data_3IDQ # _entry.id 3IDQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.378 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3IDQ pdb_00003idq 10.2210/pdb3idq/pdb RCSB RCSB054283 ? ? WWPDB D_1000054283 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1IBG _pdbx_database_related.details 'The homolog in Aspergillus fumigatus' _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 3IDQ _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-07-21 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Suloway, C.J.M.' 1 'Chartron, J.W.' 2 'Zaslaver, M.' 3 'Clemons Jr., W.M.' 4 # _citation.id primary _citation.title 'Model for eukaryotic tail-anchored protein binding based on the structure of Get3' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 106 _citation.page_first 14849 _citation.page_last 14854 _citation.year 2009 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19706470 _citation.pdbx_database_id_DOI 10.1073/pnas.0907522106 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Suloway, C.J.' 1 ? primary 'Chartron, J.W.' 2 ? primary 'Zaslaver, M.' 3 ? primary 'Clemons, W.M.' 4 ? # _cell.length_a 115.320 _cell.length_b 115.320 _cell.length_c 281.111 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 3IDQ _cell.pdbx_unique_axis ? _cell.Z_PDB 18 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'H 3 2' _symmetry.entry_id 3IDQ _symmetry.Int_Tables_number 155 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ATPase GET3' 41132.508 1 3.6.3.16 ? ? ? 2 non-polymer syn 'NICKEL (II) ION' 58.693 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Arsenical pump-driving ATPase, Arsenite-translocating ATPase, Arsenical resistance ATPase, Arsenite-transporting ATPase, Golgi to ER traffic protein 3 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGM NNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETF DTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVC VCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGE IRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKEGLVPRGSLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGM NNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETF DTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVC VCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGE IRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKEGLVPRGSLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 LEU n 1 4 THR n 1 5 VAL n 1 6 GLU n 1 7 PRO n 1 8 ASN n 1 9 LEU n 1 10 HIS n 1 11 SER n 1 12 LEU n 1 13 ILE n 1 14 THR n 1 15 SER n 1 16 THR n 1 17 THR n 1 18 HIS n 1 19 LYS n 1 20 TRP n 1 21 ILE n 1 22 PHE n 1 23 VAL n 1 24 GLY n 1 25 GLY n 1 26 LYS n 1 27 GLY n 1 28 GLY n 1 29 VAL n 1 30 GLY n 1 31 LYS n 1 32 THR n 1 33 THR n 1 34 SER n 1 35 SER n 1 36 CYS n 1 37 SER n 1 38 ILE n 1 39 ALA n 1 40 ILE n 1 41 GLN n 1 42 MET n 1 43 ALA n 1 44 LEU n 1 45 SER n 1 46 GLN n 1 47 PRO n 1 48 ASN n 1 49 LYS n 1 50 GLN n 1 51 PHE n 1 52 LEU n 1 53 LEU n 1 54 ILE n 1 55 SER n 1 56 THR n 1 57 ASP n 1 58 PRO n 1 59 ALA n 1 60 HIS n 1 61 ASN n 1 62 LEU n 1 63 SER n 1 64 ASP n 1 65 ALA n 1 66 PHE n 1 67 GLY n 1 68 GLU n 1 69 LYS n 1 70 PHE n 1 71 GLY n 1 72 LYS n 1 73 ASP n 1 74 ALA n 1 75 ARG n 1 76 LYS n 1 77 VAL n 1 78 THR n 1 79 GLY n 1 80 MET n 1 81 ASN n 1 82 ASN n 1 83 LEU n 1 84 SER n 1 85 CYS n 1 86 MET n 1 87 GLU n 1 88 ILE n 1 89 ASP n 1 90 PRO n 1 91 SER n 1 92 ALA n 1 93 ALA n 1 94 LEU n 1 95 LYS n 1 96 ASP n 1 97 MET n 1 98 ASN n 1 99 ASP n 1 100 MET n 1 101 ALA n 1 102 VAL n 1 103 SER n 1 104 ARG n 1 105 ALA n 1 106 ASN n 1 107 ASN n 1 108 ASN n 1 109 GLY n 1 110 SER n 1 111 ASP n 1 112 GLY n 1 113 GLN n 1 114 GLY n 1 115 ASP n 1 116 ASP n 1 117 LEU n 1 118 GLY n 1 119 SER n 1 120 LEU n 1 121 LEU n 1 122 GLN n 1 123 GLY n 1 124 GLY n 1 125 ALA n 1 126 LEU n 1 127 ALA n 1 128 ASP n 1 129 LEU n 1 130 THR n 1 131 GLY n 1 132 SER n 1 133 ILE n 1 134 PRO n 1 135 GLY n 1 136 ILE n 1 137 ASP n 1 138 GLU n 1 139 ALA n 1 140 LEU n 1 141 SER n 1 142 PHE n 1 143 MET n 1 144 GLU n 1 145 VAL n 1 146 MET n 1 147 LYS n 1 148 HIS n 1 149 ILE n 1 150 LYS n 1 151 ARG n 1 152 GLN n 1 153 GLU n 1 154 GLN n 1 155 GLY n 1 156 GLU n 1 157 GLY n 1 158 GLU n 1 159 THR n 1 160 PHE n 1 161 ASP n 1 162 THR n 1 163 VAL n 1 164 ILE n 1 165 PHE n 1 166 ASP n 1 167 THR n 1 168 ALA n 1 169 PRO n 1 170 THR n 1 171 GLY n 1 172 HIS n 1 173 THR n 1 174 LEU n 1 175 ARG n 1 176 PHE n 1 177 LEU n 1 178 GLN n 1 179 LEU n 1 180 PRO n 1 181 ASN n 1 182 THR n 1 183 LEU n 1 184 SER n 1 185 LYS n 1 186 LEU n 1 187 LEU n 1 188 GLU n 1 189 LYS n 1 190 PHE n 1 191 GLY n 1 192 GLU n 1 193 ILE n 1 194 THR n 1 195 ASN n 1 196 LYS n 1 197 LEU n 1 198 GLY n 1 199 PRO n 1 200 MET n 1 201 LEU n 1 202 ASN n 1 203 SER n 1 204 PHE n 1 205 MET n 1 206 GLY n 1 207 ALA n 1 208 GLY n 1 209 ASN n 1 210 VAL n 1 211 ASP n 1 212 ILE n 1 213 SER n 1 214 GLY n 1 215 LYS n 1 216 LEU n 1 217 ASN n 1 218 GLU n 1 219 LEU n 1 220 LYS n 1 221 ALA n 1 222 ASN n 1 223 VAL n 1 224 GLU n 1 225 THR n 1 226 ILE n 1 227 ARG n 1 228 GLN n 1 229 GLN n 1 230 PHE n 1 231 THR n 1 232 ASP n 1 233 PRO n 1 234 ASP n 1 235 LEU n 1 236 THR n 1 237 THR n 1 238 PHE n 1 239 VAL n 1 240 CYS n 1 241 VAL n 1 242 CYS n 1 243 ILE n 1 244 SER n 1 245 GLU n 1 246 PHE n 1 247 LEU n 1 248 SER n 1 249 LEU n 1 250 TYR n 1 251 GLU n 1 252 THR n 1 253 GLU n 1 254 ARG n 1 255 LEU n 1 256 ILE n 1 257 GLN n 1 258 GLU n 1 259 LEU n 1 260 ILE n 1 261 SER n 1 262 TYR n 1 263 ASP n 1 264 MET n 1 265 ASP n 1 266 VAL n 1 267 ASN n 1 268 SER n 1 269 ILE n 1 270 ILE n 1 271 VAL n 1 272 ASN n 1 273 GLN n 1 274 LEU n 1 275 LEU n 1 276 PHE n 1 277 ALA n 1 278 GLU n 1 279 ASN n 1 280 ASP n 1 281 GLN n 1 282 GLU n 1 283 HIS n 1 284 ASN n 1 285 CYS n 1 286 LYS n 1 287 ARG n 1 288 CYS n 1 289 GLN n 1 290 ALA n 1 291 ARG n 1 292 TRP n 1 293 LYS n 1 294 MET n 1 295 GLN n 1 296 LYS n 1 297 LYS n 1 298 TYR n 1 299 LEU n 1 300 ASP n 1 301 GLN n 1 302 ILE n 1 303 ASP n 1 304 GLU n 1 305 LEU n 1 306 TYR n 1 307 GLU n 1 308 ASP n 1 309 PHE n 1 310 HIS n 1 311 VAL n 1 312 VAL n 1 313 LYS n 1 314 MET n 1 315 PRO n 1 316 LEU n 1 317 CYS n 1 318 ALA n 1 319 GLY n 1 320 GLU n 1 321 ILE n 1 322 ARG n 1 323 GLY n 1 324 LEU n 1 325 ASN n 1 326 ASN n 1 327 LEU n 1 328 THR n 1 329 LYS n 1 330 PHE n 1 331 SER n 1 332 GLN n 1 333 PHE n 1 334 LEU n 1 335 ASN n 1 336 LYS n 1 337 GLU n 1 338 TYR n 1 339 ASN n 1 340 PRO n 1 341 ILE n 1 342 THR n 1 343 ASP n 1 344 GLY n 1 345 LYS n 1 346 VAL n 1 347 ILE n 1 348 TYR n 1 349 GLU n 1 350 LEU n 1 351 GLU n 1 352 ASP n 1 353 LYS n 1 354 GLU n 1 355 GLY n 1 356 LEU n 1 357 VAL n 1 358 PRO n 1 359 ARG n 1 360 GLY n 1 361 SER n 1 362 LEU n 1 363 GLU n 1 364 HIS n 1 365 HIS n 1 366 HIS n 1 367 HIS n 1 368 HIS n 1 369 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name yeast _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'GET3, ARR4, YDL100C, D2371' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET33b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GET3_YEAST _struct_ref.pdbx_db_accession Q12154 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGM NNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETF DTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVC VCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGE IRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3IDQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 354 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q12154 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 354 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 354 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3IDQ GLY A 355 ? UNP Q12154 ? ? 'expression tag' 355 1 1 3IDQ LEU A 356 ? UNP Q12154 ? ? 'expression tag' 356 2 1 3IDQ VAL A 357 ? UNP Q12154 ? ? 'expression tag' 357 3 1 3IDQ PRO A 358 ? UNP Q12154 ? ? 'expression tag' 358 4 1 3IDQ ARG A 359 ? UNP Q12154 ? ? 'expression tag' 359 5 1 3IDQ GLY A 360 ? UNP Q12154 ? ? 'expression tag' 360 6 1 3IDQ SER A 361 ? UNP Q12154 ? ? 'expression tag' 361 7 1 3IDQ LEU A 362 ? UNP Q12154 ? ? 'expression tag' 362 8 1 3IDQ GLU A 363 ? UNP Q12154 ? ? 'expression tag' 363 9 1 3IDQ HIS A 364 ? UNP Q12154 ? ? 'expression tag' 364 10 1 3IDQ HIS A 365 ? UNP Q12154 ? ? 'expression tag' 365 11 1 3IDQ HIS A 366 ? UNP Q12154 ? ? 'expression tag' 366 12 1 3IDQ HIS A 367 ? UNP Q12154 ? ? 'expression tag' 367 13 1 3IDQ HIS A 368 ? UNP Q12154 ? ? 'expression tag' 368 14 1 3IDQ HIS A 369 ? UNP Q12154 ? ? 'expression tag' 369 15 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NI non-polymer . 'NICKEL (II) ION' ? 'Ni 2' 58.693 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.crystals_number 1 _exptl.entry_id 3IDQ _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 4.37 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 71.87 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '0.1 M HEPES, 1.6 M ammonium sulfate, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 325 mm CCD' _diffrn_detector.pdbx_collection_date 2009-05-15 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'LIQUID NITROGEN-COOLED DOUBLE CRYSTAL' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SSRL BEAMLINE BL12-2' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_synchrotron_site SSRL _diffrn_source.pdbx_synchrotron_beamline BL12-2 # _reflns.entry_id 3IDQ _reflns.d_resolution_high 3.701 _reflns.d_resolution_low 47.054 _reflns.number_all ? _reflns.number_obs 7954 _reflns.pdbx_Rsym_value 0.099 _reflns.pdbx_redundancy 5.900 _reflns.percent_possible_obs 99.900 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 3.7 _reflns_shell.d_res_low 3.9 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value 0.627 _reflns_shell.pdbx_redundancy 6.0 _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3IDQ _refine.ls_d_res_high 3.701 _refine.ls_d_res_low 47.054 _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.600 _refine.ls_number_reflns_obs 7936 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details RANDOM _refine.details ;Residues designated 365-369 are part of the histidine tag used in purification. Density connecting these residues to the rest of the protein in chain A was not observed, therefore it is possible they are extending from a symmetry related copy. ; _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.285 _refine.ls_R_factor_R_work 0.283 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.335 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 4.510 _refine.ls_number_reflns_R_free 358 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 182.045 _refine.solvent_model_param_bsol 150.000 _refine.solvent_model_param_ksol 0.320 _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] -33.786 _refine.aniso_B[2][2] -33.786 _refine.aniso_B[3][3] 65.133 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] -0.000 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.540 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.110 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.900 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 'PDB entry 1IBG' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 401.21 _refine.B_iso_min 59.00 _refine.occupancy_max 1.00 _refine.occupancy_min 0.33 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2184 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2186 _refine_hist.d_res_high 3.701 _refine_hist.d_res_low 47.054 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 2222 0.007 ? ? 'X-RAY DIFFRACTION' ? f_angle_d 2990 1.147 ? ? 'X-RAY DIFFRACTION' ? f_chiral_restr 339 0.080 ? ? 'X-RAY DIFFRACTION' ? f_plane_restr 381 0.004 ? ? 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 1349 23.634 ? ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id 3.701 4.236 3 100.000 2481 . 0.320 0.363 . 115 . 2596 . . 'X-RAY DIFFRACTION' 4.236 5.336 3 100.000 2502 . 0.227 0.281 . 118 . 2620 . . 'X-RAY DIFFRACTION' 5.336 47.057 3 99.000 2595 . 0.297 0.351 . 125 . 2720 . . 'X-RAY DIFFRACTION' # _struct.entry_id 3IDQ _struct.title 'Crystal structure of S. cerevisiae Get3 at 3.7 Angstrom resolution' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3IDQ _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;hydrolase, deviant Walker A motif, Arsenical resistance, ATP-binding, Cytoplasm, Endoplasmic reticulum, ER-Golgi transport, Golgi apparatus, Nucleotide-binding, Transport ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 9 ? SER A 15 ? LEU A 9 SER A 15 1 ? 7 HELX_P HELX_P2 2 GLY A 30 ? GLN A 46 ? GLY A 30 GLN A 46 1 ? 17 HELX_P HELX_P3 3 HIS A 60 ? GLY A 67 ? HIS A 60 GLY A 67 1 ? 8 HELX_P HELX_P4 4 ASP A 137 ? GLU A 156 ? ASP A 137 GLU A 156 1 ? 20 HELX_P HELX_P5 5 GLY A 171 ? LEU A 177 ? GLY A 171 LEU A 177 5 ? 7 HELX_P HELX_P6 6 GLN A 178 ? LYS A 189 ? GLN A 178 LYS A 189 1 ? 12 HELX_P HELX_P7 7 ASN A 217 ? ASP A 232 ? ASN A 217 ASP A 232 1 ? 16 HELX_P HELX_P8 8 GLU A 245 ? ASP A 263 ? GLU A 245 ASP A 263 1 ? 19 HELX_P HELX_P9 9 CYS A 285 ? TYR A 306 ? CYS A 285 TYR A 306 1 ? 22 HELX_P HELX_P10 10 GLY A 323 ? LYS A 336 ? GLY A 323 LYS A 336 1 ? 14 HELX_P HELX_P11 11 ILE A 341 ? ASP A 352 ? ILE A 341 ASP A 352 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 288 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 288 A ZN 371 1_555 ? ? ? ? ? ? ? 2.828 ? ? metalc2 metalc ? ? A HIS 367 NE2 ? ? ? 1_555 B NI . NI ? ? A HIS 367 A NI 370 1_555 ? ? ? ? ? ? ? 2.469 ? ? metalc3 metalc ? ? A HIS 368 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 368 A ZN 371 1_555 ? ? ? ? ? ? ? 2.231 ? ? metalc4 metalc ? ? A HIS 369 NE2 ? ? ? 1_555 B NI . NI ? ? A HIS 369 A NI 370 1_555 ? ? ? ? ? ? ? 2.218 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel A 6 7 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 83 ? GLU A 87 ? LEU A 83 GLU A 87 A 2 PHE A 51 ? SER A 55 ? PHE A 51 SER A 55 A 3 VAL A 163 ? ASP A 166 ? VAL A 163 ASP A 166 A 4 TRP A 20 ? GLY A 24 ? TRP A 20 GLY A 24 A 5 THR A 236 ? ILE A 243 ? THR A 236 ILE A 243 A 6 ILE A 269 ? ASN A 272 ? ILE A 269 ASN A 272 A 7 VAL A 311 ? LYS A 313 ? VAL A 311 LYS A 313 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O SER A 84 ? O SER A 84 N LEU A 53 ? N LEU A 53 A 2 3 N ILE A 54 ? N ILE A 54 O ASP A 166 ? O ASP A 166 A 3 4 O PHE A 165 ? O PHE A 165 N ILE A 21 ? N ILE A 21 A 4 5 N TRP A 20 ? N TRP A 20 O THR A 237 ? O THR A 237 A 5 6 N CYS A 240 ? N CYS A 240 O ILE A 270 ? O ILE A 270 A 6 7 N VAL A 271 ? N VAL A 271 O VAL A 312 ? O VAL A 312 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A NI 370 ? 6 'BINDING SITE FOR RESIDUE NI A 370' AC2 Software A ZN 371 ? 4 'BINDING SITE FOR RESIDUE ZN A 371' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HIS A 367 ? HIS A 367 . ? 2_555 ? 2 AC1 6 HIS A 367 ? HIS A 367 . ? 3_555 ? 3 AC1 6 HIS A 367 ? HIS A 367 . ? 1_555 ? 4 AC1 6 HIS A 369 ? HIS A 369 . ? 3_555 ? 5 AC1 6 HIS A 369 ? HIS A 369 . ? 1_555 ? 6 AC1 6 HIS A 369 ? HIS A 369 . ? 2_555 ? 7 AC2 4 CYS A 285 ? CYS A 285 . ? 1_555 ? 8 AC2 4 CYS A 288 ? CYS A 288 . ? 1_555 ? 9 AC2 4 HIS A 366 ? HIS A 366 . ? 1_555 ? 10 AC2 4 HIS A 368 ? HIS A 368 . ? 1_555 ? # _atom_sites.entry_id 3IDQ _atom_sites.fract_transf_matrix[1][1] 0.008672 _atom_sites.fract_transf_matrix[1][2] 0.005007 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010013 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003557 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N NI O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 VAL 5 5 ? ? ? A . n A 1 6 GLU 6 6 ? ? ? A . n A 1 7 PRO 7 7 ? ? ? A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 CYS 85 85 85 CYS CYS A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 PRO 90 90 ? ? ? A . n A 1 91 SER 91 91 ? ? ? A . n A 1 92 ALA 92 92 ? ? ? A . n A 1 93 ALA 93 93 ? ? ? A . n A 1 94 LEU 94 94 ? ? ? A . n A 1 95 LYS 95 95 ? ? ? A . n A 1 96 ASP 96 96 ? ? ? A . n A 1 97 MET 97 97 ? ? ? A . n A 1 98 ASN 98 98 ? ? ? A . n A 1 99 ASP 99 99 ? ? ? A . n A 1 100 MET 100 100 ? ? ? A . n A 1 101 ALA 101 101 ? ? ? A . n A 1 102 VAL 102 102 ? ? ? A . n A 1 103 SER 103 103 ? ? ? A . n A 1 104 ARG 104 104 ? ? ? A . n A 1 105 ALA 105 105 ? ? ? A . n A 1 106 ASN 106 106 ? ? ? A . n A 1 107 ASN 107 107 ? ? ? A . n A 1 108 ASN 108 108 ? ? ? A . n A 1 109 GLY 109 109 ? ? ? A . n A 1 110 SER 110 110 ? ? ? A . n A 1 111 ASP 111 111 ? ? ? A . n A 1 112 GLY 112 112 ? ? ? A . n A 1 113 GLN 113 113 ? ? ? A . n A 1 114 GLY 114 114 ? ? ? A . n A 1 115 ASP 115 115 ? ? ? A . n A 1 116 ASP 116 116 ? ? ? A . n A 1 117 LEU 117 117 ? ? ? A . n A 1 118 GLY 118 118 ? ? ? A . n A 1 119 SER 119 119 ? ? ? A . n A 1 120 LEU 120 120 ? ? ? A . n A 1 121 LEU 121 121 ? ? ? A . n A 1 122 GLN 122 122 ? ? ? A . n A 1 123 GLY 123 123 ? ? ? A . n A 1 124 GLY 124 124 ? ? ? A . n A 1 125 ALA 125 125 ? ? ? A . n A 1 126 LEU 126 126 ? ? ? A . n A 1 127 ALA 127 127 ? ? ? A . n A 1 128 ASP 128 128 ? ? ? A . n A 1 129 LEU 129 129 ? ? ? A . n A 1 130 THR 130 130 ? ? ? A . n A 1 131 GLY 131 131 ? ? ? A . n A 1 132 SER 132 132 ? ? ? A . n A 1 133 ILE 133 133 ? ? ? A . n A 1 134 PRO 134 134 ? ? ? A . n A 1 135 GLY 135 135 ? ? ? A . n A 1 136 ILE 136 136 ? ? ? A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 PHE 142 142 142 PHE PHE A . n A 1 143 MET 143 143 143 MET MET A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 MET 146 146 146 MET MET A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 HIS 148 148 148 HIS HIS A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 GLN 154 154 154 GLN GLN A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 THR 159 159 159 THR THR A . n A 1 160 PHE 160 160 160 PHE PHE A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 VAL 163 163 163 VAL VAL A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 THR 167 167 167 THR THR A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 HIS 172 172 172 HIS HIS A . n A 1 173 THR 173 173 173 THR THR A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 GLN 178 178 178 GLN GLN A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 PRO 180 180 180 PRO PRO A . n A 1 181 ASN 181 181 181 ASN ASN A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 SER 184 184 184 SER SER A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 LYS 189 189 189 LYS LYS A . n A 1 190 PHE 190 190 190 PHE PHE A . n A 1 191 GLY 191 191 ? ? ? A . n A 1 192 GLU 192 192 ? ? ? A . n A 1 193 ILE 193 193 ? ? ? A . n A 1 194 THR 194 194 ? ? ? A . n A 1 195 ASN 195 195 ? ? ? A . n A 1 196 LYS 196 196 ? ? ? A . n A 1 197 LEU 197 197 ? ? ? A . n A 1 198 GLY 198 198 ? ? ? A . n A 1 199 PRO 199 199 ? ? ? A . n A 1 200 MET 200 200 ? ? ? A . n A 1 201 LEU 201 201 ? ? ? A . n A 1 202 ASN 202 202 ? ? ? A . n A 1 203 SER 203 203 ? ? ? A . n A 1 204 PHE 204 204 ? ? ? A . n A 1 205 MET 205 205 ? ? ? A . n A 1 206 GLY 206 206 ? ? ? A . n A 1 207 ALA 207 207 ? ? ? A . n A 1 208 GLY 208 208 ? ? ? A . n A 1 209 ASN 209 209 ? ? ? A . n A 1 210 VAL 210 210 ? ? ? A . n A 1 211 ASP 211 211 ? ? ? A . n A 1 212 ILE 212 212 ? ? ? A . n A 1 213 SER 213 213 ? ? ? A . n A 1 214 GLY 214 214 ? ? ? A . n A 1 215 LYS 215 215 ? ? ? A . n A 1 216 LEU 216 216 ? ? ? A . n A 1 217 ASN 217 217 217 ASN ASN A . n A 1 218 GLU 218 218 218 GLU GLU A . n A 1 219 LEU 219 219 219 LEU LEU A . n A 1 220 LYS 220 220 220 LYS LYS A . n A 1 221 ALA 221 221 221 ALA ALA A . n A 1 222 ASN 222 222 222 ASN ASN A . n A 1 223 VAL 223 223 223 VAL VAL A . n A 1 224 GLU 224 224 224 GLU GLU A . n A 1 225 THR 225 225 225 THR THR A . n A 1 226 ILE 226 226 226 ILE ILE A . n A 1 227 ARG 227 227 227 ARG ARG A . n A 1 228 GLN 228 228 228 GLN GLN A . n A 1 229 GLN 229 229 229 GLN GLN A . n A 1 230 PHE 230 230 230 PHE PHE A . n A 1 231 THR 231 231 231 THR THR A . n A 1 232 ASP 232 232 232 ASP ASP A . n A 1 233 PRO 233 233 233 PRO PRO A . n A 1 234 ASP 234 234 234 ASP ASP A . n A 1 235 LEU 235 235 235 LEU LEU A . n A 1 236 THR 236 236 236 THR THR A . n A 1 237 THR 237 237 237 THR THR A . n A 1 238 PHE 238 238 238 PHE PHE A . n A 1 239 VAL 239 239 239 VAL VAL A . n A 1 240 CYS 240 240 240 CYS CYS A . n A 1 241 VAL 241 241 241 VAL VAL A . n A 1 242 CYS 242 242 242 CYS CYS A . n A 1 243 ILE 243 243 243 ILE ILE A . n A 1 244 SER 244 244 244 SER SER A . n A 1 245 GLU 245 245 245 GLU GLU A . n A 1 246 PHE 246 246 246 PHE PHE A . n A 1 247 LEU 247 247 247 LEU LEU A . n A 1 248 SER 248 248 248 SER SER A . n A 1 249 LEU 249 249 249 LEU LEU A . n A 1 250 TYR 250 250 250 TYR TYR A . n A 1 251 GLU 251 251 251 GLU GLU A . n A 1 252 THR 252 252 252 THR THR A . n A 1 253 GLU 253 253 253 GLU GLU A . n A 1 254 ARG 254 254 254 ARG ARG A . n A 1 255 LEU 255 255 255 LEU LEU A . n A 1 256 ILE 256 256 256 ILE ILE A . n A 1 257 GLN 257 257 257 GLN GLN A . n A 1 258 GLU 258 258 258 GLU GLU A . n A 1 259 LEU 259 259 259 LEU LEU A . n A 1 260 ILE 260 260 260 ILE ILE A . n A 1 261 SER 261 261 261 SER SER A . n A 1 262 TYR 262 262 262 TYR TYR A . n A 1 263 ASP 263 263 263 ASP ASP A . n A 1 264 MET 264 264 264 MET MET A . n A 1 265 ASP 265 265 265 ASP ASP A . n A 1 266 VAL 266 266 266 VAL VAL A . n A 1 267 ASN 267 267 267 ASN ASN A . n A 1 268 SER 268 268 268 SER SER A . n A 1 269 ILE 269 269 269 ILE ILE A . n A 1 270 ILE 270 270 270 ILE ILE A . n A 1 271 VAL 271 271 271 VAL VAL A . n A 1 272 ASN 272 272 272 ASN ASN A . n A 1 273 GLN 273 273 273 GLN GLN A . n A 1 274 LEU 274 274 274 LEU LEU A . n A 1 275 LEU 275 275 275 LEU LEU A . n A 1 276 PHE 276 276 276 PHE PHE A . n A 1 277 ALA 277 277 277 ALA ALA A . n A 1 278 GLU 278 278 ? ? ? A . n A 1 279 ASN 279 279 ? ? ? A . n A 1 280 ASP 280 280 ? ? ? A . n A 1 281 GLN 281 281 ? ? ? A . n A 1 282 GLU 282 282 ? ? ? A . n A 1 283 HIS 283 283 ? ? ? A . n A 1 284 ASN 284 284 284 ASN ASN A . n A 1 285 CYS 285 285 285 CYS CYS A . n A 1 286 LYS 286 286 286 LYS LYS A . n A 1 287 ARG 287 287 287 ARG ARG A . n A 1 288 CYS 288 288 288 CYS CYS A . n A 1 289 GLN 289 289 289 GLN GLN A . n A 1 290 ALA 290 290 290 ALA ALA A . n A 1 291 ARG 291 291 291 ARG ARG A . n A 1 292 TRP 292 292 292 TRP TRP A . n A 1 293 LYS 293 293 293 LYS LYS A . n A 1 294 MET 294 294 294 MET MET A . n A 1 295 GLN 295 295 295 GLN GLN A . n A 1 296 LYS 296 296 296 LYS LYS A . n A 1 297 LYS 297 297 297 LYS LYS A . n A 1 298 TYR 298 298 298 TYR TYR A . n A 1 299 LEU 299 299 299 LEU LEU A . n A 1 300 ASP 300 300 300 ASP ASP A . n A 1 301 GLN 301 301 301 GLN GLN A . n A 1 302 ILE 302 302 302 ILE ILE A . n A 1 303 ASP 303 303 303 ASP ASP A . n A 1 304 GLU 304 304 304 GLU GLU A . n A 1 305 LEU 305 305 305 LEU LEU A . n A 1 306 TYR 306 306 306 TYR TYR A . n A 1 307 GLU 307 307 307 GLU GLU A . n A 1 308 ASP 308 308 308 ASP ASP A . n A 1 309 PHE 309 309 309 PHE PHE A . n A 1 310 HIS 310 310 310 HIS HIS A . n A 1 311 VAL 311 311 311 VAL VAL A . n A 1 312 VAL 312 312 312 VAL VAL A . n A 1 313 LYS 313 313 313 LYS LYS A . n A 1 314 MET 314 314 314 MET MET A . n A 1 315 PRO 315 315 315 PRO PRO A . n A 1 316 LEU 316 316 316 LEU LEU A . n A 1 317 CYS 317 317 ? ? ? A . n A 1 318 ALA 318 318 ? ? ? A . n A 1 319 GLY 319 319 ? ? ? A . n A 1 320 GLU 320 320 320 GLU GLU A . n A 1 321 ILE 321 321 321 ILE ILE A . n A 1 322 ARG 322 322 322 ARG ARG A . n A 1 323 GLY 323 323 323 GLY GLY A . n A 1 324 LEU 324 324 324 LEU LEU A . n A 1 325 ASN 325 325 325 ASN ASN A . n A 1 326 ASN 326 326 326 ASN ASN A . n A 1 327 LEU 327 327 327 LEU LEU A . n A 1 328 THR 328 328 328 THR THR A . n A 1 329 LYS 329 329 329 LYS LYS A . n A 1 330 PHE 330 330 330 PHE PHE A . n A 1 331 SER 331 331 331 SER SER A . n A 1 332 GLN 332 332 332 GLN GLN A . n A 1 333 PHE 333 333 333 PHE PHE A . n A 1 334 LEU 334 334 334 LEU LEU A . n A 1 335 ASN 335 335 335 ASN ASN A . n A 1 336 LYS 336 336 336 LYS LYS A . n A 1 337 GLU 337 337 337 GLU GLU A . n A 1 338 TYR 338 338 338 TYR TYR A . n A 1 339 ASN 339 339 339 ASN ASN A . n A 1 340 PRO 340 340 340 PRO PRO A . n A 1 341 ILE 341 341 341 ILE ILE A . n A 1 342 THR 342 342 342 THR THR A . n A 1 343 ASP 343 343 343 ASP ASP A . n A 1 344 GLY 344 344 344 GLY GLY A . n A 1 345 LYS 345 345 345 LYS LYS A . n A 1 346 VAL 346 346 346 VAL VAL A . n A 1 347 ILE 347 347 347 ILE ILE A . n A 1 348 TYR 348 348 348 TYR TYR A . n A 1 349 GLU 349 349 349 GLU GLU A . n A 1 350 LEU 350 350 350 LEU LEU A . n A 1 351 GLU 351 351 351 GLU GLU A . n A 1 352 ASP 352 352 352 ASP ASP A . n A 1 353 LYS 353 353 353 LYS LYS A . n A 1 354 GLU 354 354 354 GLU GLU A . n A 1 355 GLY 355 355 355 GLY GLY A . n A 1 356 LEU 356 356 356 LEU LEU A . n A 1 357 VAL 357 357 ? ? ? A . n A 1 358 PRO 358 358 ? ? ? A . n A 1 359 ARG 359 359 ? ? ? A . n A 1 360 GLY 360 360 ? ? ? A . n A 1 361 SER 361 361 ? ? ? A . n A 1 362 LEU 362 362 ? ? ? A . n A 1 363 GLU 363 363 ? ? ? A . n A 1 364 HIS 364 364 ? ? ? A . n A 1 365 HIS 365 365 365 HIS HIS A . n A 1 366 HIS 366 366 366 HIS HIS A . n A 1 367 HIS 367 367 367 HIS HIS A . n A 1 368 HIS 368 368 368 HIS HIS A . n A 1 369 HIS 369 369 369 HIS HIS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NI 1 370 1 NI NI A . C 3 ZN 1 371 2 ZN ZN A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA trimeric 3 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C 2 1,2,3 A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 4090 ? 2 MORE -158 ? 2 'SSA (A^2)' 40700 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id NI _pdbx_struct_special_symmetry.auth_seq_id 370 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id NI _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 288 ? A CYS 288 ? 1_555 ZN ? C ZN . ? A ZN 371 ? 1_555 NE2 ? A HIS 368 ? A HIS 368 ? 1_555 40.4 ? 2 NE2 ? A HIS 367 ? A HIS 367 ? 1_555 NI ? B NI . ? A NI 370 ? 1_555 NE2 ? A HIS 369 ? A HIS 369 ? 1_555 124.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-08-25 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2023-09-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_initial_refinement_model 5 3 'Structure model' struct_ref_seq_dif 6 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_ref_seq_dif.details' 4 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 SCALA 3.3.9 2008/10/21 other 'Phil R. Evans' pre@mrc-lmb.cam.ac.uk 'data processing' http://www.ccp4.ac.uk/dist/html/scala.html Fortran_77 ? 2 PHENIX 1.4_62 ? package 'Paul D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 3 PDB_EXTRACT 3.005 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 4 Blu-Ice . ? ? ? ? 'data collection' ? ? ? 5 MOSFLM . ? ? ? ? 'data reduction' ? ? ? 6 SCALA . ? ? ? ? 'data scaling' ? ? ? 7 PHASER . ? ? ? ? phasing ? ? ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 SG A CYS 288 ? ? NE2 A HIS 368 ? ? 1.83 2 1 SG A CYS 288 ? ? CE1 A HIS 368 ? ? 2.13 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C A ASP 232 ? ? N A PRO 233 ? ? CA A PRO 233 ? ? 128.78 119.30 9.48 1.50 Y 2 1 C A ASN 339 ? ? N A PRO 340 ? ? CA A PRO 340 ? ? 129.29 119.30 9.99 1.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 15 ? ? -42.15 102.15 2 1 LYS A 26 ? ? -35.34 110.16 3 1 VAL A 29 ? ? -64.55 50.00 4 1 LYS A 49 ? ? 136.45 55.59 5 1 GLN A 50 ? ? -33.30 113.66 6 1 ASP A 57 ? ? -38.00 108.43 7 1 HIS A 60 ? ? 74.76 37.50 8 1 LYS A 72 ? ? -69.67 12.12 9 1 ARG A 75 ? ? 166.17 85.03 10 1 ASN A 82 ? ? -153.72 57.11 11 1 LEU A 83 ? ? -172.98 111.45 12 1 PHE A 142 ? ? -60.14 -84.28 13 1 LYS A 189 ? ? -158.53 43.97 14 1 LEU A 235 ? ? -141.54 -53.34 15 1 VAL A 239 ? ? -161.76 117.27 16 1 GLU A 245 ? ? -34.46 132.77 17 1 ASP A 263 ? ? 74.04 43.75 18 1 VAL A 266 ? ? -149.05 -23.91 19 1 ASN A 267 ? ? -54.64 72.83 20 1 SER A 268 ? ? 175.72 131.52 21 1 PHE A 276 ? ? -131.68 -148.71 22 1 CYS A 285 ? ? -62.37 8.32 23 1 ALA A 290 ? ? -57.18 -8.67 24 1 PRO A 315 ? ? -61.87 -140.69 25 1 ARG A 322 ? ? -140.71 -32.85 26 1 ASN A 335 ? ? -79.21 -78.32 27 1 GLU A 337 ? ? -35.39 108.79 28 1 PRO A 340 ? ? -52.28 -6.13 29 1 THR A 342 ? ? -64.37 -75.94 30 1 ASP A 343 ? ? -19.19 -57.74 31 1 ASP A 352 ? ? -58.13 -1.65 32 1 HIS A 366 ? ? -57.27 -149.99 33 1 HIS A 367 ? ? 144.19 141.28 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 PHE _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 160 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ASP _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 161 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -144.24 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 48 ? CG ? A ASN 48 CG 2 1 Y 1 A ASN 48 ? OD1 ? A ASN 48 OD1 3 1 Y 1 A ASN 48 ? ND2 ? A ASN 48 ND2 4 1 Y 1 A ARG 291 ? CG ? A ARG 291 CG 5 1 Y 1 A ARG 291 ? CD ? A ARG 291 CD 6 1 Y 1 A ARG 291 ? NE ? A ARG 291 NE 7 1 Y 1 A ARG 291 ? CZ ? A ARG 291 CZ 8 1 Y 1 A ARG 291 ? NH1 ? A ARG 291 NH1 9 1 Y 1 A ARG 291 ? NH2 ? A ARG 291 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASP 2 ? A ASP 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A VAL 5 ? A VAL 5 6 1 Y 1 A GLU 6 ? A GLU 6 7 1 Y 1 A PRO 7 ? A PRO 7 8 1 Y 1 A PRO 90 ? A PRO 90 9 1 Y 1 A SER 91 ? A SER 91 10 1 Y 1 A ALA 92 ? A ALA 92 11 1 Y 1 A ALA 93 ? A ALA 93 12 1 Y 1 A LEU 94 ? A LEU 94 13 1 Y 1 A LYS 95 ? A LYS 95 14 1 Y 1 A ASP 96 ? A ASP 96 15 1 Y 1 A MET 97 ? A MET 97 16 1 Y 1 A ASN 98 ? A ASN 98 17 1 Y 1 A ASP 99 ? A ASP 99 18 1 Y 1 A MET 100 ? A MET 100 19 1 Y 1 A ALA 101 ? A ALA 101 20 1 Y 1 A VAL 102 ? A VAL 102 21 1 Y 1 A SER 103 ? A SER 103 22 1 Y 1 A ARG 104 ? A ARG 104 23 1 Y 1 A ALA 105 ? A ALA 105 24 1 Y 1 A ASN 106 ? A ASN 106 25 1 Y 1 A ASN 107 ? A ASN 107 26 1 Y 1 A ASN 108 ? A ASN 108 27 1 Y 1 A GLY 109 ? A GLY 109 28 1 Y 1 A SER 110 ? A SER 110 29 1 Y 1 A ASP 111 ? A ASP 111 30 1 Y 1 A GLY 112 ? A GLY 112 31 1 Y 1 A GLN 113 ? A GLN 113 32 1 Y 1 A GLY 114 ? A GLY 114 33 1 Y 1 A ASP 115 ? A ASP 115 34 1 Y 1 A ASP 116 ? A ASP 116 35 1 Y 1 A LEU 117 ? A LEU 117 36 1 Y 1 A GLY 118 ? A GLY 118 37 1 Y 1 A SER 119 ? A SER 119 38 1 Y 1 A LEU 120 ? A LEU 120 39 1 Y 1 A LEU 121 ? A LEU 121 40 1 Y 1 A GLN 122 ? A GLN 122 41 1 Y 1 A GLY 123 ? A GLY 123 42 1 Y 1 A GLY 124 ? A GLY 124 43 1 Y 1 A ALA 125 ? A ALA 125 44 1 Y 1 A LEU 126 ? A LEU 126 45 1 Y 1 A ALA 127 ? A ALA 127 46 1 Y 1 A ASP 128 ? A ASP 128 47 1 Y 1 A LEU 129 ? A LEU 129 48 1 Y 1 A THR 130 ? A THR 130 49 1 Y 1 A GLY 131 ? A GLY 131 50 1 Y 1 A SER 132 ? A SER 132 51 1 Y 1 A ILE 133 ? A ILE 133 52 1 Y 1 A PRO 134 ? A PRO 134 53 1 Y 1 A GLY 135 ? A GLY 135 54 1 Y 1 A ILE 136 ? A ILE 136 55 1 Y 1 A GLY 191 ? A GLY 191 56 1 Y 1 A GLU 192 ? A GLU 192 57 1 Y 1 A ILE 193 ? A ILE 193 58 1 Y 1 A THR 194 ? A THR 194 59 1 Y 1 A ASN 195 ? A ASN 195 60 1 Y 1 A LYS 196 ? A LYS 196 61 1 Y 1 A LEU 197 ? A LEU 197 62 1 Y 1 A GLY 198 ? A GLY 198 63 1 Y 1 A PRO 199 ? A PRO 199 64 1 Y 1 A MET 200 ? A MET 200 65 1 Y 1 A LEU 201 ? A LEU 201 66 1 Y 1 A ASN 202 ? A ASN 202 67 1 Y 1 A SER 203 ? A SER 203 68 1 Y 1 A PHE 204 ? A PHE 204 69 1 Y 1 A MET 205 ? A MET 205 70 1 Y 1 A GLY 206 ? A GLY 206 71 1 Y 1 A ALA 207 ? A ALA 207 72 1 Y 1 A GLY 208 ? A GLY 208 73 1 Y 1 A ASN 209 ? A ASN 209 74 1 Y 1 A VAL 210 ? A VAL 210 75 1 Y 1 A ASP 211 ? A ASP 211 76 1 Y 1 A ILE 212 ? A ILE 212 77 1 Y 1 A SER 213 ? A SER 213 78 1 Y 1 A GLY 214 ? A GLY 214 79 1 Y 1 A LYS 215 ? A LYS 215 80 1 Y 1 A LEU 216 ? A LEU 216 81 1 Y 1 A GLU 278 ? A GLU 278 82 1 Y 1 A ASN 279 ? A ASN 279 83 1 Y 1 A ASP 280 ? A ASP 280 84 1 Y 1 A GLN 281 ? A GLN 281 85 1 Y 1 A GLU 282 ? A GLU 282 86 1 Y 1 A HIS 283 ? A HIS 283 87 1 Y 1 A CYS 317 ? A CYS 317 88 1 Y 1 A ALA 318 ? A ALA 318 89 1 Y 1 A GLY 319 ? A GLY 319 90 1 Y 1 A VAL 357 ? A VAL 357 91 1 Y 1 A PRO 358 ? A PRO 358 92 1 Y 1 A ARG 359 ? A ARG 359 93 1 Y 1 A GLY 360 ? A GLY 360 94 1 Y 1 A SER 361 ? A SER 361 95 1 Y 1 A LEU 362 ? A LEU 362 96 1 Y 1 A GLU 363 ? A GLU 363 97 1 Y 1 A HIS 364 ? A HIS 364 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 NI NI NI N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 TRP N N N N 319 TRP CA C N S 320 TRP C C N N 321 TRP O O N N 322 TRP CB C N N 323 TRP CG C Y N 324 TRP CD1 C Y N 325 TRP CD2 C Y N 326 TRP NE1 N Y N 327 TRP CE2 C Y N 328 TRP CE3 C Y N 329 TRP CZ2 C Y N 330 TRP CZ3 C Y N 331 TRP CH2 C Y N 332 TRP OXT O N N 333 TRP H H N N 334 TRP H2 H N N 335 TRP HA H N N 336 TRP HB2 H N N 337 TRP HB3 H N N 338 TRP HD1 H N N 339 TRP HE1 H N N 340 TRP HE3 H N N 341 TRP HZ2 H N N 342 TRP HZ3 H N N 343 TRP HH2 H N N 344 TRP HXT H N N 345 TYR N N N N 346 TYR CA C N S 347 TYR C C N N 348 TYR O O N N 349 TYR CB C N N 350 TYR CG C Y N 351 TYR CD1 C Y N 352 TYR CD2 C Y N 353 TYR CE1 C Y N 354 TYR CE2 C Y N 355 TYR CZ C Y N 356 TYR OH O N N 357 TYR OXT O N N 358 TYR H H N N 359 TYR H2 H N N 360 TYR HA H N N 361 TYR HB2 H N N 362 TYR HB3 H N N 363 TYR HD1 H N N 364 TYR HD2 H N N 365 TYR HE1 H N N 366 TYR HE2 H N N 367 TYR HH H N N 368 TYR HXT H N N 369 VAL N N N N 370 VAL CA C N S 371 VAL C C N N 372 VAL O O N N 373 VAL CB C N N 374 VAL CG1 C N N 375 VAL CG2 C N N 376 VAL OXT O N N 377 VAL H H N N 378 VAL H2 H N N 379 VAL HA H N N 380 VAL HB H N N 381 VAL HG11 H N N 382 VAL HG12 H N N 383 VAL HG13 H N N 384 VAL HG21 H N N 385 VAL HG22 H N N 386 VAL HG23 H N N 387 VAL HXT H N N 388 ZN ZN ZN N N 389 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'NICKEL (II) ION' NI 3 'ZINC ION' ZN # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1IBG _pdbx_initial_refinement_model.details 'PDB entry 1IBG' #