data_3HNX # _entry.id 3HNX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.284 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3HNX RCSB RCSB053366 WWPDB D_1000053366 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2KJL 'Solution structures of a designed Cyanovirin-N homolog lectin; LKAMG' unspecified PDB 3HNU 'Crystal structure of a designed Cyanovirin-N homolog lectin; LKAMG in P21 space group' unspecified PDB 3HP8 'Crystal structure of a designed Cyanovirin-N homolog lectin; LKAMG, bound to sucrose' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3HNX _pdbx_database_status.recvd_initial_deposition_date 2009-06-01 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Koharudin, L.M.I.' 1 'Furey, W.' 2 'Gronenborn, A.M.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'A designed chimeric cyanovirin-N homolog lectin: Structure and molecular basis of sucrose binding.' Proteins 77 904 915 2009 PSFGEY US 0887-3585 0867 ? 19639634 10.1002/prot.22514 1 'The Evolutionarily Conserved Family of Cyanovirin-N Homologs: Structures and Carbohydrate Specificity' Structure 16 570 584 2008 STRUE6 UK 0969-2126 2005 ? 18400178 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Koharudin, L.M.' 1 primary 'Furey, W.' 2 primary 'Gronenborn, A.M.' 3 1 'Koharudin, L.M.I.' 4 1 'Viscomi, A.' 5 1 'Jee, J.' 6 1 'Ottonello, S.' 7 1 'Gronenborn, A.M.' 8 # _cell.entry_id 3HNX _cell.length_a 45.506 _cell.length_b 46.204 _cell.length_c 50.377 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3HNX _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cyanovirin-N-like protein' 12386.461 1 ? ? ? ? 2 water nat water 18.015 151 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMSYADSSRNAVLTNGGRTLRAECRNADGNWVTSELDLDTIIGNNDGHFQWGGQNFTETAEDIRFHPKEGAAEQPILR ARLRDCNGEFHDRDVNLNRIQNVNGRLVFQ ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMSYADSSRNAVLTNGGRTLRAECRNADGNWVTSELDLDTIIGNNDGHFQWGGQNFTETAEDIRFHPKEGAAEQPILR ARLRDCNGEFHDRDVNLNRIQNVNGRLVFQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 SER n 1 6 TYR n 1 7 ALA n 1 8 ASP n 1 9 SER n 1 10 SER n 1 11 ARG n 1 12 ASN n 1 13 ALA n 1 14 VAL n 1 15 LEU n 1 16 THR n 1 17 ASN n 1 18 GLY n 1 19 GLY n 1 20 ARG n 1 21 THR n 1 22 LEU n 1 23 ARG n 1 24 ALA n 1 25 GLU n 1 26 CYS n 1 27 ARG n 1 28 ASN n 1 29 ALA n 1 30 ASP n 1 31 GLY n 1 32 ASN n 1 33 TRP n 1 34 VAL n 1 35 THR n 1 36 SER n 1 37 GLU n 1 38 LEU n 1 39 ASP n 1 40 LEU n 1 41 ASP n 1 42 THR n 1 43 ILE n 1 44 ILE n 1 45 GLY n 1 46 ASN n 1 47 ASN n 1 48 ASP n 1 49 GLY n 1 50 HIS n 1 51 PHE n 1 52 GLN n 1 53 TRP n 1 54 GLY n 1 55 GLY n 1 56 GLN n 1 57 ASN n 1 58 PHE n 1 59 THR n 1 60 GLU n 1 61 THR n 1 62 ALA n 1 63 GLU n 1 64 ASP n 1 65 ILE n 1 66 ARG n 1 67 PHE n 1 68 HIS n 1 69 PRO n 1 70 LYS n 1 71 GLU n 1 72 GLY n 1 73 ALA n 1 74 ALA n 1 75 GLU n 1 76 GLN n 1 77 PRO n 1 78 ILE n 1 79 LEU n 1 80 ARG n 1 81 ALA n 1 82 ARG n 1 83 LEU n 1 84 ARG n 1 85 ASP n 1 86 CYS n 1 87 ASN n 1 88 GLY n 1 89 GLU n 1 90 PHE n 1 91 HIS n 1 92 ASP n 1 93 ARG n 1 94 ASP n 1 95 VAL n 1 96 ASN n 1 97 LEU n 1 98 ASN n 1 99 ARG n 1 100 ILE n 1 101 GLN n 1 102 ASN n 1 103 VAL n 1 104 ASN n 1 105 GLY n 1 106 ARG n 1 107 LEU n 1 108 VAL n 1 109 PHE n 1 110 GLN n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? 4 42 ? ? ? ? ? ? ? ? ? 'Tuber borchii' 42251 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET15b ? ? 1 2 sample ? 43 96 ? ? ? ? ? ? ? ? ? 'Neurospora crassa' 5141 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET15b ? ? 1 3 sample ? 97 110 ? ? ? ? ? ? ? ? ? 'Tuber borchii' 42251 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET15b ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP Q5MK11_TUBBO Q5MK11 1 MSYADSSRNAVLTNGGRTLRAECRNADGNWVTSELDLDT 1 ? 2 UNP Q7S6U4_NEUCR Q7S6U4 1 IIGNNDGHFQWGGQNFTETAEDIRFHPKEGAAEQPILRARLRDCNGEFHDRDVN 42 ? 3 UNP Q5MK11_TUBBO Q5MK11 1 LNRIQNVNGRLVFQ 90 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 3HNX A 4 ? 42 ? Q5MK11 1 ? 39 ? 1 39 2 2 3HNX A 43 ? 96 ? Q7S6U4 42 ? 95 ? 40 93 3 3 3HNX A 97 ? 110 ? Q5MK11 90 ? 103 ? 94 107 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3HNX GLY A 1 ? UNP Q5MK11 ? ? 'EXPRESSION TAG' -2 1 1 3HNX SER A 2 ? UNP Q5MK11 ? ? 'EXPRESSION TAG' -1 2 1 3HNX HIS A 3 ? UNP Q5MK11 ? ? 'EXPRESSION TAG' 0 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3HNX _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.14 _exptl_crystal.density_percent_sol 42.46 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;50 mg/ml protein concentration in 0.2 M Li2SO4, 0.1 M Tris-HCl (pH 8.5), and 30% PEG 4000 at protein to mother liquor ratio of 8 to 1, VAPOR DIFFUSION, SITTING DROP, temperature 277K ; # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'RIGAKU SATURN 944' _diffrn_detector.pdbx_collection_date 2006-10-17 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'OSMIC MIRRORS' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU FR-E SUPERBRIGHT' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 3HNX _reflns.observed_criterion_sigma_I 3.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 27.260 _reflns.d_resolution_high 1.350 _reflns.number_obs 23394 _reflns.number_all ? _reflns.percent_possible_obs 97.7 _reflns.pdbx_Rmerge_I_obs 0.03900 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 40.7000 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 13.320 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.35 _reflns_shell.d_res_low 1.40 _reflns_shell.percent_possible_all 77.3 _reflns_shell.Rmerge_I_obs 0.33700 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.700 _reflns_shell.pdbx_redundancy 2.94 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 3HNX _refine.ls_number_reflns_obs 21673 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 27.26 _refine.ls_d_res_high 1.37 _refine.ls_percent_reflns_obs 99.5 _refine.ls_R_factor_obs 0.170 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.168 _refine.ls_R_factor_R_free 0.210 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.100 _refine.ls_number_reflns_R_free 1168 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.970 _refine.correlation_coeff_Fo_to_Fc_free 0.951 _refine.B_iso_mean 18.02 _refine.aniso_B[1][1] -0.21000 _refine.aniso_B[2][2] -0.31000 _refine.aniso_B[3][3] 0.53000 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] -0.00000 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 3HNU _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model Anisotropic _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.071 _refine.pdbx_overall_ESU_R_Free 0.066 _refine.overall_SU_ML 0.031 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 1.643 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 932 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 151 _refine_hist.number_atoms_total 1083 _refine_hist.d_res_high 1.37 _refine_hist.d_res_low 27.26 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.007 0.021 ? 955 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.090 1.905 ? 1302 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.984 5.000 ? 122 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 31.300 23.607 ? 61 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 11.664 15.000 ? 154 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 21.589 15.000 ? 13 'X-RAY DIFFRACTION' ? r_chiral_restr 0.099 0.200 ? 133 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.012 0.020 ? 799 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 2.097 1.500 ? 578 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 3.135 2.000 ? 933 'X-RAY DIFFRACTION' ? r_scbond_it 4.038 3.000 ? 377 'X-RAY DIFFRACTION' ? r_scangle_it 5.815 4.500 ? 369 'X-RAY DIFFRACTION' ? r_rigid_bond_restr 2.271 3.000 ? 955 'X-RAY DIFFRACTION' ? r_sphericity_free 9.944 3.000 ? 154 'X-RAY DIFFRACTION' ? r_sphericity_bonded 6.211 3.000 ? 932 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.37 _refine_ls_shell.d_res_low 1.41 _refine_ls_shell.number_reflns_R_work 1504 _refine_ls_shell.R_factor_R_work 0.3960 _refine_ls_shell.percent_reflns_obs 95.32 _refine_ls_shell.R_factor_R_free 0.4440 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 85 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 3HNX _struct.title 'Crystal structure of a designed Cyanovirin-N homolog lectin; LKAMG in P212121 space group' _struct.pdbx_descriptor 'Cyanovirin-N-like protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3HNX _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' _struct_keywords.text 'Cyanovirin-N, CVNH, lectin, SUGAR BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 5 ? ASP A 8 ? SER A 2 ASP A 5 5 ? 4 HELX_P HELX_P2 2 ASN A 57 ? GLU A 60 ? ASN A 54 GLU A 57 5 ? 4 HELX_P HELX_P3 3 ASN A 98 ? ILE A 100 ? ASN A 95 ILE A 97 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? C ? 3 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 10 ? THR A 16 ? SER A 7 THR A 13 A 2 THR A 21 ? ARG A 27 ? THR A 18 ARG A 24 A 3 TRP A 33 ? ASP A 39 ? TRP A 30 ASP A 36 B 1 ILE A 44 ? ASN A 47 ? ILE A 41 ASN A 44 B 2 HIS A 50 ? TRP A 53 ? HIS A 47 TRP A 50 C 1 ALA A 62 ? GLU A 71 ? ALA A 59 GLU A 68 C 2 GLN A 76 ? ARG A 84 ? GLN A 73 ARG A 81 C 3 PHE A 90 ? ASN A 96 ? PHE A 87 ASN A 93 D 1 GLN A 101 ? VAL A 103 ? GLN A 98 VAL A 100 D 2 ARG A 106 ? VAL A 108 ? ARG A 103 VAL A 105 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 14 ? N VAL A 11 O ARG A 23 ? O ARG A 20 A 2 3 N CYS A 26 ? N CYS A 23 O VAL A 34 ? O VAL A 31 B 1 2 N ASN A 47 ? N ASN A 44 O HIS A 50 ? O HIS A 47 C 1 2 N ARG A 66 ? N ARG A 63 O ARG A 80 ? O ARG A 77 C 2 3 N LEU A 79 ? N LEU A 76 O VAL A 95 ? O VAL A 92 D 1 2 N GLN A 101 ? N GLN A 98 O VAL A 108 ? O VAL A 105 # _database_PDB_matrix.entry_id 3HNX _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3HNX _atom_sites.fract_transf_matrix[1][1] 0.021975 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021643 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019850 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 0 HIS HIS A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 SER 5 2 2 SER SER A . n A 1 6 TYR 6 3 3 TYR TYR A . n A 1 7 ALA 7 4 4 ALA ALA A . n A 1 8 ASP 8 5 5 ASP ASP A . n A 1 9 SER 9 6 6 SER SER A . n A 1 10 SER 10 7 7 SER SER A . n A 1 11 ARG 11 8 8 ARG ARG A . n A 1 12 ASN 12 9 9 ASN ASN A . n A 1 13 ALA 13 10 10 ALA ALA A . n A 1 14 VAL 14 11 11 VAL VAL A . n A 1 15 LEU 15 12 12 LEU LEU A . n A 1 16 THR 16 13 13 THR THR A . n A 1 17 ASN 17 14 14 ASN ASN A . n A 1 18 GLY 18 15 15 GLY GLY A . n A 1 19 GLY 19 16 16 GLY GLY A . n A 1 20 ARG 20 17 17 ARG ARG A . n A 1 21 THR 21 18 18 THR THR A . n A 1 22 LEU 22 19 19 LEU LEU A . n A 1 23 ARG 23 20 20 ARG ARG A . n A 1 24 ALA 24 21 21 ALA ALA A . n A 1 25 GLU 25 22 22 GLU GLU A . n A 1 26 CYS 26 23 23 CYS CYS A . n A 1 27 ARG 27 24 24 ARG ARG A . n A 1 28 ASN 28 25 25 ASN ASN A . n A 1 29 ALA 29 26 26 ALA ALA A . n A 1 30 ASP 30 27 27 ASP ASP A . n A 1 31 GLY 31 28 28 GLY GLY A . n A 1 32 ASN 32 29 29 ASN ASN A . n A 1 33 TRP 33 30 30 TRP TRP A . n A 1 34 VAL 34 31 31 VAL VAL A . n A 1 35 THR 35 32 32 THR THR A . n A 1 36 SER 36 33 33 SER SER A . n A 1 37 GLU 37 34 34 GLU GLU A . n A 1 38 LEU 38 35 35 LEU LEU A . n A 1 39 ASP 39 36 36 ASP ASP A . n A 1 40 LEU 40 37 37 LEU LEU A . n A 1 41 ASP 41 38 38 ASP ASP A . n A 1 42 THR 42 39 39 THR THR A . n A 1 43 ILE 43 40 40 ILE ILE A . n A 1 44 ILE 44 41 41 ILE ILE A . n A 1 45 GLY 45 42 42 GLY GLY A . n A 1 46 ASN 46 43 43 ASN ASN A . n A 1 47 ASN 47 44 44 ASN ASN A . n A 1 48 ASP 48 45 45 ASP ASP A . n A 1 49 GLY 49 46 46 GLY GLY A . n A 1 50 HIS 50 47 47 HIS HIS A . n A 1 51 PHE 51 48 48 PHE PHE A . n A 1 52 GLN 52 49 49 GLN GLN A . n A 1 53 TRP 53 50 50 TRP TRP A . n A 1 54 GLY 54 51 51 GLY GLY A . n A 1 55 GLY 55 52 52 GLY GLY A . n A 1 56 GLN 56 53 53 GLN GLN A . n A 1 57 ASN 57 54 54 ASN ASN A . n A 1 58 PHE 58 55 55 PHE PHE A . n A 1 59 THR 59 56 56 THR THR A . n A 1 60 GLU 60 57 57 GLU GLU A . n A 1 61 THR 61 58 58 THR THR A . n A 1 62 ALA 62 59 59 ALA ALA A . n A 1 63 GLU 63 60 60 GLU GLU A . n A 1 64 ASP 64 61 61 ASP ASP A . n A 1 65 ILE 65 62 62 ILE ILE A . n A 1 66 ARG 66 63 63 ARG ARG A . n A 1 67 PHE 67 64 64 PHE PHE A . n A 1 68 HIS 68 65 65 HIS HIS A . n A 1 69 PRO 69 66 66 PRO PRO A . n A 1 70 LYS 70 67 67 LYS LYS A . n A 1 71 GLU 71 68 68 GLU GLU A . n A 1 72 GLY 72 69 69 GLY GLY A . n A 1 73 ALA 73 70 70 ALA ALA A . n A 1 74 ALA 74 71 71 ALA ALA A . n A 1 75 GLU 75 72 72 GLU GLU A . n A 1 76 GLN 76 73 73 GLN GLN A . n A 1 77 PRO 77 74 74 PRO PRO A . n A 1 78 ILE 78 75 75 ILE ILE A . n A 1 79 LEU 79 76 76 LEU LEU A . n A 1 80 ARG 80 77 77 ARG ARG A . n A 1 81 ALA 81 78 78 ALA ALA A . n A 1 82 ARG 82 79 79 ARG ARG A . n A 1 83 LEU 83 80 80 LEU LEU A . n A 1 84 ARG 84 81 81 ARG ARG A . n A 1 85 ASP 85 82 82 ASP ASP A . n A 1 86 CYS 86 83 83 CYS CYS A . n A 1 87 ASN 87 84 84 ASN ASN A . n A 1 88 GLY 88 85 85 GLY GLY A . n A 1 89 GLU 89 86 86 GLU GLU A . n A 1 90 PHE 90 87 87 PHE PHE A . n A 1 91 HIS 91 88 88 HIS HIS A . n A 1 92 ASP 92 89 89 ASP ASP A . n A 1 93 ARG 93 90 90 ARG ARG A . n A 1 94 ASP 94 91 91 ASP ASP A . n A 1 95 VAL 95 92 92 VAL VAL A . n A 1 96 ASN 96 93 93 ASN ASN A . n A 1 97 LEU 97 94 94 LEU LEU A . n A 1 98 ASN 98 95 95 ASN ASN A . n A 1 99 ARG 99 96 96 ARG ARG A . n A 1 100 ILE 100 97 97 ILE ILE A . n A 1 101 GLN 101 98 98 GLN GLN A . n A 1 102 ASN 102 99 99 ASN ASN A . n A 1 103 VAL 103 100 100 VAL VAL A . n A 1 104 ASN 104 101 101 ASN ASN A . n A 1 105 GLY 105 102 102 GLY GLY A . n A 1 106 ARG 106 103 103 ARG ARG A . n A 1 107 LEU 107 104 104 LEU LEU A . n A 1 108 VAL 108 105 105 VAL VAL A . n A 1 109 PHE 109 106 106 PHE PHE A . n A 1 110 GLN 110 107 107 GLN GLN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 108 108 HOH HOH A . B 2 HOH 2 109 109 HOH HOH A . B 2 HOH 3 110 110 HOH HOH A . B 2 HOH 4 111 111 HOH HOH A . B 2 HOH 5 112 112 HOH HOH A . B 2 HOH 6 113 113 HOH HOH A . B 2 HOH 7 114 114 HOH HOH A . B 2 HOH 8 115 115 HOH HOH A . B 2 HOH 9 116 116 HOH HOH A . B 2 HOH 10 117 117 HOH HOH A . B 2 HOH 11 118 118 HOH HOH A . B 2 HOH 12 119 119 HOH HOH A . B 2 HOH 13 120 120 HOH HOH A . B 2 HOH 14 121 121 HOH HOH A . B 2 HOH 15 122 122 HOH HOH A . B 2 HOH 16 123 123 HOH HOH A . B 2 HOH 17 124 124 HOH HOH A . B 2 HOH 18 125 125 HOH HOH A . B 2 HOH 19 126 126 HOH HOH A . B 2 HOH 20 127 127 HOH HOH A . B 2 HOH 21 128 128 HOH HOH A . B 2 HOH 22 129 129 HOH HOH A . B 2 HOH 23 130 130 HOH HOH A . B 2 HOH 24 131 131 HOH HOH A . B 2 HOH 25 133 133 HOH HOH A . B 2 HOH 26 134 134 HOH HOH A . B 2 HOH 27 135 135 HOH HOH A . B 2 HOH 28 136 136 HOH HOH A . B 2 HOH 29 137 137 HOH HOH A . B 2 HOH 30 138 138 HOH HOH A . B 2 HOH 31 139 139 HOH HOH A . B 2 HOH 32 140 140 HOH HOH A . B 2 HOH 33 141 141 HOH HOH A . B 2 HOH 34 143 143 HOH HOH A . B 2 HOH 35 144 144 HOH HOH A . B 2 HOH 36 145 145 HOH HOH A . B 2 HOH 37 146 146 HOH HOH A . B 2 HOH 38 147 147 HOH HOH A . B 2 HOH 39 148 148 HOH HOH A . B 2 HOH 40 149 149 HOH HOH A . B 2 HOH 41 150 150 HOH HOH A . B 2 HOH 42 151 151 HOH HOH A . B 2 HOH 43 152 152 HOH HOH A . B 2 HOH 44 154 154 HOH HOH A . B 2 HOH 45 155 155 HOH HOH A . B 2 HOH 46 156 156 HOH HOH A . B 2 HOH 47 157 157 HOH HOH A . B 2 HOH 48 158 158 HOH HOH A . B 2 HOH 49 159 159 HOH HOH A . B 2 HOH 50 160 160 HOH HOH A . B 2 HOH 51 161 161 HOH HOH A . B 2 HOH 52 162 162 HOH HOH A . B 2 HOH 53 163 163 HOH HOH A . B 2 HOH 54 164 164 HOH HOH A . B 2 HOH 55 165 165 HOH HOH A . B 2 HOH 56 166 166 HOH HOH A . B 2 HOH 57 167 167 HOH HOH A . B 2 HOH 58 168 168 HOH HOH A . B 2 HOH 59 169 169 HOH HOH A . B 2 HOH 60 170 170 HOH HOH A . B 2 HOH 61 171 171 HOH HOH A . B 2 HOH 62 172 172 HOH HOH A . B 2 HOH 63 173 173 HOH HOH A . B 2 HOH 64 174 174 HOH HOH A . B 2 HOH 65 175 175 HOH HOH A . B 2 HOH 66 176 176 HOH HOH A . B 2 HOH 67 177 177 HOH HOH A . B 2 HOH 68 178 178 HOH HOH A . B 2 HOH 69 179 179 HOH HOH A . B 2 HOH 70 180 180 HOH HOH A . B 2 HOH 71 181 181 HOH HOH A . B 2 HOH 72 182 182 HOH HOH A . B 2 HOH 73 183 183 HOH HOH A . B 2 HOH 74 184 184 HOH HOH A . B 2 HOH 75 185 185 HOH HOH A . B 2 HOH 76 186 186 HOH HOH A . B 2 HOH 77 187 187 HOH HOH A . B 2 HOH 78 188 188 HOH HOH A . B 2 HOH 79 189 189 HOH HOH A . B 2 HOH 80 190 190 HOH HOH A . B 2 HOH 81 191 191 HOH HOH A . B 2 HOH 82 192 192 HOH HOH A . B 2 HOH 83 193 193 HOH HOH A . B 2 HOH 84 194 194 HOH HOH A . B 2 HOH 85 195 195 HOH HOH A . B 2 HOH 86 196 196 HOH HOH A . B 2 HOH 87 197 197 HOH HOH A . B 2 HOH 88 198 198 HOH HOH A . B 2 HOH 89 199 199 HOH HOH A . B 2 HOH 90 200 200 HOH HOH A . B 2 HOH 91 201 201 HOH HOH A . B 2 HOH 92 202 202 HOH HOH A . B 2 HOH 93 203 203 HOH HOH A . B 2 HOH 94 204 204 HOH HOH A . B 2 HOH 95 205 205 HOH HOH A . B 2 HOH 96 206 206 HOH HOH A . B 2 HOH 97 207 207 HOH HOH A . B 2 HOH 98 208 208 HOH HOH A . B 2 HOH 99 209 209 HOH HOH A . B 2 HOH 100 210 210 HOH HOH A . B 2 HOH 101 211 211 HOH HOH A . B 2 HOH 102 212 212 HOH HOH A . B 2 HOH 103 213 213 HOH HOH A . B 2 HOH 104 214 214 HOH HOH A . B 2 HOH 105 215 215 HOH HOH A . B 2 HOH 106 216 216 HOH HOH A . B 2 HOH 107 217 217 HOH HOH A . B 2 HOH 108 218 218 HOH HOH A . B 2 HOH 109 219 219 HOH HOH A . B 2 HOH 110 220 220 HOH HOH A . B 2 HOH 111 221 221 HOH HOH A . B 2 HOH 112 222 222 HOH HOH A . B 2 HOH 113 223 223 HOH HOH A . B 2 HOH 114 224 224 HOH HOH A . B 2 HOH 115 225 225 HOH HOH A . B 2 HOH 116 226 226 HOH HOH A . B 2 HOH 117 227 227 HOH HOH A . B 2 HOH 118 228 228 HOH HOH A . B 2 HOH 119 229 229 HOH HOH A . B 2 HOH 120 230 230 HOH HOH A . B 2 HOH 121 231 231 HOH HOH A . B 2 HOH 122 232 232 HOH HOH A . B 2 HOH 123 233 233 HOH HOH A . B 2 HOH 124 234 234 HOH HOH A . B 2 HOH 125 235 235 HOH HOH A . B 2 HOH 126 236 236 HOH HOH A . B 2 HOH 127 237 237 HOH HOH A . B 2 HOH 128 238 238 HOH HOH A . B 2 HOH 129 239 239 HOH HOH A . B 2 HOH 130 240 240 HOH HOH A . B 2 HOH 131 241 241 HOH HOH A . B 2 HOH 132 242 242 HOH HOH A . B 2 HOH 133 243 243 HOH HOH A . B 2 HOH 134 244 244 HOH HOH A . B 2 HOH 135 245 245 HOH HOH A . B 2 HOH 136 246 246 HOH HOH A . B 2 HOH 137 247 247 HOH HOH A . B 2 HOH 138 248 248 HOH HOH A . B 2 HOH 139 249 249 HOH HOH A . B 2 HOH 140 250 250 HOH HOH A . B 2 HOH 141 251 251 HOH HOH A . B 2 HOH 142 252 252 HOH HOH A . B 2 HOH 143 253 253 HOH HOH A . B 2 HOH 144 254 254 HOH HOH A . B 2 HOH 145 255 255 HOH HOH A . B 2 HOH 146 256 256 HOH HOH A . B 2 HOH 147 257 257 HOH HOH A . B 2 HOH 148 258 258 HOH HOH A . B 2 HOH 149 259 259 HOH HOH A . B 2 HOH 150 260 260 HOH HOH A . B 2 HOH 151 261 261 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-06-23 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-08-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' 3 3 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' entity_src_gen 2 3 'Structure model' software # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal StructureStudio 'data collection' . ? 1 PHASER phasing . ? 2 REFMAC refinement 5.5.0044 ? 3 d*TREK 'data reduction' . ? 4 d*TREK 'data scaling' . ? 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 81 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 B _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 109 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.99 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 121 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 177 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_564 _pdbx_validate_symm_contact.dist 1.64 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 1 ? ? 67.69 117.29 2 1 SER A 6 ? ? -143.70 26.33 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #