data_3ISY # _entry.id 3ISY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.365 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3ISY pdb_00003isy 10.2210/pdb3isy/pdb RCSB RCSB054826 ? ? WWPDB D_1000054826 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id 392216 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.SG_entry Y _pdbx_database_status.entry_id 3ISY _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-08-27 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Joint Center for Structural Genomics (JCSG)' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'The first structure in a family of peptidase inhibitors reveals an unusual Ig-like fold.' _citation.journal_abbrev F1000Res _citation.journal_volume 2 _citation.page_first 154 _citation.page_last 154 _citation.year 2013 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2046-1402 _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24555072 _citation.pdbx_database_id_DOI 10.12688/f1000research.2-154.v2 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rigden, D.J.' 1 ? primary 'Xu, Q.' 2 ? primary 'Chang, Y.' 3 ? primary 'Eberhardt, R.Y.' 4 ? primary 'Finn, R.D.' 5 ? primary 'Rawlings, N.D.' 6 ? # _cell.entry_id 3ISY _cell.length_a 73.586 _cell.length_b 73.586 _cell.length_c 132.923 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.pdbx_unique_axis ? _cell.Z_PDB 16 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3ISY _symmetry.Int_Tables_number 98 _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Intracellular proteinase inhibitor' 14287.434 1 ? ? ? ? 2 non-polymer syn 'TETRAETHYLENE GLYCOL' 194.226 1 ? ? ? ? 3 water nat water 18.015 21 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name BsuPI # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;G(MSE)ENQEVVLSIDAIQEPEQIKFN(MSE)SLKNQSERAIEFQFSTGQKFELVVYDSEHKERYRYSKEK(MSE)FTQA FQNLTLESGETYDFSDVWKEVPEPGTYEVKVTFKGRAENLKQVQAVQQFEVK ; _entity_poly.pdbx_seq_one_letter_code_can ;GMENQEVVLSIDAIQEPEQIKFNMSLKNQSERAIEFQFSTGQKFELVVYDSEHKERYRYSKEKMFTQAFQNLTLESGETY DFSDVWKEVPEPGTYEVKVTFKGRAENLKQVQAVQQFEVK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier 392216 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MSE n 1 3 GLU n 1 4 ASN n 1 5 GLN n 1 6 GLU n 1 7 VAL n 1 8 VAL n 1 9 LEU n 1 10 SER n 1 11 ILE n 1 12 ASP n 1 13 ALA n 1 14 ILE n 1 15 GLN n 1 16 GLU n 1 17 PRO n 1 18 GLU n 1 19 GLN n 1 20 ILE n 1 21 LYS n 1 22 PHE n 1 23 ASN n 1 24 MSE n 1 25 SER n 1 26 LEU n 1 27 LYS n 1 28 ASN n 1 29 GLN n 1 30 SER n 1 31 GLU n 1 32 ARG n 1 33 ALA n 1 34 ILE n 1 35 GLU n 1 36 PHE n 1 37 GLN n 1 38 PHE n 1 39 SER n 1 40 THR n 1 41 GLY n 1 42 GLN n 1 43 LYS n 1 44 PHE n 1 45 GLU n 1 46 LEU n 1 47 VAL n 1 48 VAL n 1 49 TYR n 1 50 ASP n 1 51 SER n 1 52 GLU n 1 53 HIS n 1 54 LYS n 1 55 GLU n 1 56 ARG n 1 57 TYR n 1 58 ARG n 1 59 TYR n 1 60 SER n 1 61 LYS n 1 62 GLU n 1 63 LYS n 1 64 MSE n 1 65 PHE n 1 66 THR n 1 67 GLN n 1 68 ALA n 1 69 PHE n 1 70 GLN n 1 71 ASN n 1 72 LEU n 1 73 THR n 1 74 LEU n 1 75 GLU n 1 76 SER n 1 77 GLY n 1 78 GLU n 1 79 THR n 1 80 TYR n 1 81 ASP n 1 82 PHE n 1 83 SER n 1 84 ASP n 1 85 VAL n 1 86 TRP n 1 87 LYS n 1 88 GLU n 1 89 VAL n 1 90 PRO n 1 91 GLU n 1 92 PRO n 1 93 GLY n 1 94 THR n 1 95 TYR n 1 96 GLU n 1 97 VAL n 1 98 LYS n 1 99 VAL n 1 100 THR n 1 101 PHE n 1 102 LYS n 1 103 GLY n 1 104 ARG n 1 105 ALA n 1 106 GLU n 1 107 ASN n 1 108 LEU n 1 109 LYS n 1 110 GLN n 1 111 VAL n 1 112 GLN n 1 113 ALA n 1 114 VAL n 1 115 GLN n 1 116 GLN n 1 117 PHE n 1 118 GLU n 1 119 VAL n 1 120 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BSU11130, ipi, NP_388994.1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia Coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain HK100 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name SpeedET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IPI_BACSU _struct_ref.pdbx_db_accession P39804 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MENQEVVLSIDAIQEPEQIKFNMSLKNQSERAIEFQFSTGQKFELVVYDSEHKERYRYSKEKMFTQAFQNLTLESGETYD FSDVWKEVPEPGTYEVKVTFKGRAENLKQVQAVQQFEVK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3ISY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 120 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P39804 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 119 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 119 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 3ISY _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P39804 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PG4 non-polymer . 'TETRAETHYLENE GLYCOL' ? 'C8 H18 O5' 194.226 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.method 'X-RAY DIFFRACTION' _exptl.entry_id 3ISY # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 3.15 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 60.93 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 9.7 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.pdbx_details '48.50% polyethylene glycol 600, 0.1M CHES pH 9.7, NANODROP, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 325 mm CCD' _diffrn_detector.details 'Flat collimating mirror, toroid focusing mirror' _diffrn_detector.pdbx_collection_date 2009-05-14 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Double crystal monochromator' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.91162 1.0 2 0.97934 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.pdbx_wavelength_list 0.91162,0.97934 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.entry_id 3ISY _reflns.d_resolution_high 2.61 _reflns.d_resolution_low 37.959 _reflns.number_obs 5864 _reflns.pdbx_Rmerge_I_obs 0.093 _reflns.pdbx_netI_over_sigmaI 16.530 _reflns.percent_possible_obs 99.900 _reflns.B_iso_Wilson_estimate 68.776 _reflns.observed_criterion_sigma_I -3.00 _reflns.observed_criterion_sigma_F ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.61 2.70 3820 ? 529 0.010 2.2 ? ? ? ? ? 100.00 1 1 2.70 2.81 4287 ? 597 0.010 3.1 ? ? ? ? ? 100.00 2 1 2.81 2.94 4165 ? 582 0.010 4.5 ? ? ? ? ? 100.00 3 1 2.94 3.09 3983 ? 555 0.010 6.0 ? ? ? ? ? 100.00 4 1 3.09 3.29 4256 ? 593 0.010 9.3 ? ? ? ? ? 100.00 5 1 3.29 3.54 4080 ? 577 0.010 14.8 ? ? ? ? ? 100.00 6 1 3.54 3.89 4021 ? 571 0.010 21.4 ? ? ? ? ? 100.00 7 1 3.89 4.45 4142 ? 596 0.010 28.4 ? ? ? ? ? 100.00 8 1 4.45 5.59 4145 ? 603 0.010 34.8 ? ? ? ? ? 100.00 9 1 5.59 37.959 4135 ? 661 0.010 36.0 ? ? ? ? ? 99.20 10 1 # _refine.entry_id 3ISY _refine.ls_d_res_high 2.610 _refine.ls_d_res_low 37.959 _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.930 _refine.ls_number_reflns_obs 5851 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ;1. HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. 2. A MET-INHIBITION PROTOCOL WAS USED FOR SELENOMETHIONINE INCORPORATION DURING PROTEIN EXPRESSION. THE OCCUPANCY OF THE SE ATOMS IN THE MSE RESIDUES WAS REDUCED TO 0.75 FOR THE REDUCED SCATTERING POWER DUE TO PARTIAL S-MET INCORPORATION. 3. ATOM RECORDS CONTAIN RESIDUAL B FACTORS ONLY. 4. PEG MOLECULE MODELED IS LOCATED ON SPECIAL POSITION. ; _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.205 _refine.ls_R_factor_R_work 0.203 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.243 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 4.500 _refine.ls_number_reflns_R_free 266 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 45.523 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 1.370 _refine.aniso_B[2][2] 1.370 _refine.aniso_B[3][3] -2.750 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.948 _refine.correlation_coeff_Fo_to_Fc_free 0.929 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R 0.429 _refine.pdbx_overall_ESU_R_Free 0.273 _refine.overall_SU_ML 0.218 _refine.overall_SU_B 23.266 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 91.64 _refine.B_iso_min 22.86 _refine.occupancy_max 1.00 _refine.occupancy_min 0.50 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_starting_model ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 967 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 13 _refine_hist.number_atoms_solvent 21 _refine_hist.number_atoms_total 1001 _refine_hist.d_res_high 2.610 _refine_hist.d_res_low 37.959 # loop_ _refine_ls_restr.type _refine_ls_restr.pdbx_refine_id _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 'X-RAY DIFFRACTION' 998 0.014 0.022 ? ? r_bond_other_d 'X-RAY DIFFRACTION' 693 0.001 0.020 ? ? r_angle_refined_deg 'X-RAY DIFFRACTION' 1339 1.521 1.948 ? ? r_angle_other_deg 'X-RAY DIFFRACTION' 1690 0.830 3.000 ? ? r_dihedral_angle_1_deg 'X-RAY DIFFRACTION' 116 6.182 5.000 ? ? r_dihedral_angle_2_deg 'X-RAY DIFFRACTION' 56 42.282 25.714 ? ? r_dihedral_angle_3_deg 'X-RAY DIFFRACTION' 181 14.549 15.000 ? ? r_dihedral_angle_4_deg 'X-RAY DIFFRACTION' 4 16.083 15.000 ? ? r_chiral_restr 'X-RAY DIFFRACTION' 140 0.093 0.200 ? ? r_gen_planes_refined 'X-RAY DIFFRACTION' 1102 0.007 0.020 ? ? r_gen_planes_other 'X-RAY DIFFRACTION' 201 0.001 0.020 ? ? r_mcbond_it 'X-RAY DIFFRACTION' 584 1.747 3.000 ? ? r_mcbond_other 'X-RAY DIFFRACTION' 234 0.355 3.000 ? ? r_mcangle_it 'X-RAY DIFFRACTION' 947 3.417 5.000 ? ? r_scbond_it 'X-RAY DIFFRACTION' 414 5.426 8.000 ? ? r_scangle_it 'X-RAY DIFFRACTION' 392 8.411 11.000 ? ? # _refine_ls_shell.d_res_high 2.610 _refine_ls_shell.d_res_low 2.678 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 100.000 _refine_ls_shell.number_reflns_R_work 400 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.290 _refine_ls_shell.R_factor_R_free 0.226 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 13 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 413 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3ISY _struct.title 'Crystal structure of an intracellular proteinase inhibitor (ipi, bsu11130) from bacillus subtilis at 2.61 A resolution' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.text ;Intracellular proteinase inhibitor bsupi, beta sandwich, greek key, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, protein binding ; _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.entry_id 3ISY # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details 'ANALYTICAL SIZE EXCLUSION CHROMATOGRAPHY SUPPORTS THE ASSIGNMENT OF A MONOMER AS THE SIGNIFICANT OLIGOMERIZATION STATE IN SOLUTION.' # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASN 23 C ? ? ? 1_555 A MSE 24 N ? ? A ASN 22 A MSE 23 1_555 ? ? ? ? ? ? ? 1.308 ? ? covale2 covale both ? A MSE 24 C ? ? ? 1_555 A SER 25 N ? ? A MSE 23 A SER 24 1_555 ? ? ? ? ? ? ? 1.311 ? ? covale3 covale both ? A LYS 63 C ? ? ? 1_555 A MSE 64 N ? ? A LYS 62 A MSE 63 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale4 covale both ? A MSE 64 C ? ? ? 1_555 A PHE 65 N ? ? A MSE 63 A PHE 64 1_555 ? ? ? ? ? ? ? 1.329 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 3 ? C ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 7 ? GLN A 15 ? VAL A 6 GLN A 14 A 2 ILE A 20 ? ASN A 28 ? ILE A 19 ASN A 27 A 3 THR A 79 ? TRP A 86 ? THR A 78 TRP A 85 B 1 GLN A 70 ? LEU A 74 ? GLN A 69 LEU A 73 B 2 ILE A 34 ? PHE A 38 ? ILE A 33 PHE A 37 B 3 ARG A 104 ? ALA A 105 ? ARG A 103 ALA A 104 C 1 GLU A 55 ? ARG A 58 ? GLU A 54 ARG A 57 C 2 PHE A 44 ? TYR A 49 ? PHE A 43 TYR A 48 C 3 GLY A 93 ? PHE A 101 ? GLY A 92 PHE A 100 C 4 GLN A 112 ? VAL A 119 ? GLN A 111 VAL A 118 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 8 ? N VAL A 7 O LYS A 27 ? O LYS A 26 A 2 3 N PHE A 22 ? N PHE A 21 O ASP A 84 ? O ASP A 83 B 1 2 O LEU A 72 ? O LEU A 71 N PHE A 36 ? N PHE A 35 B 2 3 N GLN A 37 ? N GLN A 36 O ARG A 104 ? O ARG A 103 C 1 2 O ARG A 56 ? O ARG A 55 N VAL A 48 ? N VAL A 47 C 2 3 N TYR A 49 ? N TYR A 48 O GLU A 96 ? O GLU A 95 C 3 4 N GLY A 93 ? N GLY A 92 O VAL A 119 ? O VAL A 118 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id PG4 _struct_site.pdbx_auth_seq_id 120 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'BINDING SITE FOR RESIDUE PG4 A 120' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 TYR A 49 ? TYR A 48 . ? 10_755 ? 2 AC1 6 TYR A 49 ? TYR A 48 . ? 1_555 ? 3 AC1 6 HIS A 53 ? HIS A 52 . ? 1_555 ? 4 AC1 6 HIS A 53 ? HIS A 52 . ? 10_755 ? 5 AC1 6 GLU A 96 ? GLU A 95 . ? 1_555 ? 6 AC1 6 GLU A 96 ? GLU A 95 . ? 10_755 ? # _atom_sites.entry_id 3ISY _atom_sites.fract_transf_matrix[1][1] 0.013590 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013590 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007523 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 MSE 2 1 ? ? ? A . n A 1 3 GLU 3 2 ? ? ? A . n A 1 4 ASN 4 3 3 ASN ASN A . n A 1 5 GLN 5 4 4 GLN GLN A . n A 1 6 GLU 6 5 5 GLU GLU A . n A 1 7 VAL 7 6 6 VAL VAL A . n A 1 8 VAL 8 7 7 VAL VAL A . n A 1 9 LEU 9 8 8 LEU LEU A . n A 1 10 SER 10 9 9 SER SER A . n A 1 11 ILE 11 10 10 ILE ILE A . n A 1 12 ASP 12 11 11 ASP ASP A . n A 1 13 ALA 13 12 12 ALA ALA A . n A 1 14 ILE 14 13 13 ILE ILE A . n A 1 15 GLN 15 14 14 GLN GLN A . n A 1 16 GLU 16 15 15 GLU GLU A . n A 1 17 PRO 17 16 16 PRO PRO A . n A 1 18 GLU 18 17 17 GLU GLU A . n A 1 19 GLN 19 18 18 GLN GLN A . n A 1 20 ILE 20 19 19 ILE ILE A . n A 1 21 LYS 21 20 20 LYS LYS A . n A 1 22 PHE 22 21 21 PHE PHE A . n A 1 23 ASN 23 22 22 ASN ASN A . n A 1 24 MSE 24 23 23 MSE MSE A . n A 1 25 SER 25 24 24 SER SER A . n A 1 26 LEU 26 25 25 LEU LEU A . n A 1 27 LYS 27 26 26 LYS LYS A . n A 1 28 ASN 28 27 27 ASN ASN A . n A 1 29 GLN 29 28 28 GLN GLN A . n A 1 30 SER 30 29 29 SER SER A . n A 1 31 GLU 31 30 30 GLU GLU A . n A 1 32 ARG 32 31 31 ARG ARG A . n A 1 33 ALA 33 32 32 ALA ALA A . n A 1 34 ILE 34 33 33 ILE ILE A . n A 1 35 GLU 35 34 34 GLU GLU A . n A 1 36 PHE 36 35 35 PHE PHE A . n A 1 37 GLN 37 36 36 GLN GLN A . n A 1 38 PHE 38 37 37 PHE PHE A . n A 1 39 SER 39 38 38 SER SER A . n A 1 40 THR 40 39 39 THR THR A . n A 1 41 GLY 41 40 40 GLY GLY A . n A 1 42 GLN 42 41 41 GLN GLN A . n A 1 43 LYS 43 42 42 LYS LYS A . n A 1 44 PHE 44 43 43 PHE PHE A . n A 1 45 GLU 45 44 44 GLU GLU A . n A 1 46 LEU 46 45 45 LEU LEU A . n A 1 47 VAL 47 46 46 VAL VAL A . n A 1 48 VAL 48 47 47 VAL VAL A . n A 1 49 TYR 49 48 48 TYR TYR A . n A 1 50 ASP 50 49 49 ASP ASP A . n A 1 51 SER 51 50 50 SER SER A . n A 1 52 GLU 52 51 51 GLU GLU A . n A 1 53 HIS 53 52 52 HIS HIS A . n A 1 54 LYS 54 53 53 LYS LYS A . n A 1 55 GLU 55 54 54 GLU GLU A . n A 1 56 ARG 56 55 55 ARG ARG A . n A 1 57 TYR 57 56 56 TYR TYR A . n A 1 58 ARG 58 57 57 ARG ARG A . n A 1 59 TYR 59 58 58 TYR TYR A . n A 1 60 SER 60 59 59 SER SER A . n A 1 61 LYS 61 60 60 LYS LYS A . n A 1 62 GLU 62 61 61 GLU GLU A . n A 1 63 LYS 63 62 62 LYS LYS A . n A 1 64 MSE 64 63 63 MSE MSE A . n A 1 65 PHE 65 64 64 PHE PHE A . n A 1 66 THR 66 65 65 THR THR A . n A 1 67 GLN 67 66 66 GLN GLN A . n A 1 68 ALA 68 67 67 ALA ALA A . n A 1 69 PHE 69 68 68 PHE PHE A . n A 1 70 GLN 70 69 69 GLN GLN A . n A 1 71 ASN 71 70 70 ASN ASN A . n A 1 72 LEU 72 71 71 LEU LEU A . n A 1 73 THR 73 72 72 THR THR A . n A 1 74 LEU 74 73 73 LEU LEU A . n A 1 75 GLU 75 74 74 GLU GLU A . n A 1 76 SER 76 75 75 SER SER A . n A 1 77 GLY 77 76 76 GLY GLY A . n A 1 78 GLU 78 77 77 GLU GLU A . n A 1 79 THR 79 78 78 THR THR A . n A 1 80 TYR 80 79 79 TYR TYR A . n A 1 81 ASP 81 80 80 ASP ASP A . n A 1 82 PHE 82 81 81 PHE PHE A . n A 1 83 SER 83 82 82 SER SER A . n A 1 84 ASP 84 83 83 ASP ASP A . n A 1 85 VAL 85 84 84 VAL VAL A . n A 1 86 TRP 86 85 85 TRP TRP A . n A 1 87 LYS 87 86 86 LYS LYS A . n A 1 88 GLU 88 87 87 GLU GLU A . n A 1 89 VAL 89 88 88 VAL VAL A . n A 1 90 PRO 90 89 89 PRO PRO A . n A 1 91 GLU 91 90 90 GLU GLU A . n A 1 92 PRO 92 91 91 PRO PRO A . n A 1 93 GLY 93 92 92 GLY GLY A . n A 1 94 THR 94 93 93 THR THR A . n A 1 95 TYR 95 94 94 TYR TYR A . n A 1 96 GLU 96 95 95 GLU GLU A . n A 1 97 VAL 97 96 96 VAL VAL A . n A 1 98 LYS 98 97 97 LYS LYS A . n A 1 99 VAL 99 98 98 VAL VAL A . n A 1 100 THR 100 99 99 THR THR A . n A 1 101 PHE 101 100 100 PHE PHE A . n A 1 102 LYS 102 101 101 LYS LYS A . n A 1 103 GLY 103 102 102 GLY GLY A . n A 1 104 ARG 104 103 103 ARG ARG A . n A 1 105 ALA 105 104 104 ALA ALA A . n A 1 106 GLU 106 105 105 GLU GLU A . n A 1 107 ASN 107 106 106 ASN ASN A . n A 1 108 LEU 108 107 107 LEU LEU A . n A 1 109 LYS 109 108 108 LYS LYS A . n A 1 110 GLN 110 109 109 GLN GLN A . n A 1 111 VAL 111 110 110 VAL VAL A . n A 1 112 GLN 112 111 111 GLN GLN A . n A 1 113 ALA 113 112 112 ALA ALA A . n A 1 114 VAL 114 113 113 VAL VAL A . n A 1 115 GLN 115 114 114 GLN GLN A . n A 1 116 GLN 116 115 115 GLN GLN A . n A 1 117 PHE 117 116 116 PHE PHE A . n A 1 118 GLU 118 117 117 GLU GLU A . n A 1 119 VAL 119 118 118 VAL VAL A . n A 1 120 LYS 120 119 119 LYS LYS A . n # _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Joint Center for Structural Genomics' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center JCSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PG4 1 120 1 PG4 PG4 A . C 3 HOH 1 121 2 HOH HOH A . C 3 HOH 2 122 3 HOH HOH A . C 3 HOH 3 123 4 HOH HOH A . C 3 HOH 4 124 5 HOH HOH A . C 3 HOH 5 125 6 HOH HOH A . C 3 HOH 6 126 7 HOH HOH A . C 3 HOH 7 127 8 HOH HOH A . C 3 HOH 8 128 9 HOH HOH A . C 3 HOH 9 129 10 HOH HOH A . C 3 HOH 10 130 11 HOH HOH A . C 3 HOH 11 131 12 HOH HOH A . C 3 HOH 12 132 13 HOH HOH A . C 3 HOH 13 133 14 HOH HOH A . C 3 HOH 14 134 15 HOH HOH A . C 3 HOH 15 135 16 HOH HOH A . C 3 HOH 16 136 17 HOH HOH A . C 3 HOH 17 137 18 HOH HOH A . C 3 HOH 18 138 19 HOH HOH A . C 3 HOH 19 139 20 HOH HOH A . C 3 HOH 20 140 21 HOH HOH A . C 3 HOH 21 141 22 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 24 A MSE 23 ? MET SELENOMETHIONINE 2 A MSE 64 A MSE 63 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id PG4 _pdbx_struct_special_symmetry.auth_seq_id 120 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id PG4 _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-09-15 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2014-06-25 4 'Structure model' 1 3 2017-10-25 5 'Structure model' 1 4 2019-07-24 6 'Structure model' 1 5 2023-02-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Author supporting evidence' 5 4 'Structure model' 'Refinement description' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Derived calculations' 8 5 'Structure model' 'Refinement description' 9 6 'Structure model' 'Database references' 10 6 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_struct_assembly_auth_evidence 2 4 'Structure model' software 3 5 'Structure model' software 4 5 'Structure model' struct_conn 5 6 'Structure model' citation 6 6 'Structure model' database_2 7 6 'Structure model' struct_ref_seq_dif 8 6 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_software.classification' 2 4 'Structure model' '_software.name' 3 5 'Structure model' '_software.classification' 4 5 'Structure model' '_software.contact_author' 5 5 'Structure model' '_software.contact_author_email' 6 5 'Structure model' '_software.language' 7 5 'Structure model' '_software.location' 8 5 'Structure model' '_software.name' 9 5 'Structure model' '_software.type' 10 5 'Structure model' '_software.version' 11 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 12 6 'Structure model' '_citation.country' 13 6 'Structure model' '_citation.journal_id_ISSN' 14 6 'Structure model' '_database_2.pdbx_DOI' 15 6 'Structure model' '_database_2.pdbx_database_accession' 16 6 'Structure model' '_struct_ref_seq_dif.details' 17 6 'Structure model' '_struct_site.pdbx_auth_asym_id' 18 6 'Structure model' '_struct_site.pdbx_auth_comp_id' 19 6 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 63.0034 _pdbx_refine_tls.origin_y 9.7372 _pdbx_refine_tls.origin_z 34.1719 _pdbx_refine_tls.T[1][1] 0.1184 _pdbx_refine_tls.T[2][2] 0.0599 _pdbx_refine_tls.T[3][3] 0.0458 _pdbx_refine_tls.T[1][2] 0.0325 _pdbx_refine_tls.T[1][3] -0.0418 _pdbx_refine_tls.T[2][3] 0.0214 _pdbx_refine_tls.L[1][1] 0.8849 _pdbx_refine_tls.L[2][2] 2.7332 _pdbx_refine_tls.L[3][3] 1.2543 _pdbx_refine_tls.L[1][2] -0.3823 _pdbx_refine_tls.L[1][3] -0.3685 _pdbx_refine_tls.L[2][3] 0.7083 _pdbx_refine_tls.S[1][1] 0.0277 _pdbx_refine_tls.S[2][2] 0.0045 _pdbx_refine_tls.S[3][3] -0.0322 _pdbx_refine_tls.S[1][2] -0.1282 _pdbx_refine_tls.S[1][3] -0.1072 _pdbx_refine_tls.S[2][3] -0.0283 _pdbx_refine_tls.S[2][1] 0.0842 _pdbx_refine_tls.S[3][1] 0.2774 _pdbx_refine_tls.S[3][2] 0.0861 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 2 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 119 _pdbx_refine_tls_group.selection_details ? _pdbx_refine_tls_group.beg_label_asym_id . _pdbx_refine_tls_group.beg_label_seq_id . _pdbx_refine_tls_group.end_label_asym_id . _pdbx_refine_tls_group.end_label_seq_id . _pdbx_refine_tls_group.selection ? # _phasing.method MAD # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal REFMAC 5.5.0053 ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 1 PHENIX . ? package 'P.D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 2 SHELX . ? package 'George M. Sheldrick' gsheldr@shelx.uni-ac.gwdg.de phasing http://shelx.uni-ac.gwdg.de/SHELX/ Fortran_77 ? 3 MolProbity 3beta29 ? package 'D.C. & J.S. Richardson lab' molprobity@kinemage.biochem.duke.edu 'model building' http://kinemage.biochem.duke.edu/molprobity/ ? ? 4 XSCALE . ? package 'Wolfgang Kabsch' ? 'data scaling' http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ? ? 5 PDB_EXTRACT 3.006 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 6 XDS . ? ? ? ? 'data reduction' ? ? ? 7 SHELXD . ? ? ? ? phasing ? ? ? 8 autoSHARP . ? ? ? ? phasing ? ? ? 9 # _pdbx_entry_details.entry_id 3ISY _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THE CONSTRUCT WAS EXPRESSED WITH A PURIFICATION TAG MGSDKIHHHHHHENLYFQG. THE TAG WAS REMOVED WITH TEV PROTEASE LEAVING ONLY A GLYCINE (0) FOLLOWED BY THE TARGET SEQUENCE. ; _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 86 ? ? -90.96 37.67 2 1 GLU A 87 ? ? -163.23 118.55 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 17 ? CG ? A GLU 18 CG 2 1 Y 1 A GLU 17 ? CD ? A GLU 18 CD 3 1 Y 1 A GLU 17 ? OE1 ? A GLU 18 OE1 4 1 Y 1 A GLU 17 ? OE2 ? A GLU 18 OE2 5 1 Y 1 A LYS 60 ? CD ? A LYS 61 CD 6 1 Y 1 A LYS 60 ? CE ? A LYS 61 CE 7 1 Y 1 A LYS 60 ? NZ ? A LYS 61 NZ 8 1 Y 1 A LYS 97 ? CE ? A LYS 98 CE 9 1 Y 1 A LYS 97 ? NZ ? A LYS 98 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A MSE 1 ? A MSE 2 3 1 Y 1 A GLU 2 ? A GLU 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'TETRAETHYLENE GLYCOL' PG4 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #