data_3IOZ # _entry.id 3IOZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3IOZ pdb_00003ioz 10.2210/pdb3ioz/pdb RCSB RCSB054683 ? ? WWPDB D_1000054683 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-02-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-03-28 4 'Structure model' 1 3 2017-11-01 5 'Structure model' 1 4 2024-02-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Refinement description' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' chem_comp_atom 3 5 'Structure model' chem_comp_bond 4 5 'Structure model' database_2 5 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.entry_id 3IOZ _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-08-15 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3IK5 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kim, W.M.' 1 'Sigalov, A.B.' 2 'Stern, L.J.' 3 # _citation.id primary _citation.title ;Pseudo-merohedral twinning and noncrystallographic symmetry in orthorhombic crystals of SIVmac239 Nef core domain bound to different-length TCRzeta fragments. ; _citation.journal_abbrev 'Acta Crystallogr.,Sect.D' _citation.journal_volume 66 _citation.page_first 163 _citation.page_last 175 _citation.year 2010 _citation.journal_id_ASTM ABCRE6 _citation.country DK _citation.journal_id_ISSN 0907-4449 _citation.journal_id_CSD 0766 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20124696 _citation.pdbx_database_id_DOI 10.1107/S090744490904880X # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, W.M.' 1 ? primary 'Sigalov, A.B.' 2 ? primary 'Stern, L.J.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein Nef' 16698.676 1 ? ? ? ? 2 polymer man 'T-cell surface glycoprotein CD3 zeta chain' 5279.782 1 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name 'T-cell receptor T3 zeta chain' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSDDLVGVSVRPKVPLRTMSYKLAIDMSHFIKEKGGLEGIYYSARRHRILDIYLEKEEGIIPDWQDYTSGPGIRYPKTFG WLWKLVPVNVSDEAQEDEEHYLMHPAQTSQWDDPWGEVLAWKFDPTLAYTYEAYVRYPEEFGS ; ;GSDDLVGVSVRPKVPLRTMSYKLAIDMSHFIKEKGGLEGIYYSARRHRILDIYLEKEEGIIPDWQDYTSGPGIRYPKTFG WLWKLVPVNVSDEAQEDEEHYLMHPAQTSQWDDPWGEVLAWKFDPTLAYTYEAYVRYPEEFGS ; A ? 2 'polypeptide(L)' no no GSLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRD GSLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRD B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ASP n 1 4 ASP n 1 5 LEU n 1 6 VAL n 1 7 GLY n 1 8 VAL n 1 9 SER n 1 10 VAL n 1 11 ARG n 1 12 PRO n 1 13 LYS n 1 14 VAL n 1 15 PRO n 1 16 LEU n 1 17 ARG n 1 18 THR n 1 19 MET n 1 20 SER n 1 21 TYR n 1 22 LYS n 1 23 LEU n 1 24 ALA n 1 25 ILE n 1 26 ASP n 1 27 MET n 1 28 SER n 1 29 HIS n 1 30 PHE n 1 31 ILE n 1 32 LYS n 1 33 GLU n 1 34 LYS n 1 35 GLY n 1 36 GLY n 1 37 LEU n 1 38 GLU n 1 39 GLY n 1 40 ILE n 1 41 TYR n 1 42 TYR n 1 43 SER n 1 44 ALA n 1 45 ARG n 1 46 ARG n 1 47 HIS n 1 48 ARG n 1 49 ILE n 1 50 LEU n 1 51 ASP n 1 52 ILE n 1 53 TYR n 1 54 LEU n 1 55 GLU n 1 56 LYS n 1 57 GLU n 1 58 GLU n 1 59 GLY n 1 60 ILE n 1 61 ILE n 1 62 PRO n 1 63 ASP n 1 64 TRP n 1 65 GLN n 1 66 ASP n 1 67 TYR n 1 68 THR n 1 69 SER n 1 70 GLY n 1 71 PRO n 1 72 GLY n 1 73 ILE n 1 74 ARG n 1 75 TYR n 1 76 PRO n 1 77 LYS n 1 78 THR n 1 79 PHE n 1 80 GLY n 1 81 TRP n 1 82 LEU n 1 83 TRP n 1 84 LYS n 1 85 LEU n 1 86 VAL n 1 87 PRO n 1 88 VAL n 1 89 ASN n 1 90 VAL n 1 91 SER n 1 92 ASP n 1 93 GLU n 1 94 ALA n 1 95 GLN n 1 96 GLU n 1 97 ASP n 1 98 GLU n 1 99 GLU n 1 100 HIS n 1 101 TYR n 1 102 LEU n 1 103 MET n 1 104 HIS n 1 105 PRO n 1 106 ALA n 1 107 GLN n 1 108 THR n 1 109 SER n 1 110 GLN n 1 111 TRP n 1 112 ASP n 1 113 ASP n 1 114 PRO n 1 115 TRP n 1 116 GLY n 1 117 GLU n 1 118 VAL n 1 119 LEU n 1 120 ALA n 1 121 TRP n 1 122 LYS n 1 123 PHE n 1 124 ASP n 1 125 PRO n 1 126 THR n 1 127 LEU n 1 128 ALA n 1 129 TYR n 1 130 THR n 1 131 TYR n 1 132 GLU n 1 133 ALA n 1 134 TYR n 1 135 VAL n 1 136 ARG n 1 137 TYR n 1 138 PRO n 1 139 GLU n 1 140 GLU n 1 141 PHE n 1 142 GLY n 1 143 SER n 2 1 GLY n 2 2 SER n 2 3 LEU n 2 4 ARG n 2 5 VAL n 2 6 LYS n 2 7 PHE n 2 8 SER n 2 9 ARG n 2 10 SER n 2 11 ALA n 2 12 ASP n 2 13 ALA n 2 14 PRO n 2 15 ALA n 2 16 TYR n 2 17 GLN n 2 18 GLN n 2 19 GLY n 2 20 GLN n 2 21 ASN n 2 22 GLN n 2 23 LEU n 2 24 TYR n 2 25 ASN n 2 26 GLU n 2 27 LEU n 2 28 ASN n 2 29 LEU n 2 30 GLY n 2 31 ARG n 2 32 ARG n 2 33 GLU n 2 34 GLU n 2 35 TYR n 2 36 ASP n 2 37 VAL n 2 38 LEU n 2 39 ASP n 2 40 LYS n 2 41 ARG n 2 42 ARG n 2 43 GLY n 2 44 ARG n 2 45 ASP n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'Simian immunodeficiency virus' 388909 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21 (DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample ? ? ? human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21 (DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 93 ? ? ? A . n A 1 2 SER 2 94 ? ? ? A . n A 1 3 ASP 3 95 ? ? ? A . n A 1 4 ASP 4 96 ? ? ? A . n A 1 5 LEU 5 97 ? ? ? A . n A 1 6 VAL 6 98 ? ? ? A . n A 1 7 GLY 7 99 ? ? ? A . n A 1 8 VAL 8 100 ? ? ? A . n A 1 9 SER 9 101 ? ? ? A . n A 1 10 VAL 10 102 ? ? ? A . n A 1 11 ARG 11 103 ? ? ? A . n A 1 12 PRO 12 104 ? ? ? A . n A 1 13 LYS 13 105 ? ? ? A . n A 1 14 VAL 14 106 ? ? ? A . n A 1 15 PRO 15 107 107 PRO PRO A . n A 1 16 LEU 16 108 108 LEU LEU A . n A 1 17 ARG 17 109 109 ARG ARG A . n A 1 18 THR 18 110 110 THR THR A . n A 1 19 MET 19 111 111 MET MET A . n A 1 20 SER 20 112 112 SER SER A . n A 1 21 TYR 21 113 113 TYR TYR A . n A 1 22 LYS 22 114 114 LYS LYS A . n A 1 23 LEU 23 115 115 LEU LEU A . n A 1 24 ALA 24 116 116 ALA ALA A . n A 1 25 ILE 25 117 117 ILE ILE A . n A 1 26 ASP 26 118 118 ASP ASP A . n A 1 27 MET 27 119 119 MET MET A . n A 1 28 SER 28 120 120 SER SER A . n A 1 29 HIS 29 121 121 HIS HIS A . n A 1 30 PHE 30 122 122 PHE PHE A . n A 1 31 ILE 31 123 123 ILE ILE A . n A 1 32 LYS 32 124 124 LYS LYS A . n A 1 33 GLU 33 125 125 GLU GLU A . n A 1 34 LYS 34 126 126 LYS LYS A . n A 1 35 GLY 35 127 127 GLY GLY A . n A 1 36 GLY 36 128 128 GLY GLY A . n A 1 37 LEU 37 129 129 LEU LEU A . n A 1 38 GLU 38 130 130 GLU GLU A . n A 1 39 GLY 39 131 131 GLY GLY A . n A 1 40 ILE 40 132 132 ILE ILE A . n A 1 41 TYR 41 133 133 TYR TYR A . n A 1 42 TYR 42 134 134 TYR TYR A . n A 1 43 SER 43 135 135 SER SER A . n A 1 44 ALA 44 136 136 ALA ALA A . n A 1 45 ARG 45 137 137 ARG ARG A . n A 1 46 ARG 46 138 138 ARG ARG A . n A 1 47 HIS 47 139 139 HIS HIS A . n A 1 48 ARG 48 140 140 ARG ARG A . n A 1 49 ILE 49 141 141 ILE ILE A . n A 1 50 LEU 50 142 142 LEU LEU A . n A 1 51 ASP 51 143 143 ASP ASP A . n A 1 52 ILE 52 144 144 ILE ILE A . n A 1 53 TYR 53 145 145 TYR TYR A . n A 1 54 LEU 54 146 146 LEU LEU A . n A 1 55 GLU 55 147 147 GLU GLU A . n A 1 56 LYS 56 148 148 LYS LYS A . n A 1 57 GLU 57 149 149 GLU GLU A . n A 1 58 GLU 58 150 150 GLU GLU A . n A 1 59 GLY 59 151 151 GLY GLY A . n A 1 60 ILE 60 152 152 ILE ILE A . n A 1 61 ILE 61 153 153 ILE ILE A . n A 1 62 PRO 62 154 154 PRO PRO A . n A 1 63 ASP 63 155 155 ASP ASP A . n A 1 64 TRP 64 156 156 TRP TRP A . n A 1 65 GLN 65 157 157 GLN GLN A . n A 1 66 ASP 66 158 158 ASP ASP A . n A 1 67 TYR 67 159 159 TYR TYR A . n A 1 68 THR 68 160 160 THR THR A . n A 1 69 SER 69 161 161 SER SER A . n A 1 70 GLY 70 162 162 GLY GLY A . n A 1 71 PRO 71 163 163 PRO PRO A . n A 1 72 GLY 72 164 164 GLY GLY A . n A 1 73 ILE 73 165 165 ILE ILE A . n A 1 74 ARG 74 166 166 ARG ARG A . n A 1 75 TYR 75 167 167 TYR TYR A . n A 1 76 PRO 76 168 168 PRO PRO A . n A 1 77 LYS 77 169 169 LYS LYS A . n A 1 78 THR 78 170 170 THR THR A . n A 1 79 PHE 79 171 171 PHE PHE A . n A 1 80 GLY 80 172 172 GLY GLY A . n A 1 81 TRP 81 173 173 TRP TRP A . n A 1 82 LEU 82 174 174 LEU LEU A . n A 1 83 TRP 83 175 175 TRP TRP A . n A 1 84 LYS 84 176 176 LYS LYS A . n A 1 85 LEU 85 177 177 LEU LEU A . n A 1 86 VAL 86 178 178 VAL VAL A . n A 1 87 PRO 87 179 179 PRO PRO A . n A 1 88 VAL 88 180 180 VAL VAL A . n A 1 89 ASN 89 181 ? ? ? A . n A 1 90 VAL 90 182 ? ? ? A . n A 1 91 SER 91 183 ? ? ? A . n A 1 92 ASP 92 184 ? ? ? A . n A 1 93 GLU 93 185 ? ? ? A . n A 1 94 ALA 94 186 ? ? ? A . n A 1 95 GLN 95 187 ? ? ? A . n A 1 96 GLU 96 188 ? ? ? A . n A 1 97 ASP 97 189 ? ? ? A . n A 1 98 GLU 98 190 ? ? ? A . n A 1 99 GLU 99 191 ? ? ? A . n A 1 100 HIS 100 192 ? ? ? A . n A 1 101 TYR 101 193 ? ? ? A . n A 1 102 LEU 102 194 ? ? ? A . n A 1 103 MET 103 195 ? ? ? A . n A 1 104 HIS 104 196 ? ? ? A . n A 1 105 PRO 105 197 ? ? ? A . n A 1 106 ALA 106 198 ? ? ? A . n A 1 107 GLN 107 199 ? ? ? A . n A 1 108 THR 108 200 200 THR THR A . n A 1 109 SER 109 201 201 SER SER A . n A 1 110 GLN 110 202 202 GLN GLN A . n A 1 111 TRP 111 203 203 TRP TRP A . n A 1 112 ASP 112 204 204 ASP ASP A . n A 1 113 ASP 113 205 205 ASP ASP A . n A 1 114 PRO 114 206 206 PRO PRO A . n A 1 115 TRP 115 207 207 TRP TRP A . n A 1 116 GLY 116 208 208 GLY GLY A . n A 1 117 GLU 117 209 209 GLU GLU A . n A 1 118 VAL 118 210 210 VAL VAL A . n A 1 119 LEU 119 211 211 LEU LEU A . n A 1 120 ALA 120 212 212 ALA ALA A . n A 1 121 TRP 121 213 213 TRP TRP A . n A 1 122 LYS 122 214 214 LYS LYS A . n A 1 123 PHE 123 215 215 PHE PHE A . n A 1 124 ASP 124 216 216 ASP ASP A . n A 1 125 PRO 125 217 217 PRO PRO A . n A 1 126 THR 126 218 218 THR THR A . n A 1 127 LEU 127 219 219 LEU LEU A . n A 1 128 ALA 128 220 220 ALA ALA A . n A 1 129 TYR 129 221 221 TYR TYR A . n A 1 130 THR 130 222 222 THR THR A . n A 1 131 TYR 131 223 223 TYR TYR A . n A 1 132 GLU 132 224 224 GLU GLU A . n A 1 133 ALA 133 225 225 ALA ALA A . n A 1 134 TYR 134 226 226 TYR TYR A . n A 1 135 VAL 135 227 227 VAL VAL A . n A 1 136 ARG 136 228 228 ARG ARG A . n A 1 137 TYR 137 229 229 TYR TYR A . n A 1 138 PRO 138 230 230 PRO PRO A . n A 1 139 GLU 139 231 231 GLU GLU A . n A 1 140 GLU 140 232 232 GLU GLU A . n A 1 141 PHE 141 233 233 PHE PHE A . n A 1 142 GLY 142 234 234 GLY GLY A . n A 1 143 SER 143 235 ? ? ? A . n B 2 1 GLY 1 49 ? ? ? B . n B 2 2 SER 2 50 ? ? ? B . n B 2 3 LEU 3 51 ? ? ? B . n B 2 4 ARG 4 52 ? ? ? B . n B 2 5 VAL 5 53 ? ? ? B . n B 2 6 LYS 6 54 ? ? ? B . n B 2 7 PHE 7 55 ? ? ? B . n B 2 8 SER 8 56 ? ? ? B . n B 2 9 ARG 9 57 ? ? ? B . n B 2 10 SER 10 58 ? ? ? B . n B 2 11 ALA 11 59 ? ? ? B . n B 2 12 ASP 12 60 ? ? ? B . n B 2 13 ALA 13 61 ? ? ? B . n B 2 14 PRO 14 62 ? ? ? B . n B 2 15 ALA 15 63 63 ALA ALA B . n B 2 16 TYR 16 64 64 TYR TYR B . n B 2 17 GLN 17 65 65 GLN GLN B . n B 2 18 GLN 18 66 66 GLN GLN B . n B 2 19 GLY 19 67 67 GLY GLY B . n B 2 20 GLN 20 68 68 GLN GLN B . n B 2 21 ASN 21 69 69 ASN ASN B . n B 2 22 GLN 22 70 70 GLN GLN B . n B 2 23 LEU 23 71 71 LEU LEU B . n B 2 24 TYR 24 72 72 TYR TYR B . n B 2 25 ASN 25 73 73 ASN ASN B . n B 2 26 GLU 26 74 74 GLU GLU B . n B 2 27 LEU 27 75 75 LEU LEU B . n B 2 28 ASN 28 76 76 ASN ASN B . n B 2 29 LEU 29 77 77 LEU LEU B . n B 2 30 GLY 30 78 78 GLY GLY B . n B 2 31 ARG 31 79 ? ? ? B . n B 2 32 ARG 32 80 ? ? ? B . n B 2 33 GLU 33 81 ? ? ? B . n B 2 34 GLU 34 82 ? ? ? B . n B 2 35 TYR 35 83 ? ? ? B . n B 2 36 ASP 36 84 ? ? ? B . n B 2 37 VAL 37 85 ? ? ? B . n B 2 38 LEU 38 86 ? ? ? B . n B 2 39 ASP 39 87 ? ? ? B . n B 2 40 LYS 40 88 ? ? ? B . n B 2 41 ARG 41 89 ? ? ? B . n B 2 42 ARG 42 90 ? ? ? B . n B 2 43 GLY 43 91 ? ? ? B . n B 2 44 ARG 44 92 ? ? ? B . n B 2 45 ASP 45 93 ? ? ? B . n # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 3 PHASER 2.1.4 'Thu Nov 13 11:40:59 2008' program 'Randy J. Read' cimr-phaser@lists.cam.ac.uk phasing http://www-structmed.cimr.cam.ac.uk/phaser/ ? ? 4 PHENIX . ? package 'Paul D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 5 PDB_EXTRACT 3.005 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 6 CBASS . ? ? ? ? 'data collection' ? ? ? 7 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 8 HKL-2000 . ? ? ? ? 'data scaling' ? ? ? # _cell.length_a 51.638 _cell.length_b 51.638 _cell.length_c 189.449 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 3IOZ _cell.pdbx_unique_axis ? _cell.Z_PDB 8 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.entry_id 3IOZ _symmetry.Int_Tables_number 96 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # _exptl.crystals_number 1 _exptl.entry_id 3IOZ _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.87 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 57.19 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 8.2 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '15% PEG 3350, 0.15M KF, 0.1M hepes, pH 8.2, VAPOR DIFFUSION, HANGING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2008-10-18 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.290 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X29A' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.290 _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X29A # _reflns.entry_id 3IOZ _reflns.d_resolution_high 3.700 _reflns.d_resolution_low 50.000 _reflns.number_obs 3122 _reflns.pdbx_Rmerge_I_obs 0.051 _reflns.pdbx_netI_over_sigmaI 12.800 _reflns.pdbx_chi_squared 1.037 _reflns.pdbx_redundancy 12.600 _reflns.percent_possible_obs 99.400 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 3.70 3.83 ? ? ? 0.393 ? ? 1.037 12.70 ? 282 100.00 1 1 3.83 3.99 ? ? ? 0.279 ? ? 1.007 13.10 ? 311 100.00 2 1 3.99 4.17 ? ? ? 0.169 ? ? 1.057 13.40 ? 293 100.00 3 1 4.17 4.39 ? ? ? 0.158 ? ? 1.020 13.30 ? 306 100.00 4 1 4.39 4.66 ? ? ? 0.101 ? ? 1.057 13.10 ? 305 100.00 5 1 4.66 5.02 ? ? ? 0.090 ? ? 1.061 13.20 ? 305 100.00 6 1 5.02 5.53 ? ? ? 0.072 ? ? 1.051 12.70 ? 311 100.00 7 1 5.53 6.32 ? ? ? 0.056 ? ? 0.986 12.50 ? 317 99.70 8 1 6.32 7.96 ? ? ? 0.039 ? ? 0.998 12.00 ? 325 100.00 9 1 7.96 50.00 ? ? ? 0.030 ? ? 1.098 10.80 ? 367 95.10 10 1 # _refine.entry_id 3IOZ _refine.ls_d_res_high 3.699 _refine.ls_d_res_low 35.854 _refine.pdbx_ls_sigma_F 0.22 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 94.440 _refine.ls_number_reflns_obs 2923 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details ? _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.302 _refine.ls_R_factor_R_work 0.301 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.329 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 4.380 _refine.ls_number_reflns_R_free 128 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 206.485 _refine.solvent_model_param_bsol 143.650 _refine.solvent_model_param_ksol 0.314 _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 28.379 _refine.aniso_B[2][2] 28.379 _refine.aniso_B[3][3] -84.592 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 2.170 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.110 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.900 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.577 _refine.B_iso_max 251.08 _refine.B_iso_min 162.98 _refine.occupancy_max 1.00 _refine.occupancy_min 1.00 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1051 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1051 _refine_hist.d_res_high 3.699 _refine_hist.d_res_low 35.854 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 1088 0.003 ? ? 'X-RAY DIFFRACTION' ? f_angle_d 1478 0.565 ? ? 'X-RAY DIFFRACTION' ? f_chiral_restr 144 0.040 ? ? 'X-RAY DIFFRACTION' ? f_plane_restr 187 0.003 ? ? 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 383 13.315 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 3.699 _refine_ls_shell.d_res_low ? _refine_ls_shell.pdbx_total_number_of_bins_used 1 _refine_ls_shell.percent_reflns_obs 94.000 _refine_ls_shell.number_reflns_R_work 2795 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.301 _refine_ls_shell.R_factor_R_free 0.329 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 128 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 2923 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3IOZ _struct.title 'SIVmac239 Nef in complex with a TCR zeta polypeptide DP1 (L51-D93)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3IOZ _struct_keywords.pdbx_keywords 'VIRAL PROTEIN/SIGNALING PROTEIN' _struct_keywords.text ;Protein-Protein complex, Cell membrane, Lipoprotein, Membrane, Myristate, Viral immunoevasion, Virulence, Disulfide bond, Host-virus interaction, Phosphoprotein, Receptor, Transmembrane, VIRAL PROTEIN-ANTIVIRAL PROTEIN COMPLEX, VIRAL PROTEIN-SIGNALING PROTEIN COMPLEX ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP Q5QGG3_SIVCZ Q5QGG3 1 ;DDLVGVSVRPKVPLRTMSYKLAIDMSHFIKEKGGLEGIYYSARRHRILDIYLEKEEGIIPDWQDYTSGPGIRYPKTFGWL WKLVPVNVSDEAQEDEEHYLMHPAQTSQWDDPWGEVLAWKFDPTLAYTYEAYVRYPEEFGS ; 95 ? 2 UNP CD3Z_HUMAN P20963 2 LRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRD 51 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 3IOZ A 3 ? 143 ? Q5QGG3 95 ? 235 ? 95 235 2 2 3IOZ B 3 ? 45 ? P20963 51 ? 93 ? 51 93 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3IOZ GLY A 1 ? UNP Q5QGG3 ? ? 'expression tag' 93 1 1 3IOZ SER A 2 ? UNP Q5QGG3 ? ? 'expression tag' 94 2 2 3IOZ GLY B 1 ? UNP P20963 ? ? 'expression tag' 49 3 2 3IOZ SER B 2 ? UNP P20963 ? ? 'expression tag' 50 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1040 ? 1 MORE -6 ? 1 'SSA (A^2)' 7380 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 20 ? GLU A 33 ? SER A 112 GLU A 125 1 ? 14 HELX_P HELX_P2 2 SER A 43 ? GLY A 59 ? SER A 135 GLY A 151 1 ? 17 HELX_P HELX_P3 3 PRO A 125 ? TYR A 129 ? PRO A 217 TYR A 221 5 ? 5 HELX_P HELX_P4 4 TYR A 131 ? TYR A 137 ? TYR A 223 TYR A 229 1 ? 7 HELX_P HELX_P5 5 GLN B 17 ? GLU B 26 ? GLN B 65 GLU B 74 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 70 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 162 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 71 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 163 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.02 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 83 ? VAL A 86 ? TRP A 175 VAL A 178 A 2 ALA A 120 ? PHE A 123 ? ALA A 212 PHE A 215 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 84 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 176 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 122 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 214 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 109 ? ? -179.31 136.69 2 1 LEU A 115 ? ? -63.52 -72.63 3 1 ILE A 117 ? ? -55.40 -72.75 4 1 LEU A 129 ? ? 77.06 -44.48 5 1 GLU A 130 ? ? -46.88 107.13 6 1 ASP A 143 ? ? -39.74 -36.58 7 1 PRO A 154 ? ? -72.56 29.54 8 1 PRO A 163 ? ? -75.94 -143.59 9 1 ASP A 204 ? ? -64.55 -169.67 10 1 ASP A 216 ? ? -160.53 107.64 11 1 THR A 222 ? ? -160.25 102.13 12 1 ALA A 225 ? ? -54.43 -74.72 13 1 GLU A 232 ? ? -98.42 44.19 14 1 ASN B 76 ? ? 72.72 39.76 # _pdbx_phasing_MR.entry_id 3IOZ _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor 53.530 _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 5.000 _pdbx_phasing_MR.d_res_low_rotation 28.920 _pdbx_phasing_MR.d_res_high_translation 5.000 _pdbx_phasing_MR.d_res_low_translation 28.920 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 93 ? A GLY 1 2 1 Y 1 A SER 94 ? A SER 2 3 1 Y 1 A ASP 95 ? A ASP 3 4 1 Y 1 A ASP 96 ? A ASP 4 5 1 Y 1 A LEU 97 ? A LEU 5 6 1 Y 1 A VAL 98 ? A VAL 6 7 1 Y 1 A GLY 99 ? A GLY 7 8 1 Y 1 A VAL 100 ? A VAL 8 9 1 Y 1 A SER 101 ? A SER 9 10 1 Y 1 A VAL 102 ? A VAL 10 11 1 Y 1 A ARG 103 ? A ARG 11 12 1 Y 1 A PRO 104 ? A PRO 12 13 1 Y 1 A LYS 105 ? A LYS 13 14 1 Y 1 A VAL 106 ? A VAL 14 15 1 Y 1 A ASN 181 ? A ASN 89 16 1 Y 1 A VAL 182 ? A VAL 90 17 1 Y 1 A SER 183 ? A SER 91 18 1 Y 1 A ASP 184 ? A ASP 92 19 1 Y 1 A GLU 185 ? A GLU 93 20 1 Y 1 A ALA 186 ? A ALA 94 21 1 Y 1 A GLN 187 ? A GLN 95 22 1 Y 1 A GLU 188 ? A GLU 96 23 1 Y 1 A ASP 189 ? A ASP 97 24 1 Y 1 A GLU 190 ? A GLU 98 25 1 Y 1 A GLU 191 ? A GLU 99 26 1 Y 1 A HIS 192 ? A HIS 100 27 1 Y 1 A TYR 193 ? A TYR 101 28 1 Y 1 A LEU 194 ? A LEU 102 29 1 Y 1 A MET 195 ? A MET 103 30 1 Y 1 A HIS 196 ? A HIS 104 31 1 Y 1 A PRO 197 ? A PRO 105 32 1 Y 1 A ALA 198 ? A ALA 106 33 1 Y 1 A GLN 199 ? A GLN 107 34 1 Y 1 A SER 235 ? A SER 143 35 1 Y 1 B GLY 49 ? B GLY 1 36 1 Y 1 B SER 50 ? B SER 2 37 1 Y 1 B LEU 51 ? B LEU 3 38 1 Y 1 B ARG 52 ? B ARG 4 39 1 Y 1 B VAL 53 ? B VAL 5 40 1 Y 1 B LYS 54 ? B LYS 6 41 1 Y 1 B PHE 55 ? B PHE 7 42 1 Y 1 B SER 56 ? B SER 8 43 1 Y 1 B ARG 57 ? B ARG 9 44 1 Y 1 B SER 58 ? B SER 10 45 1 Y 1 B ALA 59 ? B ALA 11 46 1 Y 1 B ASP 60 ? B ASP 12 47 1 Y 1 B ALA 61 ? B ALA 13 48 1 Y 1 B PRO 62 ? B PRO 14 49 1 Y 1 B ARG 79 ? B ARG 31 50 1 Y 1 B ARG 80 ? B ARG 32 51 1 Y 1 B GLU 81 ? B GLU 33 52 1 Y 1 B GLU 82 ? B GLU 34 53 1 Y 1 B TYR 83 ? B TYR 35 54 1 Y 1 B ASP 84 ? B ASP 36 55 1 Y 1 B VAL 85 ? B VAL 37 56 1 Y 1 B LEU 86 ? B LEU 38 57 1 Y 1 B ASP 87 ? B ASP 39 58 1 Y 1 B LYS 88 ? B LYS 40 59 1 Y 1 B ARG 89 ? B ARG 41 60 1 Y 1 B ARG 90 ? B ARG 42 61 1 Y 1 B GLY 91 ? B GLY 43 62 1 Y 1 B ARG 92 ? B ARG 44 63 1 Y 1 B ASP 93 ? B ASP 45 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _atom_sites.entry_id 3IOZ _atom_sites.fract_transf_matrix[1][1] 0.019366 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019366 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005278 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ #