG ARG A . n A 1 76 LEU 76 442 442 LEU LEU A . n A 1 77 ILE 77 443 443 ILE ILE A . n A 1 78 LEU 78 444 444 LEU LEU A . n A 1 79 TYR 79 445 445 TYR TYR A . n A 1 80 ASN 80 446 446 ASN ASN A . n A 1 81 ASP 81 447 447 ASP ASP A . n A 1 82 GLY 82 448 448 GLY GLY A . n A 1 83 ASP 83 449 449 ASP ASP A . n A 1 84 SER 84 450 450 SER SER A . n A 1 85 LEU 85 451 451 LEU LEU A . n A 1 86 GLN 86 452 452 GLN GLN A . n A 1 87 TYR 87 453 453 TYR TYR A . n A 1 88 ILE 88 454 454 ILE ILE A . n A 1 89 GLU 89 455 455 GLU GLU A . n A 1 90 ARG 90 456 456 ARG ARG A . n A 1 91 ASP 91 457 457 ASP ASP A . n A 1 92 GLY 92 458 458 GLY GLY A . n A 1 93 THR 93 459 459 THR THR A . n A 1 94 GLU 94 460 460 GLU GLU A . n A 1 95 SER 95 461 461 SER SER A . n A 1 96 TYR 96 462 462 TYR TYR A . n A 1 97 LEU 97 463 463 LEU LEU A . n A 1 98 THR 98 464 464 THR THR A . n A 1 99 VAL 99 465 465 VAL VAL A . n A 1 100 SER 100 466 466 SER SER A . n A 1 101 SER 101 467 467 SER SER A . n A 1 102 HIS 102 468 468 HIS HIS A . n A 1 103 PRO 103 469 469 PRO PRO A . n A 1 104 ASN 104 470 470 ASN ASN A . n A 1 105 SER 105 471 471 SER SER A . n A 1 106 LEU 106 472 472 LEU LEU A . n A 1 107 MET 107 473 473 MET MET A . n A 1 108 LYS 108 474 474 LYS LYS A . n A 1 109 LYS 109 475 475 LYS LYS A . n A 1 110 ILE 110 476 476 ILE ILE A . n A 1 111 THR 111 477 477 THR THR A . n A 1 112 LEU 112 478 478 LEU LEU A . n A 1 113 LEU 113 479 479 LEU LEU A . n A 1 114 LYS 114 480 480 LYS LYS A . n A 1 115 TYR 115 481 481 TYR TYR A . n A 1 116 PHE 116 482 482 PHE PHE A . n A 1 117 ARG 117 483 483 ARG ARG A . n A 1 118 ASN 118 484 484 ASN ASN A . n A 1 119 TYR 119 485 485 TYR TYR A . n A 1 120 MET 120 486 486 MET MET A . n A 1 121 SER 121 487 487 SER SER A . n A 1 122 GLU 122 488 488 GLU GLU A . n A 1 123 HIS 123 489 489 HIS HIS A . n A 1 124 LEU 124 490 490 LEU LEU A . n A 1 125 LEU 125 491 491 LEU LEU A . n A 1 126 LYS 126 492 492 LYS LYS A . n A 1 127 ALA 127 493 493 ALA ALA A . n A 1 128 GLY 128 494 494 GLY GLY A . n A 1 129 ALA 129 495 495 ALA ALA A . n A 1 130 ASN 130 496 496 ASN ASN A . n A 1 131 ILE 131 497 497 ILE ILE A . n A 1 132 THR 132 498 498 THR THR A . n A 1 133 PRO 133 499 499 PRO PRO A . n A 1 134 ARG 134 500 500 ARG ARG A . n A 1 135 GLU 135 501 501 GLU GLU A . n A 1 136 GLY 136 502 502 GLY GLY A . n A 1 137 ASP 137 503 503 ASP ASP A . n A 1 138 GLU 138 504 504 GLU GLU A . n A 1 139 LEU 139 505 505 LEU LEU A . n A 1 140 ALA 140 506 506 ALA ALA A . n A 1 141 ARG 141 507 507 ARG ARG A . n A 1 142 LEU 142 508 508 LEU LEU A . n A 1 143 PRO 143 509 509 PRO PRO A . n A 1 144 TYR 144 510 510 TYR TYR A . n A 1 145 LEU 145 511 511 LEU LEU A . n A 1 146 ARG 146 512 512 ARG ARG A . n A 1 147 THR 147 513 513 THR THR A . n A 1 148 TRP 148 514 514 TRP TRP A . n A 1 149 PHE 149 515 515 PHE PHE A . n A 1 150 ARG 150 516 516 ARG ARG A . n A 1 151 THR 151 517 517 THR THR A . n A 1 152 ARG 152 518 518 ARG ARG A . n A 1 153 SER 153 519 519 SER SER A . n A 1 154 ALA 154 520 520 ALA ALA A . n A 1 155 ILE 155 521 521 ILE ILE A . n A 1 156 ILE 156 522 522 ILE ILE A . n A 1 157 LEU 157 523 523 LEU LEU A . n A 1 158 HIS 158 524 524 HIS HIS A . n A 1 159 LEU 159 525 525 LEU LEU A . n A 1 160 SER 160 526 526 SER SER A . n A 1 161 ASN 161 527 527 ASN ASN A . n A 1 162 GLY 162 528 528 GLY GLY A . n A 1 163 SER 163 529 529 SER SER A . n A 1 164 VAL 164 530 530 VAL VAL A . n A 1 165 GLN 165 531 531 GLN GLN A . n A 1 166 ILE 166 532 532 ILE ILE A . n A 1 167 ASN 167 533 533 ASN ASN A . n A 1 168 PHE 168 534 534 PHE PHE A . n A 1 169 PHE 169 535 535 PHE PHE A . n A 1 170 GLN 170 536 536 GLN GLN A . n A 1 171 ASP 171 537 537 ASP ASP A . n A 1 172 HIS 172 538 538 HIS HIS A . n A 1 173 THR 173 539 539 THR THR A . n A 1 174 LYS 174 540 540 LYS LYS A . n A 1 175 LEU 175 541 541 LEU LEU A . n A 1 176 ILE 176 542 542 ILE ILE A . n A 1 177 LEU 177 543 543 LEU LEU A . n A 1 178 CYS 178 544 544 CYS CYS A . n A 1 179 PRO 179 545 545 PRO PRO A . n A 1 180 LEU 180 546 546 LEU LEU A . n A 1 181 MET 181 547 547 MET MET A . n A 1 182 ALA 182 548 548 ALA ALA A . n A 1 183 ALA 183 549 549 ALA ALA A . n A 1 184 VAL 184 550 550 VAL VAL A . n A 1 185 THR 185 551 551 THR THR A . n A 1 186 TYR 186 552 552 TYR TYR A . n A 1 187 ILE 187 553 553 ILE ILE A . n A 1 188 ASP 188 554 554 ASP ASP A . n A 1 189 GLU 189 555 555 GLU GLU A . n A 1 190 LYS 190 556 556 LYS LYS A . n A 1 191 ARG 191 557 557 ARG ARG A . n A 1 192 ASP 192 558 558 ASP ASP A . n A 1 193 PHE 193 559 559 PHE PHE A . n A 1 194 ARG 194 560 560 ARG ARG A . n A 1 195 THR 195 561 561 THR THR A . n A 1 196 TYR 196 562 562 TYR TYR A . n A 1 197 ARG 197 563 563 ARG ARG A . n A 1 198 LEU 198 564 564 LEU LEU A . n A 1 199 SER 199 565 565 SER SER A . n A 1 200 LEU 200 566 566 LEU LEU A . n A 1 201 LEU 201 567 567 LEU LEU A . n A 1 202 GLU 202 568 568 GLU GLU A . n A 1 203 GLU 203 569 569 GLU GLU A . n A 1 204 TYR 204 570 570 TYR TYR A . n A 1 205 GLY 205 571 571 GLY GLY A . n A 1 206 CYS 206 572 572 CYS CYS A . n A 1 207 CYS 207 573 573 CYS CYS A . n A 1 208 LYS 208 574 574 LYS LYS A . n A 1 209 GLU 209 575 575 GLU GLU A . n A 1 210 LEU 210 576 576 LEU LEU A . n A 1 211 ALA 211 577 577 ALA ALA A . n A 1 212 SER 212 578 578 SER SER A . n A 1 213 ARG 213 579 579 ARG ARG A . n A 1 214 LEU 214 580 580 LEU LEU A . n A 1 215 ARG 215 581 581 ARG ARG A . n A 1 216 TYR 216 582 582 TYR TYR A . n A 1 217 ALA 217 583 583 ALA ALA A . n A 1 218 ARG 218 584 584 ARG ARG A . n A 1 219 THR 219 585 585 THR THR A . n A 1 220 MET 220 586 586 MET MET A . n A 1 221 VAL 221 587 587 VAL VAL A . n A 1 222 ASP 222 588 588 ASP ASP A . n A 1 223 LYS 223 589 589 LYS LYS A . n A 1 224 LEU 224 590 590 LEU LEU A . n A 1 225 LEU 225 591 591 LEU LEU A . n A 1 226 SER 226 592 592 SER SER A . n A 1 227 SER 227 593 593 SER SER A . n A 1 228 ARG 228 594 594 ARG ARG A . n A 1 229 SER 229 595 ? ? ? A . n A 1 230 ALA 230 596 ? ? ? A . n A 1 231 SER 231 597 ? ? ? A . n A 1 232 ASN 232 598 ? ? ? A . n A 1 233 ARG 233 599 ? ? ? A . n A 1 234 LEU 234 600 ? ? ? A . n A 1 235 LYS 235 601 ? ? ? A . n A 1 236 ALA 236 602 ? ? ? A . n A 1 237 SER 237 603 ? ? ? A . n B 2 1 ACE 1 0 0 ACE ACE B . n B 2 2 PRO 2 1 1 PRO PRO B . n B 2 3 LEU 3 2 2 LEU LEU B . n B 2 4 HIS 4 3 3 HIS HIS B . n B 2 5 SER 5 4 4 SER SER B . n B 2 6 TPO 6 5 5 TPO TPO B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 GOL 1 2 2 GOL GOL A . D 4 EDO 1 3 3 EDO EDO A . E 3 GOL 1 6 1 GOL GOL B . F 5 HOH 1 1 1 HOH HOH A . F 5 HOH 2 4 4 HOH HOH A . F 5 HOH 3 6 6 HOH HOH A . F 5 HOH 4 7 7 HOH HOH A . F 5 HOH 5 8 8 HOH HOH A . F 5 HOH 6 9 9 HOH HOH A . F 5 HOH 7 10 10 HOH HOH A . F 5 HOH 8 11 11 HOH HOH A . F 5 HOH 9 12 12 HOH HOH A . F 5 HOH 10 13 13 HOH HOH A . F 5 HOH 11 14 14 HOH HOH A . F 5 HOH 12 15 15 HOH HOH A . F 5 HOH 13 16 16 HOH HOH A . F 5 HOH 14 17 17 HOH HOH A . F 5 HOH 15 18 18 HOH HOH A . F 5 HOH 16 19 19 HOH HOH A . F 5 HOH 17 20 20 HOH HOH A . F 5 HOH 18 21 21 HOH HOH A . F 5 HOH 19 22 22 HOH HOH A . F 5 HOH 20 23 23 HOH HOH A . F 5 HOH 21 24 24 HOH HOH A . F 5 HOH 22 25 25 HOH HOH A . F 5 HOH 23 26 26 HOH HOH A . F 5 HOH 24 27 27 HOH HOH A . F 5 HOH 25 28 28 HOH HOH A . F 5 HOH 26 29 29 HOH HOH A . F 5 HOH 27 30 30 HOH HOH A . F 5 HOH 28 31 31 HOH HOH A . F 5 HOH 29 32 32 HOH HOH A . F 5 HOH 30 33 33 HOH HOH A . F 5 HOH 31 34 34 HOH HOH A . F 5 HOH 32 35 35 HOH HOH A . F 5 HOH 33 36 36 HOH HOH A . F 5 HOH 34 37 37 HOH HOH A . F 5 HOH 35 39 39 HOH HOH A . F 5 HOH 36 40 40 HOH HOH A . F 5 HOH 37 41 41 HOH HOH A . F 5 HOH 38 42 42 HOH HOH A . F 5 HOH 39 43 43 HOH HOH A . F 5 HOH 40 45 45 HOH HOH A . F 5 HOH 41 46 46 HOH HOH A . F 5 HOH 42 47 47 HOH HOH A . F 5 HOH 43 48 48 HOH HOH A . F 5 HOH 44 49 49 HOH HOH A . F 5 HOH 45 50 50 HOH HOH A . F 5 HOH 46 51 51 HOH HOH A . F 5 HOH 47 52 52 HOH HOH A . F 5 HOH 48 53 53 HOH HOH A . F 5 HOH 49 54 54 HOH HOH A . F 5 HOH 50 55 55 HOH HOH A . F 5 HOH 51 56 56 HOH HOH A . F 5 HOH 52 57 57 HOH HOH A . F 5 HOH 53 58 58 HOH HOH A . F 5 HOH 54 59 59 HOH HOH A . F 5 HOH 55 60 60 HOH HOH A . F 5 HOH 56 61 61 HOH HOH A . F 5 HOH 57 62 62 HOH HOH A . F 5 HOH 58 63 63 HOH HOH A . F 5 HOH 59 64 64 HOH HOH A . F 5 HOH 60 65 65 HOH HOH A . F 5 HOH 61 66 66 HOH HOH A . F 5 HOH 62 67 67 HOH HOH A . F 5 HOH 63 68 68 HOH HOH A . F 5 HOH 64 69 69 HOH HOH A . F 5 HOH 65 70 70 HOH HOH A . F 5 HOH 66 71 71 HOH HOH A . F 5 HOH 67 72 72 HOH HOH A . F 5 HOH 68 73 73 HOH HOH A . F 5 HOH 69 74 74 HOH HOH A . F 5 HOH 70 75 75 HOH HOH A . F 5 HOH 71 76 76 HOH HOH A . F 5 HOH 72 77 77 HOH HOH A . F 5 HOH 73 78 78 HOH HOH A . F 5 HOH 74 79 79 HOH HOH A . F 5 HOH 75 80 80 HOH HOH A . F 5 HOH 76 81 81 HOH HOH A . F 5 HOH 77 82 82 HOH HOH A . F 5 HOH 78 84 84 HOH HOH A . F 5 HOH 79 85 85 HOH HOH A . F 5 HOH 80 86 86 HOH HOH A . F 5 HOH 81 87 87 HOH HOH A . F 5 HOH 82 88 88 HOH HOH A . F 5 HOH 83 89 89 HOH HOH A . F 5 HOH 84 90 90 HOH HOH A . F 5 HOH 85 91 91 HOH HOH A . F 5 HOH 86 92 92 HOH HOH A . F 5 HOH 87 93 93 HOH HOH A . F 5 HOH 88 94 94 HOH HOH A . F 5 HOH 89 95 95 HOH HOH A . F 5 HOH 90 96 96 HOH HOH A . F 5 HOH 91 97 97 HOH HOH A . F 5 HOH 92 98 98 HOH HOH A . F 5 HOH 93 99 99 HOH HOH A . F 5 HOH 94 100 100 HOH HOH A . F 5 HOH 95 101 101 HOH HOH A . F 5 HOH 96 102 102 HOH HOH A . F 5 HOH 97 103 103 HOH HOH A . F 5 HOH 98 104 104 HOH HOH A . F 5 HOH 99 105 105 HOH HOH A . F 5 HOH 100 106 106 HOH HOH A . F 5 HOH 101 107 107 HOH HOH A . F 5 HOH 102 109 109 HOH HOH A . F 5 HOH 103 110 110 HOH HOH A . F 5 HOH 104 111 111 HOH HOH A . F 5 HOH 105 112 112 HOH HOH A . F 5 HOH 106 113 113 HOH HOH A . F 5 HOH 107 114 114 HOH HOH A . F 5 HOH 108 116 116 HOH HOH A . F 5 HOH 109 117 117 HOH HOH A . F 5 HOH 110 118 118 HOH HOH A . F 5 HOH 111 119 119 HOH HOH A . F 5 HOH 112 120 120 HOH HOH A . F 5 HOH 113 121 121 HOH HOH A . F 5 HOH 114 122 122 HOH HOH A . F 5 HOH 115 604 3 HOH HOH A . G 5 HOH 1 7 2 HOH HOH B . G 5 HOH 2 8 5 HOH HOH B . G 5 HOH 3 38 38 HOH HOH B . G 5 HOH 4 44 44 HOH HOH B . G 5 HOH 5 83 83 HOH HOH B . G 5 HOH 6 108 108 HOH HOH B . G 5 HOH 7 115 115 HOH HOH B . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id TPO _pdbx_struct_mod_residue.label_seq_id 6 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id TPO _pdbx_struct_mod_residue.auth_seq_id 5 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id THR _pdbx_struct_mod_residue.details PHOSPHOTHREONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1700 ? 1 MORE -10 ? 1 'SSA (A^2)' 11040 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-06-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-11-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Non-polymer description' 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 3 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 3 MOLREP . ? program 'Alexei Vaguine' alexei@ysbl.york.ac.uk phasing http://www.ccp4.ac.uk/dist/html/molrep.html Fortran_77 ? 4 REFMAC . ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 5 PDB_EXTRACT 3.005 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 6 HKL-2000 . ? ? ? ? 'data collection' ? ? ? 7 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 8 HKL-2000 . ? ? ? ? 'data scaling' ? ? ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 470 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 60 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.12 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 463 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 463 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 463 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 132.76 _pdbx_validate_rmsd_angle.angle_target_value 115.30 _pdbx_validate_rmsd_angle.angle_deviation 17.46 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.30 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 396 ? ? -116.67 56.24 2 1 TYR A 421 ? ? -130.09 -52.94 3 1 HIS A 468 ? ? -119.47 75.02 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 388 ? NZ ? A LYS 22 NZ 2 1 Y 1 A GLU 391 ? OE1 ? A GLU 25 OE1 3 1 Y 1 A GLU 391 ? OE2 ? A GLU 25 OE2 4 1 Y 1 A GLU 398 ? OE1 ? A GLU 32 OE1 5 1 Y 1 A GLU 398 ? OE2 ? A GLU 32 OE2 6 1 Y 1 A ASP 419 ? OD1 ? A ASP 53 OD1 7 1 Y 1 A ASP 419 ? OD2 ? A ASP 53 OD2 8 1 Y 1 A LYS 420 ? CE ? A LYS 54 CE 9 1 Y 1 A LYS 420 ? NZ ? A LYS 54 NZ 10 1 Y 1 A ARG 456 ? CZ ? A ARG 90 CZ 11 1 Y 1 A ARG 456 ? NH1 ? A ARG 90 NH1 12 1 Y 1 A ARG 456 ? NH2 ? A ARG 90 NH2 13 1 Y 1 A GLU 488 ? CD ? A GLU 122 CD 14 1 Y 1 A GLU 488 ? OE1 ? A GLU 122 OE1 15 1 Y 1 A GLU 488 ? OE2 ? A GLU 122 OE2 16 1 Y 1 A GLU 504 ? CG ? A GLU 138 CG 17 1 Y 1 A GLU 504 ? CD ? A GLU 138 CD 18 1 Y 1 A GLU 504 ? OE1 ? A GLU 138 OE1 19 1 Y 1 A GLU 504 ? OE2 ? A GLU 138 OE2 20 1 Y 1 A ARG 518 ? CD ? A ARG 152 CD 21 1 Y 1 A ARG 518 ? NE ? A ARG 152 NE 22 1 Y 1 A ARG 518 ? CZ ? A ARG 152 CZ 23 1 Y 1 A ARG 518 ? NH1 ? A ARG 152 NH1 24 1 Y 1 A ARG 518 ? NH2 ? A ARG 152 NH2 25 1 Y 1 A GLN 536 ? OE1 ? A GLN 170 OE1 26 1 Y 1 A GLN 536 ? NE2 ? A GLN 170 NE2 27 1 Y 1 A GLU 555 ? CD ? A GLU 189 CD 28 1 Y 1 A GLU 555 ? OE1 ? A GLU 189 OE1 29 1 Y 1 A GLU 555 ? OE2 ? A GLU 189 OE2 30 1 Y 1 A ARG 557 ? CZ ? A ARG 191 CZ 31 1 Y 1 A ARG 557 ? NH1 ? A ARG 191 NH1 32 1 Y 1 A ARG 557 ? NH2 ? A ARG 191 NH2 33 1 Y 1 A LYS 574 ? CG ? A LYS 208 CG 34 1 Y 1 A LYS 574 ? CD ? A LYS 208 CD 35 1 Y 1 A LYS 574 ? CE ? A LYS 208 CE 36 1 Y 1 A LYS 574 ? NZ ? A LYS 208 NZ 37 1 Y 1 A GLU 575 ? CD ? A GLU 209 CD 38 1 Y 1 A GLU 575 ? OE1 ? A GLU 209 OE1 39 1 Y 1 A GLU 575 ? OE2 ? A GLU 209 OE2 40 1 Y 1 A ARG 594 ? CZ ? A ARG 228 CZ 41 1 Y 1 A ARG 594 ? NH1 ? A ARG 228 NH1 42 1 Y 1 A ARG 594 ? NH2 ? A ARG 228 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 367 ? A GLY 1 2 1 Y 1 A GLU 368 ? A GLU 2 3 1 Y 1 A VAL 369 ? A VAL 3 4 1 Y 1 A VAL 370 ? A VAL 4 5 1 Y 1 A SER 595 ? A SER 229 6 1 Y 1 A ALA 596 ? A ALA 230 7 1 Y 1 A SER 597 ? A SER 231 8 1 Y 1 A ASN 598 ? A ASN 232 9 1 Y 1 A ARG 599 ? A ARG 233 10 1 Y 1 A LEU 600 ? A LEU 234 11 1 Y 1 A LYS 601 ? A LYS 235 12 1 Y 1 A ALA 602 ? A ALA 236 13 1 Y 1 A SER 603 ? A SER 237 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 GLYCEROL GOL 4 1,2-ETHANEDIOL EDO 5 water HOH #