data_3HVP # _entry.id 3HVP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3HVP WWPDB D_1000179010 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3HVP _pdbx_database_status.recvd_initial_deposition_date 1989-08-08 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wlodawer, A.' 1 'Jaskolski, M.' 2 'Miller, M.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Conserved folding in retroviral proteases: crystal structure of a synthetic HIV-1 protease.' Science 245 616 621 1989 SCIEAS US 0036-8075 0038 ? 2548279 ? 1 'Molecular Modeling of the HIV-1 Protease and its Substrate Binding Site' Science 243 928 ? 1989 SCIEAS US 0036-8075 0038 ? ? ? 2 'Crystal Structure of a Retroviral Protease Proves Relationship to Aspartic Protease Family' Nature 337 576 ? 1989 NATUAS UK 0028-0836 0006 ? ? ? 3 'Enzymatic Activity of a Synthetic 99 Residue Protein Corresponding to the Putative HIV-1 Protease' 'Cell(Cambridge,Mass.)' 54 363 ? 1988 CELLB5 US 0092-8674 0998 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Wlodawer, A.' 1 primary 'Miller, M.' 2 primary 'Jaskolski, M.' 3 primary 'Sathyanarayana, B.K.' 4 primary 'Baldwin, E.' 5 primary 'Weber, I.T.' 6 primary 'Selk, L.M.' 7 primary 'Clawson, L.' 8 primary 'Schneider, J.' 9 primary 'Kent, S.B.' 10 1 'Weber, I.T.' 11 1 'Miller, M.' 12 1 'Jaskolski, M.' 13 1 'Leis, J.' 14 1 'Skalka, A.M.' 15 1 'Wlodawer, A.' 16 2 'Miller, M.' 17 2 'Jaskolski, M.' 18 2 'Rao, J.K.M.' 19 2 'Leis, J.' 20 2 'Wlodawer, A.' 21 3 'Schneider, J.' 22 3 'Kent, S.B.H.' 23 # _cell.entry_id 3HVP _cell.length_a 50.240 _cell.length_b 50.240 _cell.length_c 106.560 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 3HVP _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'UNLIGANDED HIV-1 PROTEASE' _entity.formula_weight 10764.636 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEI(ABA)GHKAIGTVL VGPTPVNIIGRNLLTQIG(ABA)TLNF ; _entity_poly.pdbx_seq_one_letter_code_can ;PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEIAGHKAIGTVLVGPT PVNIIGRNLLTQIGATLNF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 GLN n 1 3 ILE n 1 4 THR n 1 5 LEU n 1 6 TRP n 1 7 GLN n 1 8 ARG n 1 9 PRO n 1 10 LEU n 1 11 VAL n 1 12 THR n 1 13 ILE n 1 14 ARG n 1 15 ILE n 1 16 GLY n 1 17 GLY n 1 18 GLN n 1 19 LEU n 1 20 LYS n 1 21 GLU n 1 22 ALA n 1 23 LEU n 1 24 LEU n 1 25 ASP n 1 26 THR n 1 27 GLY n 1 28 ALA n 1 29 ASP n 1 30 ASP n 1 31 THR n 1 32 VAL n 1 33 LEU n 1 34 GLU n 1 35 GLU n 1 36 MET n 1 37 ASN n 1 38 LEU n 1 39 PRO n 1 40 GLY n 1 41 LYS n 1 42 TRP n 1 43 LYS n 1 44 PRO n 1 45 LYS n 1 46 MET n 1 47 ILE n 1 48 GLY n 1 49 GLY n 1 50 ILE n 1 51 GLY n 1 52 GLY n 1 53 PHE n 1 54 ILE n 1 55 LYS n 1 56 VAL n 1 57 ARG n 1 58 GLN n 1 59 TYR n 1 60 ASP n 1 61 GLN n 1 62 ILE n 1 63 PRO n 1 64 VAL n 1 65 GLU n 1 66 ILE n 1 67 ABA n 1 68 GLY n 1 69 HIS n 1 70 LYS n 1 71 ALA n 1 72 ILE n 1 73 GLY n 1 74 THR n 1 75 VAL n 1 76 LEU n 1 77 VAL n 1 78 GLY n 1 79 PRO n 1 80 THR n 1 81 PRO n 1 82 VAL n 1 83 ASN n 1 84 ILE n 1 85 ILE n 1 86 GLY n 1 87 ARG n 1 88 ASN n 1 89 LEU n 1 90 LEU n 1 91 THR n 1 92 GLN n 1 93 ILE n 1 94 GLY n 1 95 ABA n 1 96 THR n 1 97 LEU n 1 98 ASN n 1 99 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Lentivirus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POL_HV1A2 _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P03369 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;FFREDLAFLQGKAREFSSEQTRANSPTRRELQVWGGENNSLSEAGADRQGTVSFNFPQITLWQRPLVTIRIGGQLKEALL DTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNFPISPI ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQ DFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMT KILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIM LPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHEVYYDPSKDL VAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKVSTESIVIWGKIPKFKLPIQKETWEAWWMEY WQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSIADTTNQKTELQAIHLA LQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVLFLNGI DKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKIILVAVHVASGYIE AEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNNELKKIIGQV RDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDNKDPLWKGPAKLLWKG EGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3HVP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 99 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03369 _struct_ref_seq.db_align_beg 57 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 155 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 99 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3HVP ABA A 67 ? UNP P03369 CYS 123 CONFLICT 67 1 1 3HVP ABA A 95 ? UNP P03369 CYS 151 CONFLICT 95 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ABA 'L-peptide linking' n 'ALPHA-AMINOBUTYRIC ACID' ? 'C4 H9 N O2' 103.120 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3HVP _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.12 _exptl_crystal.density_percent_sol 60.59 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _refine.entry_id 3HVP _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low ? _refine.ls_d_res_high 2.8 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.1840000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 758 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 758 _refine_hist.d_res_high 2.8 _refine_hist.d_res_low . # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.026 0.021 ? ? 'X-RAY DIFFRACTION' ? p_angle_d 0.076 0.035 ? ? 'X-RAY DIFFRACTION' ? p_angle_deg ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_d 0.097 0.058 ? ? 'X-RAY DIFFRACTION' ? p_hb_or_metal_coord ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcbond_it 1.336 1.000 ? ? 'X-RAY DIFFRACTION' ? p_mcangle_it 2.315 1.500 ? ? 'X-RAY DIFFRACTION' ? p_scbond_it 3.795 2.500 ? ? 'X-RAY DIFFRACTION' ? p_scangle_it 5.474 3.000 ? ? 'X-RAY DIFFRACTION' ? p_plane_restr 0.025 0.024 ? ? 'X-RAY DIFFRACTION' ? p_chiral_restr 0.264 0.160 ? ? 'X-RAY DIFFRACTION' ? p_singtor_nbd 0.271 0.300 ? ? 'X-RAY DIFFRACTION' ? p_multtor_nbd 0.297 0.300 ? ? 'X-RAY DIFFRACTION' ? p_xhyhbond_nbd 0.204 0.300 ? ? 'X-RAY DIFFRACTION' ? p_xyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_tor 4.4 3.9 ? ? 'X-RAY DIFFRACTION' ? p_staggered_tor 19.4 10.0 ? ? 'X-RAY DIFFRACTION' ? p_orthonormal_tor 28.1 40.0 ? ? 'X-RAY DIFFRACTION' ? p_transverse_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_special_tor ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 3HVP _struct.title 'CONSERVED FOLDING IN RETROVIRAL PROTEASES. CRYSTAL STRUCTURE OF A SYNTHETIC HIV-1 PROTEASE' _struct.pdbx_descriptor '(ABA67,95)-HIV-1 PROTEASE (SF2 ISOLATE)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3HVP _struct_keywords.pdbx_keywords 'HYDROLASE(ACID PROTEINASE)' _struct_keywords.text 'HYDROLASE(ACID PROTEINASE)' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ;THE ACTIVE ENZYME IS FORMED BY TWO CRYSTALLOGRAPHICALLY RELATED MOLECULES. TO GENERATE THE OTHER MOLECULE ONE MUST APPLY THE CRYSTALLOGRAPHIC TWO-FOLD (Y, X, -Z) TO THE COORDINATES IN THIS ENTRY. ; # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id H _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 86 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 94 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 86 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 94 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ILE 66 C ? ? ? 1_555 A ABA 67 N ? ? A ILE 66 A ABA 67 1_555 ? ? ? ? ? ? ? 1.309 ? covale2 covale ? ? A ABA 67 C ? ? ? 1_555 A GLY 68 N ? ? A ABA 67 A GLY 68 1_555 ? ? ? ? ? ? ? 1.346 ? covale3 covale ? ? A GLY 94 C ? ? ? 1_555 A ABA 95 N ? ? A GLY 94 A ABA 95 1_555 ? ? ? ? ? ? ? 1.314 ? covale4 covale ? ? A ABA 95 C ? ? ? 1_555 A THR 96 N ? ? A ABA 95 A THR 96 1_555 ? ? ? ? ? ? ? 1.297 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id COR _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense COR 1 2 ? anti-parallel COR 2 3 ? anti-parallel COR 3 4 ? parallel COR 4 5 ? anti-parallel COR 5 6 ? parallel COR 6 7 ? anti-parallel COR 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id COR 1 LYS A 43 ? GLY A 49 ? LYS A 43 GLY A 49 COR 2 GLY A 52 ? ILE A 66 ? GLY A 52 ILE A 66 COR 3 HIS A 69 ? GLY A 78 ? HIS A 69 GLY A 78 COR 4 THR A 31 ? GLU A 34 ? THR A 31 GLU A 34 COR 5 ASN A 83 ? ILE A 85 ? ASN A 83 ILE A 85 COR 6 GLN A 18 ? ASP A 25 ? GLN A 18 ASP A 25 COR 7 PRO A 9 ? ILE A 15 ? PRO A 9 ILE A 15 COR 8 GLU A 65 ? ILE A 66 ? GLU A 65 ILE A 66 # _struct_site.id DTG _struct_site.pdbx_evidence_code Unknown _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details ? # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 DTG 3 ASP A 25 ? ASP A 25 . ? 1_555 ? 2 DTG 3 THR A 26 ? THR A 26 . ? 1_555 ? 3 DTG 3 GLY A 27 ? GLY A 27 . ? 1_555 ? # _database_PDB_matrix.entry_id 3HVP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3HVP _atom_sites.fract_transf_matrix[1][1] 0.019904 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019904 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009384 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 TRP 6 6 6 TRP TRP A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ABA 67 67 67 ABA ABA A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ABA 95 95 95 ABA ABA A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 PHE 99 99 99 PHE PHE A . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A ABA 67 A ABA 67 ? ALA 'ALPHA-AMINOBUTYRIC ACID' 2 A ABA 95 A ABA 95 ? ALA 'ALPHA-AMINOBUTYRIC ACID' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3220 ? 1 MORE -16 ? 1 'SSA (A^2)' 10120 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1989-10-15 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' struct_conf 3 4 'Structure model' struct_conf_type # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # _software.name PROFFT _software.classification refinement _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # _pdbx_database_remark.id 700 _pdbx_database_remark.text ;SHEET THE DIMER INTERFACE IS COMPOSED OF INTERDIGITATED N- AND C-TERMINI FROM BOTH SUBUNITS FORMING A FOUR-STRANDED ANTIPARALLEL BETA-SHEET. BECAUSE OF LIMITATIONS IMPOSED BY THE PROTEIN DATA BANK FORMAT IT IS NOT POSSIBLE TO PRESENT THIS SHEET ON SHEET RECORDS. INSTEAD THIS SHEET IS SPECIFIED IN THIS REMARK. STRANDS 1 AND 3 ARE FROM THE MOLECULE IN THIS ENTRY AND STRANDS 2 AND 4 ARE FROM THE SYMMETRY RELATED MOLECULE. INT 4 PRO 1 THR 4 0 INT 4 THR 96 PHE 99 -1 INT 4 THR 96 PHE 99 -1 INT 4 PRO 1 THR 4 -1 ; # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 N _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLY _pdbx_validate_rmsd_bond.auth_seq_id_1 51 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CA _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLY _pdbx_validate_rmsd_bond.auth_seq_id_2 51 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.553 _pdbx_validate_rmsd_bond.bond_target_value 1.456 _pdbx_validate_rmsd_bond.bond_deviation 0.097 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.015 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 O A PRO 1 ? ? C A PRO 1 ? ? N A GLN 2 ? ? 138.88 122.70 16.18 1.60 Y 2 1 N A GLN 2 ? ? CA A GLN 2 ? ? CB A GLN 2 ? ? 124.66 110.60 14.06 1.80 N 3 1 CA A TRP 6 ? ? C A TRP 6 ? ? O A TRP 6 ? ? 134.27 120.10 14.17 2.10 N 4 1 OE1 A GLN 7 ? ? CD A GLN 7 ? ? NE2 A GLN 7 ? ? 135.92 121.90 14.02 2.30 N 5 1 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 115.64 120.30 -4.66 0.50 N 6 1 O A VAL 11 ? ? C A VAL 11 ? ? N A THR 12 ? ? 140.61 122.70 17.91 1.60 Y 7 1 CD A ARG 14 ? ? NE A ARG 14 ? ? CZ A ARG 14 ? ? 140.75 123.60 17.15 1.40 N 8 1 NE A ARG 14 ? ? CZ A ARG 14 ? ? NH1 A ARG 14 ? ? 127.85 120.30 7.55 0.50 N 9 1 NE A ARG 14 ? ? CZ A ARG 14 ? ? NH2 A ARG 14 ? ? 112.76 120.30 -7.54 0.50 N 10 1 CB A ASP 29 ? ? CG A ASP 29 ? ? OD1 A ASP 29 ? ? 127.86 118.30 9.56 0.90 N 11 1 CB A ASP 29 ? ? CG A ASP 29 ? ? OD2 A ASP 29 ? ? 109.14 118.30 -9.16 0.90 N 12 1 C A ASP 29 ? ? N A ASP 30 ? ? CA A ASP 30 ? ? 141.30 121.70 19.60 2.50 Y 13 1 N A ASP 30 ? ? CA A ASP 30 ? ? CB A ASP 30 ? ? 96.63 110.60 -13.97 1.80 N 14 1 CB A ASP 30 ? ? CG A ASP 30 ? ? OD1 A ASP 30 ? ? 132.87 118.30 14.57 0.90 N 15 1 CB A ASP 30 ? ? CG A ASP 30 ? ? OD2 A ASP 30 ? ? 103.04 118.30 -15.26 0.90 N 16 1 CA A VAL 32 ? ? CB A VAL 32 ? ? CG1 A VAL 32 ? ? 121.61 110.90 10.71 1.50 N 17 1 OE1 A GLU 35 ? ? CD A GLU 35 ? ? OE2 A GLU 35 ? ? 131.39 123.30 8.09 1.20 N 18 1 C A PRO 39 ? ? N A GLY 40 ? ? CA A GLY 40 ? ? 136.13 122.30 13.83 2.10 Y 19 1 N A GLY 40 ? ? CA A GLY 40 ? ? C A GLY 40 ? ? 134.30 113.10 21.20 2.50 N 20 1 CA A LYS 41 ? ? CB A LYS 41 ? ? CG A LYS 41 ? ? 129.10 113.40 15.70 2.20 N 21 1 CA A LYS 41 ? ? C A LYS 41 ? ? N A TRP 42 ? ? 104.00 117.20 -13.20 2.20 Y 22 1 N A TRP 42 ? ? CA A TRP 42 ? ? CB A TRP 42 ? ? 95.30 110.60 -15.30 1.80 N 23 1 CA A TRP 42 ? ? CB A TRP 42 ? ? CG A TRP 42 ? ? 130.87 113.70 17.17 1.90 N 24 1 CA A LYS 45 ? ? CB A LYS 45 ? ? CG A LYS 45 ? ? 132.91 113.40 19.51 2.20 N 25 1 CA A MET 46 ? ? CB A MET 46 ? ? CG A MET 46 ? ? 131.73 113.30 18.43 1.70 N 26 1 N A ILE 50 ? ? CA A ILE 50 ? ? CB A ILE 50 ? ? 125.60 110.80 14.80 2.30 N 27 1 O A ILE 50 ? ? C A ILE 50 ? ? N A GLY 51 ? ? 133.84 123.20 10.64 1.70 Y 28 1 N A GLY 51 ? ? CA A GLY 51 ? ? C A GLY 51 ? ? 96.39 113.10 -16.71 2.50 N 29 1 CB A PHE 53 ? ? CA A PHE 53 ? ? C A PHE 53 ? ? 122.89 110.40 12.49 2.00 N 30 1 CB A PHE 53 ? ? CG A PHE 53 ? ? CD1 A PHE 53 ? ? 116.58 120.80 -4.22 0.70 N 31 1 N A ILE 54 ? ? CA A ILE 54 ? ? CB A ILE 54 ? ? 94.38 110.80 -16.42 2.30 N 32 1 CA A ILE 54 ? ? CB A ILE 54 ? ? CG2 A ILE 54 ? ? 124.48 110.90 13.58 2.00 N 33 1 NE A ARG 57 ? ? CZ A ARG 57 ? ? NH2 A ARG 57 ? ? 116.59 120.30 -3.71 0.50 N 34 1 N A ASP 60 ? ? CA A ASP 60 ? ? C A ASP 60 ? ? 129.74 111.00 18.74 2.70 N 35 1 CA A ASP 60 ? ? C A ASP 60 ? ? N A GLN 61 ? ? 134.43 117.20 17.23 2.20 Y 36 1 N A GLN 61 ? ? CA A GLN 61 ? ? CB A GLN 61 ? ? 123.04 110.60 12.44 1.80 N 37 1 CA A VAL 64 ? ? C A VAL 64 ? ? O A VAL 64 ? ? 105.93 120.10 -14.17 2.10 N 38 1 CA A GLU 65 ? ? CB A GLU 65 ? ? CG A GLU 65 ? ? 133.70 113.40 20.30 2.20 N 39 1 OE1 A GLU 65 ? ? CD A GLU 65 ? ? OE2 A GLU 65 ? ? 114.71 123.30 -8.59 1.20 N 40 1 O A ILE 66 ? ? C A ILE 66 ? ? N A ABA 67 ? ? 132.53 122.70 9.83 1.60 Y 41 1 CB A ILE 72 ? ? CA A ILE 72 ? ? C A ILE 72 ? ? 129.44 111.60 17.84 2.00 N 42 1 CA A ILE 72 ? ? CB A ILE 72 ? ? CG2 A ILE 72 ? ? 123.32 110.90 12.42 2.00 N 43 1 N A VAL 75 ? ? CA A VAL 75 ? ? CB A VAL 75 ? ? 96.93 111.50 -14.57 2.20 N 44 1 CA A VAL 77 ? ? CB A VAL 77 ? ? CG2 A VAL 77 ? ? 126.26 110.90 15.36 1.50 N 45 1 O A VAL 82 ? ? C A VAL 82 ? ? N A ASN 83 ? ? 133.12 122.70 10.42 1.60 Y 46 1 CA A ILE 84 ? ? C A ILE 84 ? ? O A ILE 84 ? ? 101.98 120.10 -18.12 2.10 N 47 1 O A ILE 84 ? ? C A ILE 84 ? ? N A ILE 85 ? ? 140.21 122.70 17.51 1.60 Y 48 1 CA A GLN 92 ? ? C A GLN 92 ? ? O A GLN 92 ? ? 104.90 120.10 -15.20 2.10 N 49 1 O A ABA 95 ? ? C A ABA 95 ? ? N A THR 96 ? ? 133.29 122.70 10.59 1.60 Y 50 1 O A LEU 97 ? ? C A LEU 97 ? ? N A ASN 98 ? ? 133.27 122.70 10.57 1.60 Y 51 1 CA A ASN 98 ? ? CB A ASN 98 ? ? CG A ASN 98 ? ? 97.95 113.40 -15.45 2.20 N 52 1 N A ASN 98 ? ? CA A ASN 98 ? ? C A ASN 98 ? ? 127.29 111.00 16.29 2.70 N 53 1 CA A PHE 99 ? ? C A PHE 99 ? ? O A PHE 99 ? ? 101.06 120.10 -19.04 2.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 8 ? ? -16.96 125.90 2 1 PRO A 9 ? ? -65.45 70.69 3 1 LYS A 20 ? ? 160.85 176.95 4 1 ASN A 37 ? ? -100.60 78.84 5 1 PRO A 39 ? ? -55.84 -110.50 6 1 ILE A 50 ? ? 44.74 93.43 7 1 GLN A 61 ? ? -147.30 20.76 8 1 ABA A 67 ? ? 27.63 60.27 9 1 PRO A 79 ? ? -62.37 55.86 10 1 THR A 91 ? ? -27.48 -45.74 11 1 ILE A 93 ? ? -55.30 0.21 #