data_3HXI # _entry.id 3HXI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3HXI RCSB RCSB053703 WWPDB D_1000053703 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3HXG _pdbx_database_related.details 'Crystal structure of Schistsome eIF4E complexed with m7GpppA and 4E-BP' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3HXI _pdbx_database_status.recvd_initial_deposition_date 2009-06-20 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, W.' 1 'Zhao, R.' 2 'Jones, D.N.M.' 3 'Davis, R.E.' 4 # _citation.id primary _citation.title 'Structural insights into parasite EIF4E binding specificity for m7G and m2,2,7G mRNA cap.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 284 _citation.page_first 31336 _citation.page_last 31349 _citation.year 2009 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19710013 _citation.pdbx_database_id_DOI 10.1074/jbc.M109.049858 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Liu, W.' 1 primary 'Zhao, R.' 2 primary 'McFarland, C.' 3 primary 'Kieft, J.' 4 primary 'Niedzwiecka, A.' 5 primary 'Jankowska-Anyszka, M.' 6 primary 'Stepinski, J.' 7 primary 'Darzynkiewicz, E.' 8 primary 'Jones, D.N.' 9 primary 'Davis, R.E.' 10 # _cell.entry_id 3HXI _cell.length_a 45.311 _cell.length_b 125.330 _cell.length_c 37.330 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3HXI _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Eukaryotic Translation Initiation 4E' 22237.830 1 ? ? ? ? 2 polymer syn 'Eukaryotic translation initiation factor 4E-binding protein 1' 2432.823 1 ? ? 'residues 51-67' ? 3 non-polymer syn "7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE" 803.440 1 ? ? ? ? 4 water nat water 18.015 112 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name 'eIF4E-binding protein 1, 4E-BP1, Phosphorylated heat- and acid-stable protein regulated by insulin 1, PHAS-I' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GPLGSPEFPHPLQDSWSYYLFQFRKALDWDECLEKVATFSTIEDFWSVLTHTVRPREITYGKDLYMFKSDIMPKWEDPKN ENGGRWLINVTARQDVDFLWDELLMLLIGSDWDTDEEDRQICGAVFQPRSRGSKLSVWLTSDNEEETILSIGRRIKERLE LEDTIYFQPVSDQRSQTRGSDICTGKYEI ; ;GPLGSPEFPHPLQDSWSYYLFQFRKALDWDECLEKVATFSTIEDFWSVLTHTVRPREITYGKDLYMFKSDIMPKWEDPKN ENGGRWLINVTARQDVDFLWDELLMLLIGSDWDTDEEDRQICGAVFQPRSRGSKLSVWLTSDNEEETILSIGRRIKERLE LEDTIYFQPVSDQRSQTRGSDICTGKYEI ; A ? 2 'polypeptide(L)' no no SGSGRIIYDRKFLMECRNSPV SGSGRIIYDRKFLMECRNSPV C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 PRO n 1 7 GLU n 1 8 PHE n 1 9 PRO n 1 10 HIS n 1 11 PRO n 1 12 LEU n 1 13 GLN n 1 14 ASP n 1 15 SER n 1 16 TRP n 1 17 SER n 1 18 TYR n 1 19 TYR n 1 20 LEU n 1 21 PHE n 1 22 GLN n 1 23 PHE n 1 24 ARG n 1 25 LYS n 1 26 ALA n 1 27 LEU n 1 28 ASP n 1 29 TRP n 1 30 ASP n 1 31 GLU n 1 32 CYS n 1 33 LEU n 1 34 GLU n 1 35 LYS n 1 36 VAL n 1 37 ALA n 1 38 THR n 1 39 PHE n 1 40 SER n 1 41 THR n 1 42 ILE n 1 43 GLU n 1 44 ASP n 1 45 PHE n 1 46 TRP n 1 47 SER n 1 48 VAL n 1 49 LEU n 1 50 THR n 1 51 HIS n 1 52 THR n 1 53 VAL n 1 54 ARG n 1 55 PRO n 1 56 ARG n 1 57 GLU n 1 58 ILE n 1 59 THR n 1 60 TYR n 1 61 GLY n 1 62 LYS n 1 63 ASP n 1 64 LEU n 1 65 TYR n 1 66 MET n 1 67 PHE n 1 68 LYS n 1 69 SER n 1 70 ASP n 1 71 ILE n 1 72 MET n 1 73 PRO n 1 74 LYS n 1 75 TRP n 1 76 GLU n 1 77 ASP n 1 78 PRO n 1 79 LYS n 1 80 ASN n 1 81 GLU n 1 82 ASN n 1 83 GLY n 1 84 GLY n 1 85 ARG n 1 86 TRP n 1 87 LEU n 1 88 ILE n 1 89 ASN n 1 90 VAL n 1 91 THR n 1 92 ALA n 1 93 ARG n 1 94 GLN n 1 95 ASP n 1 96 VAL n 1 97 ASP n 1 98 PHE n 1 99 LEU n 1 100 TRP n 1 101 ASP n 1 102 GLU n 1 103 LEU n 1 104 LEU n 1 105 MET n 1 106 LEU n 1 107 LEU n 1 108 ILE n 1 109 GLY n 1 110 SER n 1 111 ASP n 1 112 TRP n 1 113 ASP n 1 114 THR n 1 115 ASP n 1 116 GLU n 1 117 GLU n 1 118 ASP n 1 119 ARG n 1 120 GLN n 1 121 ILE n 1 122 CYS n 1 123 GLY n 1 124 ALA n 1 125 VAL n 1 126 PHE n 1 127 GLN n 1 128 PRO n 1 129 ARG n 1 130 SER n 1 131 ARG n 1 132 GLY n 1 133 SER n 1 134 LYS n 1 135 LEU n 1 136 SER n 1 137 VAL n 1 138 TRP n 1 139 LEU n 1 140 THR n 1 141 SER n 1 142 ASP n 1 143 ASN n 1 144 GLU n 1 145 GLU n 1 146 GLU n 1 147 THR n 1 148 ILE n 1 149 LEU n 1 150 SER n 1 151 ILE n 1 152 GLY n 1 153 ARG n 1 154 ARG n 1 155 ILE n 1 156 LYS n 1 157 GLU n 1 158 ARG n 1 159 LEU n 1 160 GLU n 1 161 LEU n 1 162 GLU n 1 163 ASP n 1 164 THR n 1 165 ILE n 1 166 TYR n 1 167 PHE n 1 168 GLN n 1 169 PRO n 1 170 VAL n 1 171 SER n 1 172 ASP n 1 173 GLN n 1 174 ARG n 1 175 SER n 1 176 GLN n 1 177 THR n 1 178 ARG n 1 179 GLY n 1 180 SER n 1 181 ASP n 1 182 ILE n 1 183 CYS n 1 184 THR n 1 185 GLY n 1 186 LYS n 1 187 TYR n 1 188 GLU n 1 189 ILE n 2 1 SER n 2 2 GLY n 2 3 SER n 2 4 GLY n 2 5 ARG n 2 6 ILE n 2 7 ILE n 2 8 TYR n 2 9 ASP n 2 10 ARG n 2 11 LYS n 2 12 PHE n 2 13 LEU n 2 14 MET n 2 15 GLU n 2 16 CYS n 2 17 ARG n 2 18 ASN n 2 19 SER n 2 20 PRO n 2 21 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene eif4e _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Schistosoma mansoni' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6183 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain XA90 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX6p-1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP 4EBP1_HUMAN Q13541 2 RIIYDRKFLMECRNSPV 51 ? 2 PDB 3HXI 3HXI 1 ;GPLGSPEFPHPLQDSWSYYLFQFRKALDWDECLEKVATFSTIEDFWSVLTHTVRPREITYGKDLYMFKSDIMPKWEDPKN ENGGRWLINVTARQDVDFLWDELLMLLIGSDWDTDEEDRQICGAVFQPRSRGSKLSVWLTSDNEEETILSIGRRIKERLE LEDTIYFQPVSDQRSQTRGSDICTGKYEI ; 1 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 3HXI C 5 ? 21 ? Q13541 51 ? 67 ? 5 21 2 2 3HXI A 1 ? 189 ? 3HXI 15 ? 203 ? 15 203 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3HXI SER C 1 ? UNP Q13541 ? ? INSERTION 1 1 1 3HXI GLY C 2 ? UNP Q13541 ? ? INSERTION 2 2 1 3HXI SER C 3 ? UNP Q13541 ? ? INSERTION 3 3 1 3HXI GLY C 4 ? UNP Q13541 ? ? INSERTION 4 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GTG non-polymer . "7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE" 'MRNA CAP ANALOG N7-METHYL GPPPG' 'C21 H30 N10 O18 P3 1' 803.440 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3HXI _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.15 _exptl_crystal.density_percent_sol 42.74 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '100mM pH 6.5 Mops, 20% PEG4K, 0.2M MgCl2, VAPOR DIFFUSION, HANGING DROP, temperature 277K' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type NOIR-1 _diffrn_detector.pdbx_collection_date 2008-12-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 4.2.2' _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 4.2.2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5 # _reflns.entry_id 3HXI _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 24.00 _reflns.d_resolution_high 1.8 _reflns.number_obs 22977 _reflns.number_all ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 3HXI _refine.ls_number_reflns_obs 17407 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 24.00 _refine.ls_d_res_high 1.80 _refine.ls_percent_reflns_obs 94.46 _refine.ls_R_factor_obs 0.22355 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.21831 _refine.ls_R_factor_R_free 0.27158 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.2 _refine.ls_number_reflns_R_free 1969 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.946 _refine.correlation_coeff_Fo_to_Fc_free 0.917 _refine.B_iso_mean 23.342 _refine.aniso_B[1][1] -0.38 _refine.aniso_B[2][2] -1.00 _refine.aniso_B[3][3] 1.38 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 2v8w _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.175 _refine.pdbx_overall_ESU_R_Free 0.167 _refine.overall_SU_ML 0.107 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 3.461 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1645 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 52 _refine_hist.number_atoms_solvent 112 _refine_hist.number_atoms_total 1809 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 24.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.011 0.022 ? 1748 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.348 1.986 ? 2386 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.063 5.000 ? 204 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 31.598 23.523 ? 88 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 12.815 15.000 ? 295 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 14.068 15.000 ? 15 'X-RAY DIFFRACTION' ? r_chiral_restr 0.087 0.200 ? 251 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.005 0.020 ? 1330 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.192 0.200 ? 799 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.306 0.200 ? 1175 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.101 0.200 ? 122 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.199 0.200 ? 36 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.104 0.200 ? 11 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.003 1.500 ? 1026 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.523 2.000 ? 1610 'X-RAY DIFFRACTION' ? r_scbond_it 2.170 3.000 ? 879 'X-RAY DIFFRACTION' ? r_scangle_it 3.328 4.500 ? 771 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.800 _refine_ls_shell.d_res_low 1.847 _refine_ls_shell.number_reflns_R_work 1314 _refine_ls_shell.R_factor_R_work 0.280 _refine_ls_shell.percent_reflns_obs 97.39 _refine_ls_shell.R_factor_R_free 0.303 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 139 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 3HXI _struct.title 'Crystal structure of Schistosome eIF4E complexed with m7GpppG and 4E-BP' _struct.pdbx_descriptor 'Eukaryotic Translation Initiation 4E, Eukaryotic translation initiation factor 4E-binding protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3HXI _struct_keywords.pdbx_keywords TRANSLATION _struct_keywords.text 'protein-mRNA cap complex, Acetylation, Phosphoprotein, Protein synthesis inhibitor, Translation regulation, TRANSLATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 28 ? GLU A 31 ? ASP A 42 GLU A 45 5 ? 4 HELX_P HELX_P2 2 ILE A 42 ? HIS A 51 ? ILE A 56 HIS A 65 1 ? 10 HELX_P HELX_P3 3 ASP A 77 ? ASN A 82 ? ASP A 91 ASN A 96 1 ? 6 HELX_P HELX_P4 4 ASP A 95 ? GLY A 109 ? ASP A 109 GLY A 123 1 ? 15 HELX_P HELX_P5 5 THR A 114 ? GLN A 120 ? THR A 128 GLN A 134 1 ? 7 HELX_P HELX_P6 6 GLU A 144 ? GLU A 160 ? GLU A 158 GLU A 174 1 ? 17 HELX_P HELX_P7 7 VAL A 170 ? GLN A 176 ? VAL A 184 GLN A 190 1 ? 7 HELX_P HELX_P8 8 ASP B 9 ? ARG B 17 ? ASP C 9 ARG C 17 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 33 ? THR A 41 ? LEU A 47 THR A 55 A 2 PRO A 11 ? PHE A 21 ? PRO A 25 PHE A 35 A 3 ASP A 63 ? LYS A 68 ? ASP A 77 LYS A 82 A 4 ILE A 121 ? GLN A 127 ? ILE A 135 GLN A 141 A 5 LYS A 134 ? LEU A 139 ? LYS A 148 LEU A 153 A 6 GLY A 84 ? ASN A 89 ? GLY A 98 ASN A 103 A 7 ILE A 165 ? PRO A 169 ? ILE A 179 PRO A 183 A 8 TYR A 187 ? ILE A 189 ? TYR A 201 ILE A 203 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ALA A 37 ? O ALA A 51 N TYR A 18 ? N TYR A 32 A 2 3 N SER A 17 ? N SER A 31 O PHE A 67 ? O PHE A 81 A 3 4 N MET A 66 ? N MET A 80 O ALA A 124 ? O ALA A 138 A 4 5 N GLN A 127 ? N GLN A 141 O LYS A 134 ? O LYS A 148 A 5 6 O LEU A 139 ? O LEU A 153 N GLY A 84 ? N GLY A 98 A 6 7 N LEU A 87 ? N LEU A 101 O TYR A 166 ? O TYR A 180 A 7 8 N ILE A 165 ? N ILE A 179 O ILE A 189 ? O ILE A 203 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 24 _struct_site.details 'BINDING SITE FOR RESIDUE GTG A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 24 HOH D . ? HOH A 8 . ? 1_555 ? 2 AC1 24 GLU A 7 ? GLU A 21 . ? 1_655 ? 3 AC1 24 PHE A 8 ? PHE A 22 . ? 1_655 ? 4 AC1 24 PHE A 21 ? PHE A 35 . ? 1_555 ? 5 AC1 24 PHE A 23 ? PHE A 37 . ? 1_555 ? 6 AC1 24 LEU A 27 ? LEU A 41 . ? 1_555 ? 7 AC1 24 ASP A 28 ? ASP A 42 . ? 1_555 ? 8 AC1 24 TRP A 29 ? TRP A 43 . ? 1_555 ? 9 AC1 24 GLY A 61 ? GLY A 75 . ? 1_555 ? 10 AC1 24 ASP A 70 ? ASP A 84 . ? 4_555 ? 11 AC1 24 LYS A 74 ? LYS A 88 . ? 1_555 ? 12 AC1 24 TRP A 75 ? TRP A 89 . ? 1_555 ? 13 AC1 24 GLU A 76 ? GLU A 90 . ? 1_555 ? 14 AC1 24 GLN A 127 ? GLN A 141 . ? 1_555 ? 15 AC1 24 ARG A 129 ? ARG A 143 . ? 1_555 ? 16 AC1 24 LYS A 134 ? LYS A 148 . ? 1_555 ? 17 AC1 24 ARG A 178 ? ARG A 192 . ? 1_555 ? 18 AC1 24 HOH D . ? HOH A 208 . ? 1_555 ? 19 AC1 24 HOH D . ? HOH A 223 . ? 1_555 ? 20 AC1 24 HOH D . ? HOH A 224 . ? 1_555 ? 21 AC1 24 HOH D . ? HOH A 238 . ? 1_555 ? 22 AC1 24 HOH D . ? HOH A 252 . ? 1_655 ? 23 AC1 24 HOH D . ? HOH A 256 . ? 1_555 ? 24 AC1 24 HOH D . ? HOH A 276 . ? 1_555 ? # _database_PDB_matrix.entry_id 3HXI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3HXI _atom_sites.fract_transf_matrix[1][1] 0.022070 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007979 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.026788 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 15 ? ? ? A . n A 1 2 PRO 2 16 ? ? ? A . n A 1 3 LEU 3 17 ? ? ? A . n A 1 4 GLY 4 18 ? ? ? A . n A 1 5 SER 5 19 ? ? ? A . n A 1 6 PRO 6 20 ? ? ? A . n A 1 7 GLU 7 21 21 GLU GLU A . n A 1 8 PHE 8 22 22 PHE PHE A . n A 1 9 PRO 9 23 23 PRO PRO A . n A 1 10 HIS 10 24 24 HIS HIS A . n A 1 11 PRO 11 25 25 PRO PRO A . n A 1 12 LEU 12 26 26 LEU LEU A . n A 1 13 GLN 13 27 27 GLN GLN A . n A 1 14 ASP 14 28 28 ASP ASP A . n A 1 15 SER 15 29 29 SER SER A . n A 1 16 TRP 16 30 30 TRP TRP A . n A 1 17 SER 17 31 31 SER SER A . n A 1 18 TYR 18 32 32 TYR TYR A . n A 1 19 TYR 19 33 33 TYR TYR A . n A 1 20 LEU 20 34 34 LEU LEU A . n A 1 21 PHE 21 35 35 PHE PHE A . n A 1 22 GLN 22 36 36 GLN GLN A . n A 1 23 PHE 23 37 37 PHE PHE A . n A 1 24 ARG 24 38 38 ARG ARG A . n A 1 25 LYS 25 39 39 LYS ALA A . n A 1 26 ALA 26 40 40 ALA ALA A . n A 1 27 LEU 27 41 41 LEU LEU A . n A 1 28 ASP 28 42 42 ASP ASP A . n A 1 29 TRP 29 43 43 TRP TRP A . n A 1 30 ASP 30 44 44 ASP ASP A . n A 1 31 GLU 31 45 45 GLU GLU A . n A 1 32 CYS 32 46 46 CYS CYS A . n A 1 33 LEU 33 47 47 LEU LEU A . n A 1 34 GLU 34 48 48 GLU GLU A . n A 1 35 LYS 35 49 49 LYS LYS A . n A 1 36 VAL 36 50 50 VAL VAL A . n A 1 37 ALA 37 51 51 ALA ALA A . n A 1 38 THR 38 52 52 THR THR A . n A 1 39 PHE 39 53 53 PHE PHE A . n A 1 40 SER 40 54 54 SER SER A . n A 1 41 THR 41 55 55 THR THR A . n A 1 42 ILE 42 56 56 ILE ILE A . n A 1 43 GLU 43 57 57 GLU GLU A . n A 1 44 ASP 44 58 58 ASP ASP A . n A 1 45 PHE 45 59 59 PHE PHE A . n A 1 46 TRP 46 60 60 TRP TRP A . n A 1 47 SER 47 61 61 SER SER A . n A 1 48 VAL 48 62 62 VAL VAL A . n A 1 49 LEU 49 63 63 LEU LEU A . n A 1 50 THR 50 64 64 THR THR A . n A 1 51 HIS 51 65 65 HIS HIS A . n A 1 52 THR 52 66 66 THR THR A . n A 1 53 VAL 53 67 67 VAL VAL A . n A 1 54 ARG 54 68 68 ARG ARG A . n A 1 55 PRO 55 69 69 PRO PRO A . n A 1 56 ARG 56 70 70 ARG ARG A . n A 1 57 GLU 57 71 71 GLU GLU A . n A 1 58 ILE 58 72 72 ILE ILE A . n A 1 59 THR 59 73 73 THR THR A . n A 1 60 TYR 60 74 74 TYR TYR A . n A 1 61 GLY 61 75 75 GLY GLY A . n A 1 62 LYS 62 76 76 LYS LYS A . n A 1 63 ASP 63 77 77 ASP ASP A . n A 1 64 LEU 64 78 78 LEU LEU A . n A 1 65 TYR 65 79 79 TYR TYR A . n A 1 66 MET 66 80 80 MET MET A . n A 1 67 PHE 67 81 81 PHE PHE A . n A 1 68 LYS 68 82 82 LYS LYS A . n A 1 69 SER 69 83 83 SER SER A . n A 1 70 ASP 70 84 84 ASP ASP A . n A 1 71 ILE 71 85 85 ILE ILE A . n A 1 72 MET 72 86 86 MET MET A . n A 1 73 PRO 73 87 87 PRO PRO A . n A 1 74 LYS 74 88 88 LYS LYS A . n A 1 75 TRP 75 89 89 TRP TRP A . n A 1 76 GLU 76 90 90 GLU GLU A . n A 1 77 ASP 77 91 91 ASP ASP A . n A 1 78 PRO 78 92 92 PRO PRO A . n A 1 79 LYS 79 93 93 LYS LYS A . n A 1 80 ASN 80 94 94 ASN ASN A . n A 1 81 GLU 81 95 95 GLU GLU A . n A 1 82 ASN 82 96 96 ASN ASN A . n A 1 83 GLY 83 97 97 GLY GLY A . n A 1 84 GLY 84 98 98 GLY GLY A . n A 1 85 ARG 85 99 99 ARG ARG A . n A 1 86 TRP 86 100 100 TRP TRP A . n A 1 87 LEU 87 101 101 LEU LEU A . n A 1 88 ILE 88 102 102 ILE ILE A . n A 1 89 ASN 89 103 103 ASN ASN A . n A 1 90 VAL 90 104 104 VAL VAL A . n A 1 91 THR 91 105 105 THR THR A . n A 1 92 ALA 92 106 106 ALA ALA A . n A 1 93 ARG 93 107 107 ARG ARG A . n A 1 94 GLN 94 108 108 GLN GLN A . n A 1 95 ASP 95 109 109 ASP ASP A . n A 1 96 VAL 96 110 110 VAL VAL A . n A 1 97 ASP 97 111 111 ASP ASP A . n A 1 98 PHE 98 112 112 PHE PHE A . n A 1 99 LEU 99 113 113 LEU LEU A . n A 1 100 TRP 100 114 114 TRP TRP A . n A 1 101 ASP 101 115 115 ASP ASP A . n A 1 102 GLU 102 116 116 GLU GLU A . n A 1 103 LEU 103 117 117 LEU LEU A . n A 1 104 LEU 104 118 118 LEU LEU A . n A 1 105 MET 105 119 119 MET MET A . n A 1 106 LEU 106 120 120 LEU LEU A . n A 1 107 LEU 107 121 121 LEU LEU A . n A 1 108 ILE 108 122 122 ILE ILE A . n A 1 109 GLY 109 123 123 GLY GLY A . n A 1 110 SER 110 124 124 SER SER A . n A 1 111 ASP 111 125 125 ASP ASP A . n A 1 112 TRP 112 126 126 TRP TRP A . n A 1 113 ASP 113 127 127 ASP ASP A . n A 1 114 THR 114 128 128 THR THR A . n A 1 115 ASP 115 129 129 ASP ASP A . n A 1 116 GLU 116 130 130 GLU GLU A . n A 1 117 GLU 117 131 131 GLU GLU A . n A 1 118 ASP 118 132 132 ASP ASP A . n A 1 119 ARG 119 133 133 ARG ARG A . n A 1 120 GLN 120 134 134 GLN GLN A . n A 1 121 ILE 121 135 135 ILE ILE A . n A 1 122 CYS 122 136 136 CYS CYS A . n A 1 123 GLY 123 137 137 GLY GLY A . n A 1 124 ALA 124 138 138 ALA ALA A . n A 1 125 VAL 125 139 139 VAL VAL A . n A 1 126 PHE 126 140 140 PHE PHE A . n A 1 127 GLN 127 141 141 GLN GLN A . n A 1 128 PRO 128 142 142 PRO PRO A . n A 1 129 ARG 129 143 143 ARG ARG A . n A 1 130 SER 130 144 144 SER SER A . n A 1 131 ARG 131 145 145 ARG ARG A . n A 1 132 GLY 132 146 146 GLY GLY A . n A 1 133 SER 133 147 147 SER SER A . n A 1 134 LYS 134 148 148 LYS LYS A . n A 1 135 LEU 135 149 149 LEU LEU A . n A 1 136 SER 136 150 150 SER SER A . n A 1 137 VAL 137 151 151 VAL VAL A . n A 1 138 TRP 138 152 152 TRP TRP A . n A 1 139 LEU 139 153 153 LEU LEU A . n A 1 140 THR 140 154 154 THR THR A . n A 1 141 SER 141 155 155 SER SER A . n A 1 142 ASP 142 156 156 ASP ASP A . n A 1 143 ASN 143 157 157 ASN ASN A . n A 1 144 GLU 144 158 158 GLU GLU A . n A 1 145 GLU 145 159 159 GLU GLU A . n A 1 146 GLU 146 160 160 GLU GLU A . n A 1 147 THR 147 161 161 THR THR A . n A 1 148 ILE 148 162 162 ILE ILE A . n A 1 149 LEU 149 163 163 LEU LEU A . n A 1 150 SER 150 164 164 SER SER A . n A 1 151 ILE 151 165 165 ILE ILE A . n A 1 152 GLY 152 166 166 GLY GLY A . n A 1 153 ARG 153 167 167 ARG ARG A . n A 1 154 ARG 154 168 168 ARG ARG A . n A 1 155 ILE 155 169 169 ILE ILE A . n A 1 156 LYS 156 170 170 LYS LYS A . n A 1 157 GLU 157 171 171 GLU GLU A . n A 1 158 ARG 158 172 172 ARG ARG A . n A 1 159 LEU 159 173 173 LEU LEU A . n A 1 160 GLU 160 174 174 GLU GLU A . n A 1 161 LEU 161 175 175 LEU LEU A . n A 1 162 GLU 162 176 176 GLU GLU A . n A 1 163 ASP 163 177 177 ASP ASP A . n A 1 164 THR 164 178 178 THR THR A . n A 1 165 ILE 165 179 179 ILE ILE A . n A 1 166 TYR 166 180 180 TYR TYR A . n A 1 167 PHE 167 181 181 PHE PHE A . n A 1 168 GLN 168 182 182 GLN GLN A . n A 1 169 PRO 169 183 183 PRO PRO A . n A 1 170 VAL 170 184 184 VAL VAL A . n A 1 171 SER 171 185 185 SER SER A . n A 1 172 ASP 172 186 186 ASP ASP A . n A 1 173 GLN 173 187 187 GLN GLN A . n A 1 174 ARG 174 188 188 ARG ARG A . n A 1 175 SER 175 189 189 SER SER A . n A 1 176 GLN 176 190 190 GLN GLN A . n A 1 177 THR 177 191 191 THR THR A . n A 1 178 ARG 178 192 192 ARG ARG A . n A 1 179 GLY 179 193 193 GLY GLY A . n A 1 180 SER 180 194 194 SER SER A . n A 1 181 ASP 181 195 195 ASP ASP A . n A 1 182 ILE 182 196 ? ? ? A . n A 1 183 CYS 183 197 197 CYS CYS A . n A 1 184 THR 184 198 198 THR THR A . n A 1 185 GLY 185 199 199 GLY GLY A . n A 1 186 LYS 186 200 200 LYS LYS A . n A 1 187 TYR 187 201 201 TYR TYR A . n A 1 188 GLU 188 202 202 GLU GLU A . n A 1 189 ILE 189 203 203 ILE ILE A . n B 2 1 SER 1 1 ? ? ? C . n B 2 2 GLY 2 2 ? ? ? C . n B 2 3 SER 3 3 ? ? ? C . n B 2 4 GLY 4 4 4 GLY GLY C . n B 2 5 ARG 5 5 5 ARG ARG C . n B 2 6 ILE 6 6 6 ILE ILE C . n B 2 7 ILE 7 7 7 ILE ILE C . n B 2 8 TYR 8 8 8 TYR TYR C . n B 2 9 ASP 9 9 9 ASP ASP C . n B 2 10 ARG 10 10 10 ARG ARG C . n B 2 11 LYS 11 11 11 LYS LYS C . n B 2 12 PHE 12 12 12 PHE PHE C . n B 2 13 LEU 13 13 13 LEU LEU C . n B 2 14 MET 14 14 14 MET MET C . n B 2 15 GLU 15 15 15 GLU GLU C . n B 2 16 CYS 16 16 16 CYS CYS C . n B 2 17 ARG 17 17 17 ARG ARG C . n B 2 18 ASN 18 18 ? ? ? C . n B 2 19 SER 19 19 ? ? ? C . n B 2 20 PRO 20 20 ? ? ? C . n B 2 21 VAL 21 21 ? ? ? C . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2580 ? 1 MORE -9 ? 1 'SSA (A^2)' 9720 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-08-25 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PHASES phasing . ? 1 REFMAC refinement 5.2.0019 ? 2 d*TREK 'data reduction' . ? 3 d*TREK 'data scaling' . ? 4 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 39 ? CG ? A LYS 25 CG 2 1 Y 1 A LYS 39 ? CD ? A LYS 25 CD 3 1 Y 1 A LYS 39 ? CE ? A LYS 25 CE 4 1 Y 1 A LYS 39 ? NZ ? A LYS 25 NZ 5 1 Y 1 A ARG 70 ? CG ? A ARG 56 CG 6 1 Y 1 A ARG 70 ? CD ? A ARG 56 CD 7 1 Y 1 A ARG 70 ? NE ? A ARG 56 NE 8 1 Y 1 A ARG 70 ? CZ ? A ARG 56 CZ 9 1 Y 1 A ARG 70 ? NH1 ? A ARG 56 NH1 10 1 Y 1 A ARG 70 ? NH2 ? A ARG 56 NH2 11 1 Y 1 A GLU 71 ? CG ? A GLU 57 CG 12 1 Y 1 A GLU 71 ? CD ? A GLU 57 CD 13 1 Y 1 A GLU 71 ? OE1 ? A GLU 57 OE1 14 1 Y 1 A GLU 71 ? OE2 ? A GLU 57 OE2 15 1 Y 1 A ARG 145 ? CG ? A ARG 131 CG 16 1 Y 1 A ARG 145 ? CD ? A ARG 131 CD 17 1 Y 1 A ARG 145 ? NE ? A ARG 131 NE 18 1 Y 1 A ARG 145 ? CZ ? A ARG 131 CZ 19 1 Y 1 A ARG 145 ? NH1 ? A ARG 131 NH1 20 1 Y 1 A ARG 145 ? NH2 ? A ARG 131 NH2 21 1 Y 1 A SER 194 ? OG ? A SER 180 OG 22 1 Y 1 A ASP 195 ? CG ? A ASP 181 CG 23 1 Y 1 A ASP 195 ? OD1 ? A ASP 181 OD1 24 1 Y 1 A ASP 195 ? OD2 ? A ASP 181 OD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 15 ? A GLY 1 2 1 Y 1 A PRO 16 ? A PRO 2 3 1 Y 1 A LEU 17 ? A LEU 3 4 1 Y 1 A GLY 18 ? A GLY 4 5 1 Y 1 A SER 19 ? A SER 5 6 1 Y 1 A PRO 20 ? A PRO 6 7 1 Y 1 A ILE 196 ? A ILE 182 8 1 Y 1 C SER 1 ? B SER 1 9 1 Y 1 C GLY 2 ? B GLY 2 10 1 Y 1 C SER 3 ? B SER 3 11 1 Y 1 C ASN 18 ? B ASN 18 12 1 Y 1 C SER 19 ? B SER 19 13 1 Y 1 C PRO 20 ? B PRO 20 14 1 Y 1 C VAL 21 ? B VAL 21 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 "7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE" GTG 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 GTG 1 501 501 GTG GTG A . D 4 HOH 1 2 2 HOH HOH A . D 4 HOH 2 3 3 HOH HOH A . D 4 HOH 3 4 4 HOH HOH A . D 4 HOH 4 5 5 HOH HOH A . D 4 HOH 5 6 6 HOH HOH A . D 4 HOH 6 7 7 HOH HOH A . D 4 HOH 7 8 8 HOH HOH A . D 4 HOH 8 10 10 HOH HOH A . D 4 HOH 9 11 11 HOH HOH A . D 4 HOH 10 12 12 HOH HOH A . D 4 HOH 11 13 13 HOH HOH A . D 4 HOH 12 14 14 HOH HOH A . D 4 HOH 13 204 15 HOH HOH A . D 4 HOH 14 205 16 HOH HOH A . D 4 HOH 15 206 17 HOH HOH A . D 4 HOH 16 207 18 HOH HOH A . D 4 HOH 17 208 19 HOH HOH A . D 4 HOH 18 209 21 HOH HOH A . D 4 HOH 19 210 22 HOH HOH A . D 4 HOH 20 211 23 HOH HOH A . D 4 HOH 21 212 24 HOH HOH A . D 4 HOH 22 213 25 HOH HOH A . D 4 HOH 23 214 26 HOH HOH A . D 4 HOH 24 215 28 HOH HOH A . D 4 HOH 25 216 29 HOH HOH A . D 4 HOH 26 217 30 HOH HOH A . D 4 HOH 27 218 31 HOH HOH A . D 4 HOH 28 219 32 HOH HOH A . D 4 HOH 29 220 33 HOH HOH A . D 4 HOH 30 221 34 HOH HOH A . D 4 HOH 31 222 35 HOH HOH A . D 4 HOH 32 223 38 HOH HOH A . D 4 HOH 33 224 41 HOH HOH A . D 4 HOH 34 225 42 HOH HOH A . D 4 HOH 35 226 43 HOH HOH A . D 4 HOH 36 227 44 HOH HOH A . D 4 HOH 37 228 45 HOH HOH A . D 4 HOH 38 229 47 HOH HOH A . D 4 HOH 39 230 48 HOH HOH A . D 4 HOH 40 231 50 HOH HOH A . D 4 HOH 41 232 51 HOH HOH A . D 4 HOH 42 233 52 HOH HOH A . D 4 HOH 43 234 53 HOH HOH A . D 4 HOH 44 235 54 HOH HOH A . D 4 HOH 45 236 55 HOH HOH A . D 4 HOH 46 237 56 HOH HOH A . D 4 HOH 47 238 57 HOH HOH A . D 4 HOH 48 239 58 HOH HOH A . D 4 HOH 49 240 61 HOH HOH A . D 4 HOH 50 241 63 HOH HOH A . D 4 HOH 51 242 64 HOH HOH A . D 4 HOH 52 243 65 HOH HOH A . D 4 HOH 53 244 67 HOH HOH A . D 4 HOH 54 245 69 HOH HOH A . D 4 HOH 55 246 70 HOH HOH A . D 4 HOH 56 247 71 HOH HOH A . D 4 HOH 57 248 73 HOH HOH A . D 4 HOH 58 249 74 HOH HOH A . D 4 HOH 59 250 78 HOH HOH A . D 4 HOH 60 251 86 HOH HOH A . D 4 HOH 61 252 95 HOH HOH A . D 4 HOH 62 253 105 HOH HOH A . D 4 HOH 63 254 116 HOH HOH A . D 4 HOH 64 255 7 HOH HOH A . D 4 HOH 65 256 12 HOH HOH A . D 4 HOH 66 257 16 HOH HOH A . D 4 HOH 67 258 17 HOH HOH A . D 4 HOH 68 259 19 HOH HOH A . D 4 HOH 69 260 20 HOH HOH A . D 4 HOH 70 261 21 HOH HOH A . D 4 HOH 71 262 22 HOH HOH A . D 4 HOH 72 263 25 HOH HOH A . D 4 HOH 73 264 26 HOH HOH A . D 4 HOH 74 265 28 HOH HOH A . D 4 HOH 75 266 30 HOH HOH A . D 4 HOH 76 267 33 HOH HOH A . D 4 HOH 77 268 35 HOH HOH A . D 4 HOH 78 269 37 HOH HOH A . D 4 HOH 79 270 38 HOH HOH A . D 4 HOH 80 271 43 HOH HOH A . D 4 HOH 81 272 44 HOH HOH A . D 4 HOH 82 273 45 HOH HOH A . D 4 HOH 83 274 47 HOH HOH A . D 4 HOH 84 275 52 HOH HOH A . D 4 HOH 85 276 56 HOH HOH A . D 4 HOH 86 277 62 HOH HOH A . D 4 HOH 87 278 71 HOH HOH A . D 4 HOH 88 279 79 HOH HOH A . D 4 HOH 89 280 81 HOH HOH A . D 4 HOH 90 281 93 HOH HOH A . D 4 HOH 91 282 94 HOH HOH A . D 4 HOH 92 283 98 HOH HOH A . D 4 HOH 93 284 99 HOH HOH A . D 4 HOH 94 285 100 HOH HOH A . D 4 HOH 95 286 102 HOH HOH A . D 4 HOH 96 287 114 HOH HOH A . D 4 HOH 97 288 115 HOH HOH A . D 4 HOH 98 289 117 HOH HOH A . D 4 HOH 99 290 72 HOH HOH A . E 4 HOH 1 23 23 HOH HOH C . E 4 HOH 2 27 27 HOH HOH C . E 4 HOH 3 28 6 HOH HOH C . E 4 HOH 4 29 29 HOH HOH C . E 4 HOH 5 36 36 HOH HOH C . E 4 HOH 6 37 37 HOH HOH C . E 4 HOH 7 60 60 HOH HOH C . E 4 HOH 8 62 62 HOH HOH C . E 4 HOH 9 68 68 HOH HOH C . E 4 HOH 10 80 80 HOH HOH C . E 4 HOH 11 85 85 HOH HOH C . E 4 HOH 12 96 96 HOH HOH C . E 4 HOH 13 116 116 HOH HOH C . #