data_3ITI # _entry.id 3ITI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.289 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3ITI RCSB RCSB054846 WWPDB D_1000054846 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3E3D 'Structure of hen egg white lysozyme with the magic triangle I3C' unspecified PDB 3E3S 'Structure of thaumatin with the magic triangle I3C' unspecified PDB 3E3T 'Structure of porcine pancreatic elastase with the magic triangle I3C' unspecified PDB 3GT3 'Structure of proteinase K with the MAD triangle B3C' unspecified PDB 3GT4 'Structure of proteinase K with the magic triangle I3C' unspecified # _pdbx_database_status.entry_id 3ITI _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-08-28 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Beck, T.' 1 'da Cunha, C.E.' 2 'Sheldrick, G.M.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'How to get the magic triangle and the MAD triangle into your protein crystal.' 'Acta Crystallogr.,Sect.F' 65 1068 1070 2009 ? DK 1744-3091 ? ? 19851024 10.1107/S1744309109036884 1 'The magic triangle goes MAD: phasing with a bromine derivative' 'Acta Crystallogr.,Sect.D' ? ? ? ? ABCRE6 DK 0907-4449 0766 ? ? ? 2 '5-Amino-2,4,6-tribromoisophthalic acid: the MAD triangle for experimental phasing' 'Acta Crystallogr.,Sect.C' 65 o237 o239 2009 ACSCEE DK 0108-2701 0591 ? 19407425 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Beck, T.' 1 primary 'da Cunha, C.E.' 2 primary 'Sheldrick, G.M.' 3 1 'Beck, T.' 4 1 'Gruene, T.' 5 1 'Sheldrick, G.M.' 6 2 'Beck, T.' 7 2 'Herbst-Irmer, R.' 8 2 'Sheldrick, G.M.' 9 # _cell.length_a 53.658 _cell.length_b 56.883 _cell.length_c 66.808 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 3ITI _cell.pdbx_unique_axis ? _cell.Z_PDB 4 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.entry_id 3ITI _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 19 _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'Cationic trypsin' 23324.287 1 3.4.21.4 ? ? ? 2 non-polymer syn '5-amino-2,4,6-tribromobenzene-1,3-dicarboxylic acid' 417.834 1 ? ? ? ? 3 non-polymer syn BENZAMIDINE 120.152 1 ? ? ? ? 4 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 5 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 6 water nat water 18.015 243 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Beta-trypsin, Alpha-trypsin chain 1, Alpha-trypsin chain 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN ; _entity_poly.pdbx_seq_one_letter_code_can ;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 VAL n 1 3 GLY n 1 4 GLY n 1 5 TYR n 1 6 THR n 1 7 CYS n 1 8 GLY n 1 9 ALA n 1 10 ASN n 1 11 THR n 1 12 VAL n 1 13 PRO n 1 14 TYR n 1 15 GLN n 1 16 VAL n 1 17 SER n 1 18 LEU n 1 19 ASN n 1 20 SER n 1 21 GLY n 1 22 TYR n 1 23 HIS n 1 24 PHE n 1 25 CYS n 1 26 GLY n 1 27 GLY n 1 28 SER n 1 29 LEU n 1 30 ILE n 1 31 ASN n 1 32 SER n 1 33 GLN n 1 34 TRP n 1 35 VAL n 1 36 VAL n 1 37 SER n 1 38 ALA n 1 39 ALA n 1 40 HIS n 1 41 CYS n 1 42 TYR n 1 43 LYS n 1 44 SER n 1 45 GLY n 1 46 ILE n 1 47 GLN n 1 48 VAL n 1 49 ARG n 1 50 LEU n 1 51 GLY n 1 52 GLU n 1 53 ASP n 1 54 ASN n 1 55 ILE n 1 56 ASN n 1 57 VAL n 1 58 VAL n 1 59 GLU n 1 60 GLY n 1 61 ASN n 1 62 GLU n 1 63 GLN n 1 64 PHE n 1 65 ILE n 1 66 SER n 1 67 ALA n 1 68 SER n 1 69 LYS n 1 70 SER n 1 71 ILE n 1 72 VAL n 1 73 HIS n 1 74 PRO n 1 75 SER n 1 76 TYR n 1 77 ASN n 1 78 SER n 1 79 ASN n 1 80 THR n 1 81 LEU n 1 82 ASN n 1 83 ASN n 1 84 ASP n 1 85 ILE n 1 86 MET n 1 87 LEU n 1 88 ILE n 1 89 LYS n 1 90 LEU n 1 91 LYS n 1 92 SER n 1 93 ALA n 1 94 ALA n 1 95 SER n 1 96 LEU n 1 97 ASN n 1 98 SER n 1 99 ARG n 1 100 VAL n 1 101 ALA n 1 102 SER n 1 103 ILE n 1 104 SER n 1 105 LEU n 1 106 PRO n 1 107 THR n 1 108 SER n 1 109 CYS n 1 110 ALA n 1 111 SER n 1 112 ALA n 1 113 GLY n 1 114 THR n 1 115 GLN n 1 116 CYS n 1 117 LEU n 1 118 ILE n 1 119 SER n 1 120 GLY n 1 121 TRP n 1 122 GLY n 1 123 ASN n 1 124 THR n 1 125 LYS n 1 126 SER n 1 127 SER n 1 128 GLY n 1 129 THR n 1 130 SER n 1 131 TYR n 1 132 PRO n 1 133 ASP n 1 134 VAL n 1 135 LEU n 1 136 LYS n 1 137 CYS n 1 138 LEU n 1 139 LYS n 1 140 ALA n 1 141 PRO n 1 142 ILE n 1 143 LEU n 1 144 SER n 1 145 ASP n 1 146 SER n 1 147 SER n 1 148 CYS n 1 149 LYS n 1 150 SER n 1 151 ALA n 1 152 TYR n 1 153 PRO n 1 154 GLY n 1 155 GLN n 1 156 ILE n 1 157 THR n 1 158 SER n 1 159 ASN n 1 160 MET n 1 161 PHE n 1 162 CYS n 1 163 ALA n 1 164 GLY n 1 165 TYR n 1 166 LEU n 1 167 GLU n 1 168 GLY n 1 169 GLY n 1 170 LYS n 1 171 ASP n 1 172 SER n 1 173 CYS n 1 174 GLN n 1 175 GLY n 1 176 ASP n 1 177 SER n 1 178 GLY n 1 179 GLY n 1 180 PRO n 1 181 VAL n 1 182 VAL n 1 183 CYS n 1 184 SER n 1 185 GLY n 1 186 LYS n 1 187 LEU n 1 188 GLN n 1 189 GLY n 1 190 ILE n 1 191 VAL n 1 192 SER n 1 193 TRP n 1 194 GLY n 1 195 SER n 1 196 GLY n 1 197 CYS n 1 198 ALA n 1 199 GLN n 1 200 LYS n 1 201 ASN n 1 202 LYS n 1 203 PRO n 1 204 GLY n 1 205 VAL n 1 206 TYR n 1 207 THR n 1 208 LYS n 1 209 VAL n 1 210 CYS n 1 211 ASN n 1 212 TYR n 1 213 VAL n 1 214 SER n 1 215 TRP n 1 216 ILE n 1 217 LYS n 1 218 GLN n 1 219 THR n 1 220 ILE n 1 221 ALA n 1 222 SER n 1 223 ASN n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'bovine,cow,domestic cattle,domestic cow' _entity_src_nat.pdbx_organism_scientific 'Bos taurus' _entity_src_nat.pdbx_ncbi_taxonomy_id 9913 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRY1_BOVIN _struct_ref.pdbx_db_accession P00760 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN ; _struct_ref.pdbx_align_begin 24 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3ITI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 223 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00760 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 246 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 223 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BEN non-polymer . BENZAMIDINE ? 'C7 H8 N2' 120.152 BRV non-polymer . '5-amino-2,4,6-tribromobenzene-1,3-dicarboxylic acid' '5-Amino-2,4,6-tribromoisophthalic acid' 'C8 H4 Br3 N O4' 417.834 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3ITI _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.19 _exptl_crystal.density_percent_sol 43.72 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 9.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;precipitant: 30% PEG 3000, 0.1 M CHES, protein 60 mg/ml, drop size 100 nL protein solution plus 100 nl precipitant, pH 9.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K ; # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'BRUKER SMART 6000' _diffrn_detector.pdbx_collection_date 2009-01-23 _diffrn_detector.details 'MULTI-LAYER INCOATEC OPTICS' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'MULTI-LAYER INCOATEC OPTICS' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54178 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type MACSCIENCE _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.54178 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 3ITI _reflns.observed_criterion_sigma_I 0.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 41.840 _reflns.d_resolution_high 1.550 _reflns.number_obs 30398 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.06580 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 18.9000 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 7.690 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.55 _reflns_shell.d_res_low 1.65 _reflns_shell.percent_possible_all 99.7 _reflns_shell.Rmerge_I_obs 0.28800 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.870 _reflns_shell.pdbx_redundancy 3.61 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 3ITI _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all 30344 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 41.84 _refine.ls_d_res_high 1.55 _refine.ls_percent_reflns_obs 99.9 _refine.ls_R_factor_obs 0.168 _refine.ls_R_factor_all 0.168 _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free 0.213 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 1529 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min 0.14 _refine.occupancy_max 1.00 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 15.425 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details NONE _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method 'FREE R' _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'ENGH AND HUBER' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1599 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.number_atoms_solvent 243 _refine_hist.number_atoms_total 1869 _refine_hist.d_res_high 1.55 _refine_hist.d_res_low 41.84 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function s_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? s_angle_d 0.024 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_dist 0.000 ? ? ? 'X-RAY DIFFRACTION' ? s_from_restr_planes 0.497 ? ? ? 'X-RAY DIFFRACTION' ? s_zero_chiral_vol 0.050 ? ? ? 'X-RAY DIFFRACTION' ? s_non_zero_chiral_vol 0.052 ? ? ? 'X-RAY DIFFRACTION' ? s_anti_bump_dis_restr 0.013 ? ? ? 'X-RAY DIFFRACTION' ? s_rigid_bond_adp_cmpnt 0.000 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_adp_cmpnt 0.044 ? ? ? 'X-RAY DIFFRACTION' ? s_approx_iso_adps 0.000 ? ? ? 'X-RAY DIFFRACTION' ? # _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.entry_id 3ITI _pdbx_refine.R_factor_all_no_cutoff 0.168 _pdbx_refine.R_factor_obs_no_cutoff 0.168 _pdbx_refine.free_R_factor_no_cutoff 0.213 _pdbx_refine.free_R_error_no_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff ? _pdbx_refine.free_R_val_test_set_ct_no_cutoff 1529 _pdbx_refine.R_factor_all_4sig_cutoff ? _pdbx_refine.R_factor_obs_4sig_cutoff ? _pdbx_refine.free_R_factor_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff ? _pdbx_refine.number_reflns_obs_4sig_cutoff ? # _struct.entry_id 3ITI _struct.title 'Structure of bovine trypsin with the MAD triangle B3C' _struct.pdbx_descriptor 'Cationic trypsin (E.C.3.4.21.4)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3ITI _struct_keywords.text ;Phasing tool, 5-Amino-2, 4, 6-tribromoisophthalic acid, B3C, mad triangle, I3C, magic triangle, Digestion, Disulfide bond, Hydrolase, Metal-binding, Protease, Secreted, Serine protease, Zymogen ; _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 38 ? TYR A 42 ? ALA A 38 TYR A 42 5 ? 5 HELX_P HELX_P2 2 SER A 144 ? TYR A 152 ? SER A 144 TYR A 152 1 ? 9 HELX_P HELX_P3 3 TYR A 212 ? ALA A 221 ? TYR A 212 ALA A 221 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 137 SG ? ? A CYS 7 A CYS 137 1_555 ? ? ? ? ? ? ? 2.022 ? disulf2 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 25 A CYS 41 1_555 ? ? ? ? ? ? ? 2.044 ? disulf3 disulf ? ? A CYS 109 SG ? ? ? 1_555 A CYS 210 SG ? ? A CYS 109 A CYS 210 1_555 ? ? ? ? ? ? ? 2.048 ? disulf4 disulf ? ? A CYS 116 SG ? ? ? 1_555 A CYS 183 SG ? ? A CYS 116 A CYS 183 1_555 ? ? ? ? ? ? ? 1.997 ? disulf5 disulf ? ? A CYS 148 SG ? ? ? 1_555 A CYS 162 SG ? ? A CYS 148 A CYS 162 1_555 ? ? ? ? ? ? ? 2.022 ? disulf6 disulf ? ? A CYS 173 SG ? ? ? 1_555 A CYS 197 SG ? ? A CYS 173 A CYS 197 1_555 ? ? ? ? ? ? ? 2.029 ? metalc1 metalc ? ? A GLU 52 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 52 A CA 303 1_555 ? ? ? ? ? ? ? 2.312 ? metalc2 metalc ? ? A ASN 54 O ? ? ? 1_555 D CA . CA ? ? A ASN 54 A CA 303 1_555 ? ? ? ? ? ? ? 2.241 ? metalc3 metalc ? ? A VAL 57 O ? ? ? 1_555 D CA . CA ? ? A VAL 57 A CA 303 1_555 ? ? ? ? ? ? ? 2.267 ? metalc4 metalc ? ? A GLU 62 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 62 A CA 303 1_555 ? ? ? ? ? ? ? 2.339 ? metalc5 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 303 A HOH 503 1_555 ? ? ? ? ? ? ? 2.405 ? metalc6 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 303 A HOH 406 1_555 ? ? ? ? ? ? ? 2.383 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 5 ? THR A 6 ? TYR A 5 THR A 6 A 2 LYS A 136 ? PRO A 141 ? LYS A 136 PRO A 141 A 3 GLN A 115 ? GLY A 120 ? GLN A 115 GLY A 120 A 4 PRO A 180 ? CYS A 183 ? PRO A 180 CYS A 183 A 5 LYS A 186 ? TRP A 193 ? LYS A 186 TRP A 193 A 6 GLY A 204 ? LYS A 208 ? GLY A 204 LYS A 208 A 7 MET A 160 ? ALA A 163 ? MET A 160 ALA A 163 B 1 GLN A 15 ? ASN A 19 ? GLN A 15 ASN A 19 B 2 HIS A 23 ? ASN A 31 ? HIS A 23 ASN A 31 B 3 TRP A 34 ? SER A 37 ? TRP A 34 SER A 37 B 4 MET A 86 ? LEU A 90 ? MET A 86 LEU A 90 B 5 GLN A 63 ? VAL A 72 ? GLN A 63 VAL A 72 B 6 GLN A 47 ? LEU A 50 ? GLN A 47 LEU A 50 B 7 GLN A 15 ? ASN A 19 ? GLN A 15 ASN A 19 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 5 ? N TYR A 5 O CYS A 137 ? O CYS A 137 A 2 3 O ALA A 140 ? O ALA A 140 N CYS A 116 ? N CYS A 116 A 3 4 N LEU A 117 ? N LEU A 117 O VAL A 182 ? O VAL A 182 A 4 5 N VAL A 181 ? N VAL A 181 O GLY A 189 ? O GLY A 189 A 5 6 N TRP A 193 ? N TRP A 193 O VAL A 205 ? O VAL A 205 A 6 7 O TYR A 206 ? O TYR A 206 N PHE A 161 ? N PHE A 161 B 1 2 N LEU A 18 ? N LEU A 18 O CYS A 25 ? O CYS A 25 B 2 3 N SER A 28 ? N SER A 28 O VAL A 36 ? O VAL A 36 B 3 4 N SER A 37 ? N SER A 37 O MET A 86 ? O MET A 86 B 4 5 O LEU A 87 ? O LEU A 87 N ILE A 71 ? N ILE A 71 B 5 6 O ILE A 65 ? O ILE A 65 N VAL A 48 ? N VAL A 48 B 6 7 O GLN A 47 ? O GLN A 47 N ASN A 19 ? N ASN A 19 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE BRV A 301' AC2 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE BEN A 302' AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 303' AC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 19 SER A 108 ? SER A 108 . ? 1_555 ? 2 AC1 19 CYS A 109 ? CYS A 109 . ? 1_555 ? 3 AC1 19 ALA A 110 ? ALA A 110 . ? 1_555 ? 4 AC1 19 SER A 111 ? SER A 111 . ? 1_555 ? 5 AC1 19 THR A 114 ? THR A 114 . ? 1_555 ? 6 AC1 19 ASN A 123 ? ASN A 123 . ? 3_755 ? 7 AC1 19 SER A 126 ? SER A 126 . ? 3_755 ? 8 AC1 19 SER A 127 ? SER A 127 . ? 3_755 ? 9 AC1 19 GLY A 128 ? GLY A 128 . ? 3_755 ? 10 AC1 19 THR A 129 ? THR A 129 . ? 3_755 ? 11 AC1 19 TYR A 131 ? TYR A 131 . ? 3_755 ? 12 AC1 19 CYS A 173 ? CYS A 173 . ? 3_755 ? 13 AC1 19 GLN A 174 ? GLN A 174 . ? 3_755 ? 14 AC1 19 SER A 184 ? SER A 184 . ? 1_555 ? 15 AC1 19 LYS A 186 ? LYS A 186 . ? 1_555 ? 16 AC1 19 HOH F . ? HOH A 414 . ? 1_555 ? 17 AC1 19 HOH F . ? HOH A 420 . ? 1_555 ? 18 AC1 19 HOH F . ? HOH A 496 . ? 1_555 ? 19 AC1 19 HOH F . ? HOH A 522 . ? 1_555 ? 20 AC2 9 ASP A 171 ? ASP A 171 . ? 1_555 ? 21 AC2 9 SER A 172 ? SER A 172 . ? 1_555 ? 22 AC2 9 CYS A 173 ? CYS A 173 . ? 1_555 ? 23 AC2 9 SER A 177 ? SER A 177 . ? 1_555 ? 24 AC2 9 TRP A 193 ? TRP A 193 . ? 1_555 ? 25 AC2 9 GLY A 194 ? GLY A 194 . ? 1_555 ? 26 AC2 9 GLY A 196 ? GLY A 196 . ? 1_555 ? 27 AC2 9 GLY A 204 ? GLY A 204 . ? 1_555 ? 28 AC2 9 HOH F . ? HOH A 403 . ? 1_555 ? 29 AC3 6 GLU A 52 ? GLU A 52 . ? 1_555 ? 30 AC3 6 ASN A 54 ? ASN A 54 . ? 1_555 ? 31 AC3 6 VAL A 57 ? VAL A 57 . ? 1_555 ? 32 AC3 6 GLU A 62 ? GLU A 62 . ? 1_555 ? 33 AC3 6 HOH F . ? HOH A 406 . ? 1_555 ? 34 AC3 6 HOH F . ? HOH A 503 . ? 1_555 ? 35 AC4 1 SER A 146 ? SER A 146 . ? 1_555 ? # _database_PDB_matrix.entry_id 3ITI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.000000 _database_PDB_matrix.origx_vector[2] 0.000000 _database_PDB_matrix.origx_vector[3] 0.000000 # _atom_sites.entry_id 3ITI _atom_sites.fract_transf_matrix[1][1] 0.018637 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017580 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014968 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol BR C CA CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 1 1 ILE ILE A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 TRP 34 34 34 TRP TRP A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 CYS 109 109 109 CYS CYS A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 CYS 116 116 116 CYS CYS A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 TRP 121 121 121 TRP TRP A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 TYR 131 131 131 TYR TYR A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 CYS 137 137 137 CYS CYS A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 CYS 148 148 148 CYS CYS A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 TYR 152 152 152 TYR TYR A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 MET 160 160 160 MET MET A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 CYS 162 162 162 CYS CYS A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 TYR 165 165 165 TYR TYR A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 LYS 170 170 170 LYS LYS A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 SER 172 172 172 SER SER A . n A 1 173 CYS 173 173 173 CYS CYS A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 GLY 175 175 175 GLY GLY A . n A 1 176 ASP 176 176 176 ASP ASP A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 PRO 180 180 180 PRO PRO A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 CYS 183 183 183 CYS CYS A . n A 1 184 SER 184 184 184 SER SER A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 LYS 186 186 186 LYS LYS A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 GLN 188 188 188 GLN GLN A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 ILE 190 190 190 ILE ILE A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 SER 192 192 192 SER SER A . n A 1 193 TRP 193 193 193 TRP TRP A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 SER 195 195 195 SER SER A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 CYS 197 197 197 CYS CYS A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 GLN 199 199 199 GLN GLN A . n A 1 200 LYS 200 200 200 LYS LYS A . n A 1 201 ASN 201 201 201 ASN ASN A . n A 1 202 LYS 202 202 202 LYS LYS A . n A 1 203 PRO 203 203 203 PRO PRO A . n A 1 204 GLY 204 204 204 GLY GLY A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 TYR 206 206 206 TYR TYR A . n A 1 207 THR 207 207 207 THR THR A . n A 1 208 LYS 208 208 208 LYS LYS A . n A 1 209 VAL 209 209 209 VAL VAL A . n A 1 210 CYS 210 210 210 CYS CYS A . n A 1 211 ASN 211 211 211 ASN ASN A . n A 1 212 TYR 212 212 212 TYR TYR A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 SER 214 214 214 SER SER A . n A 1 215 TRP 215 215 215 TRP TRP A . n A 1 216 ILE 216 216 216 ILE ILE A . n A 1 217 LYS 217 217 217 LYS LYS A . n A 1 218 GLN 218 218 218 GLN GLN A . n A 1 219 THR 219 219 219 THR THR A . n A 1 220 ILE 220 220 220 ILE ILE A . n A 1 221 ALA 221 221 221 ALA ALA A . n A 1 222 SER 222 222 222 SER SER A . n A 1 223 ASN 223 223 223 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BRV 1 301 301 BRV BRV A . C 3 BEN 1 302 302 BEN BEN A . D 4 CA 1 303 303 CA CA A . E 5 CL 1 304 304 CL CL A . F 6 HOH 1 401 401 HOH HOH A . F 6 HOH 2 402 402 HOH HOH A . F 6 HOH 3 403 403 HOH HOH A . F 6 HOH 4 404 404 HOH HOH A . F 6 HOH 5 405 405 HOH HOH A . F 6 HOH 6 406 406 HOH HOH A . F 6 HOH 7 407 407 HOH HOH A . F 6 HOH 8 408 408 HOH HOH A . F 6 HOH 9 409 409 HOH HOH A . F 6 HOH 10 410 410 HOH HOH A . F 6 HOH 11 411 411 HOH HOH A . F 6 HOH 12 412 412 HOH HOH A . F 6 HOH 13 413 413 HOH HOH A . F 6 HOH 14 414 414 HOH HOH A . F 6 HOH 15 415 415 HOH HOH A . F 6 HOH 16 416 416 HOH HOH A . F 6 HOH 17 417 417 HOH HOH A . F 6 HOH 18 418 418 HOH HOH A . F 6 HOH 19 419 419 HOH HOH A . F 6 HOH 20 420 420 HOH HOH A . F 6 HOH 21 421 421 HOH HOH A . F 6 HOH 22 422 422 HOH HOH A . F 6 HOH 23 423 423 HOH HOH A . F 6 HOH 24 424 424 HOH HOH A . F 6 HOH 25 425 425 HOH HOH A . F 6 HOH 26 426 426 HOH HOH A . F 6 HOH 27 427 427 HOH HOH A . F 6 HOH 28 428 428 HOH HOH A . F 6 HOH 29 429 429 HOH HOH A . F 6 HOH 30 430 430 HOH HOH A . F 6 HOH 31 431 431 HOH HOH A . F 6 HOH 32 432 432 HOH HOH A . F 6 HOH 33 433 433 HOH HOH A . F 6 HOH 34 434 434 HOH HOH A . F 6 HOH 35 435 435 HOH HOH A . F 6 HOH 36 436 436 HOH HOH A . F 6 HOH 37 437 437 HOH HOH A . F 6 HOH 38 438 438 HOH HOH A . F 6 HOH 39 439 439 HOH HOH A . F 6 HOH 40 440 440 HOH HOH A . F 6 HOH 41 441 441 HOH HOH A . F 6 HOH 42 442 442 HOH HOH A . F 6 HOH 43 443 443 HOH HOH A . F 6 HOH 44 444 444 HOH HOH A . F 6 HOH 45 445 445 HOH HOH A . F 6 HOH 46 446 446 HOH HOH A . F 6 HOH 47 447 447 HOH HOH A . F 6 HOH 48 448 448 HOH HOH A . F 6 HOH 49 449 449 HOH HOH A . F 6 HOH 50 450 450 HOH HOH A . F 6 HOH 51 451 451 HOH HOH A . F 6 HOH 52 452 452 HOH HOH A . F 6 HOH 53 453 453 HOH HOH A . F 6 HOH 54 454 454 HOH HOH A . F 6 HOH 55 455 455 HOH HOH A . F 6 HOH 56 456 456 HOH HOH A . F 6 HOH 57 457 457 HOH HOH A . F 6 HOH 58 458 458 HOH HOH A . F 6 HOH 59 459 459 HOH HOH A . F 6 HOH 60 460 460 HOH HOH A . F 6 HOH 61 461 461 HOH HOH A . F 6 HOH 62 462 462 HOH HOH A . F 6 HOH 63 463 463 HOH HOH A . F 6 HOH 64 464 464 HOH HOH A . F 6 HOH 65 465 465 HOH HOH A . F 6 HOH 66 466 466 HOH HOH A . F 6 HOH 67 467 467 HOH HOH A . F 6 HOH 68 468 468 HOH HOH A . F 6 HOH 69 469 469 HOH HOH A . F 6 HOH 70 470 470 HOH HOH A . F 6 HOH 71 471 471 HOH HOH A . F 6 HOH 72 472 472 HOH HOH A . F 6 HOH 73 473 473 HOH HOH A . F 6 HOH 74 474 474 HOH HOH A . F 6 HOH 75 475 475 HOH HOH A . F 6 HOH 76 476 476 HOH HOH A . F 6 HOH 77 477 477 HOH HOH A . F 6 HOH 78 478 478 HOH HOH A . F 6 HOH 79 479 479 HOH HOH A . F 6 HOH 80 480 480 HOH HOH A . F 6 HOH 81 481 481 HOH HOH A . F 6 HOH 82 482 482 HOH HOH A . F 6 HOH 83 483 483 HOH HOH A . F 6 HOH 84 484 484 HOH HOH A . F 6 HOH 85 485 485 HOH HOH A . F 6 HOH 86 486 486 HOH HOH A . F 6 HOH 87 487 487 HOH HOH A . F 6 HOH 88 488 488 HOH HOH A . F 6 HOH 89 489 489 HOH HOH A . F 6 HOH 90 490 490 HOH HOH A . F 6 HOH 91 491 491 HOH HOH A . F 6 HOH 92 492 492 HOH HOH A . F 6 HOH 93 493 493 HOH HOH A . F 6 HOH 94 494 494 HOH HOH A . F 6 HOH 95 495 495 HOH HOH A . F 6 HOH 96 496 496 HOH HOH A . F 6 HOH 97 497 497 HOH HOH A . F 6 HOH 98 498 498 HOH HOH A . F 6 HOH 99 499 499 HOH HOH A . F 6 HOH 100 500 500 HOH HOH A . F 6 HOH 101 501 501 HOH HOH A . F 6 HOH 102 502 502 HOH HOH A . F 6 HOH 103 503 503 HOH HOH A . F 6 HOH 104 504 504 HOH HOH A . F 6 HOH 105 505 505 HOH HOH A . F 6 HOH 106 506 506 HOH HOH A . F 6 HOH 107 507 507 HOH HOH A . F 6 HOH 108 508 508 HOH HOH A . F 6 HOH 109 509 509 HOH HOH A . F 6 HOH 110 510 510 HOH HOH A . F 6 HOH 111 511 511 HOH HOH A . F 6 HOH 112 512 512 HOH HOH A . F 6 HOH 113 513 513 HOH HOH A . F 6 HOH 114 514 514 HOH HOH A . F 6 HOH 115 515 515 HOH HOH A . F 6 HOH 116 516 516 HOH HOH A . F 6 HOH 117 517 517 HOH HOH A . F 6 HOH 118 518 518 HOH HOH A . F 6 HOH 119 519 519 HOH HOH A . F 6 HOH 120 520 520 HOH HOH A . F 6 HOH 121 521 521 HOH HOH A . F 6 HOH 122 522 522 HOH HOH A . F 6 HOH 123 523 523 HOH HOH A . F 6 HOH 124 524 524 HOH HOH A . F 6 HOH 125 525 525 HOH HOH A . F 6 HOH 126 526 526 HOH HOH A . F 6 HOH 127 527 527 HOH HOH A . F 6 HOH 128 528 528 HOH HOH A . F 6 HOH 129 529 529 HOH HOH A . F 6 HOH 130 530 530 HOH HOH A . F 6 HOH 131 531 531 HOH HOH A . F 6 HOH 132 532 532 HOH HOH A . F 6 HOH 133 533 533 HOH HOH A . F 6 HOH 134 534 534 HOH HOH A . F 6 HOH 135 535 535 HOH HOH A . F 6 HOH 136 536 536 HOH HOH A . F 6 HOH 137 537 537 HOH HOH A . F 6 HOH 138 538 538 HOH HOH A . F 6 HOH 139 539 539 HOH HOH A . F 6 HOH 140 540 540 HOH HOH A . F 6 HOH 141 541 541 HOH HOH A . F 6 HOH 142 542 542 HOH HOH A . F 6 HOH 143 543 543 HOH HOH A . F 6 HOH 144 544 544 HOH HOH A . F 6 HOH 145 545 545 HOH HOH A . F 6 HOH 146 546 546 HOH HOH A . F 6 HOH 147 547 547 HOH HOH A . F 6 HOH 148 548 548 HOH HOH A . F 6 HOH 149 549 549 HOH HOH A . F 6 HOH 150 550 550 HOH HOH A . F 6 HOH 151 551 551 HOH HOH A . F 6 HOH 152 552 552 HOH HOH A . F 6 HOH 153 553 553 HOH HOH A . F 6 HOH 154 554 554 HOH HOH A . F 6 HOH 155 555 555 HOH HOH A . F 6 HOH 156 556 556 HOH HOH A . F 6 HOH 157 557 557 HOH HOH A . F 6 HOH 158 558 558 HOH HOH A . F 6 HOH 159 559 559 HOH HOH A . F 6 HOH 160 560 560 HOH HOH A . F 6 HOH 161 561 561 HOH HOH A . F 6 HOH 162 562 562 HOH HOH A . F 6 HOH 163 563 563 HOH HOH A . F 6 HOH 164 564 564 HOH HOH A . F 6 HOH 165 565 565 HOH HOH A . F 6 HOH 166 566 566 HOH HOH A . F 6 HOH 167 567 567 HOH HOH A . F 6 HOH 168 568 568 HOH HOH A . F 6 HOH 169 569 569 HOH HOH A . F 6 HOH 170 570 570 HOH HOH A . F 6 HOH 171 571 571 HOH HOH A . F 6 HOH 172 572 572 HOH HOH A . F 6 HOH 173 573 573 HOH HOH A . F 6 HOH 174 574 574 HOH HOH A . F 6 HOH 175 575 575 HOH HOH A . F 6 HOH 176 576 576 HOH HOH A . F 6 HOH 177 577 577 HOH HOH A . F 6 HOH 178 578 578 HOH HOH A . F 6 HOH 179 579 579 HOH HOH A . F 6 HOH 180 580 580 HOH HOH A . F 6 HOH 181 581 581 HOH HOH A . F 6 HOH 182 582 582 HOH HOH A . F 6 HOH 183 583 583 HOH HOH A . F 6 HOH 184 584 584 HOH HOH A . F 6 HOH 185 585 585 HOH HOH A . F 6 HOH 186 586 586 HOH HOH A . F 6 HOH 187 587 587 HOH HOH A . F 6 HOH 188 588 588 HOH HOH A . F 6 HOH 189 589 589 HOH HOH A . F 6 HOH 190 590 590 HOH HOH A . F 6 HOH 191 591 591 HOH HOH A . F 6 HOH 192 592 592 HOH HOH A . F 6 HOH 193 593 593 HOH HOH A . F 6 HOH 194 594 594 HOH HOH A . F 6 HOH 195 595 595 HOH HOH A . F 6 HOH 196 596 596 HOH HOH A . F 6 HOH 197 597 597 HOH HOH A . F 6 HOH 198 598 598 HOH HOH A . F 6 HOH 199 599 599 HOH HOH A . F 6 HOH 200 600 600 HOH HOH A . F 6 HOH 201 601 601 HOH HOH A . F 6 HOH 202 602 602 HOH HOH A . F 6 HOH 203 603 603 HOH HOH A . F 6 HOH 204 604 604 HOH HOH A . F 6 HOH 205 605 605 HOH HOH A . F 6 HOH 206 606 606 HOH HOH A . F 6 HOH 207 607 607 HOH HOH A . F 6 HOH 208 608 608 HOH HOH A . F 6 HOH 209 609 609 HOH HOH A . F 6 HOH 210 610 610 HOH HOH A . F 6 HOH 211 611 611 HOH HOH A . F 6 HOH 212 612 612 HOH HOH A . F 6 HOH 213 613 613 HOH HOH A . F 6 HOH 214 614 614 HOH HOH A . F 6 HOH 215 615 615 HOH HOH A . F 6 HOH 216 616 616 HOH HOH A . F 6 HOH 217 617 617 HOH HOH A . F 6 HOH 218 618 618 HOH HOH A . F 6 HOH 219 619 619 HOH HOH A . F 6 HOH 220 620 620 HOH HOH A . F 6 HOH 221 621 621 HOH HOH A . F 6 HOH 222 622 622 HOH HOH A . F 6 HOH 223 623 623 HOH HOH A . F 6 HOH 224 624 624 HOH HOH A . F 6 HOH 225 625 625 HOH HOH A . F 6 HOH 226 626 626 HOH HOH A . F 6 HOH 227 627 627 HOH HOH A . F 6 HOH 228 628 628 HOH HOH A . F 6 HOH 229 629 629 HOH HOH A . F 6 HOH 230 630 630 HOH HOH A . F 6 HOH 231 631 631 HOH HOH A . F 6 HOH 232 632 632 HOH HOH A . F 6 HOH 233 633 633 HOH HOH A . F 6 HOH 234 634 634 HOH HOH A . F 6 HOH 235 635 635 HOH HOH A . F 6 HOH 236 636 636 HOH HOH A . F 6 HOH 237 637 637 HOH HOH A . F 6 HOH 238 638 638 HOH HOH A . F 6 HOH 239 639 639 HOH HOH A . F 6 HOH 240 640 640 HOH HOH A . F 6 HOH 241 641 641 HOH HOH A . F 6 HOH 242 642 642 HOH HOH A . F 6 HOH 243 643 643 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 52 ? A GLU 52 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? A ASN 54 ? A ASN 54 ? 1_555 89.6 ? 2 OE2 ? A GLU 52 ? A GLU 52 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? A VAL 57 ? A VAL 57 ? 1_555 163.3 ? 3 O ? A ASN 54 ? A ASN 54 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? A VAL 57 ? A VAL 57 ? 1_555 82.8 ? 4 OE2 ? A GLU 52 ? A GLU 52 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 OE2 ? A GLU 62 ? A GLU 62 ? 1_555 100.2 ? 5 O ? A ASN 54 ? A ASN 54 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 OE2 ? A GLU 62 ? A GLU 62 ? 1_555 161.9 ? 6 O ? A VAL 57 ? A VAL 57 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 OE2 ? A GLU 62 ? A GLU 62 ? 1_555 91.3 ? 7 OE2 ? A GLU 52 ? A GLU 52 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 503 ? 1_555 77.5 ? 8 O ? A ASN 54 ? A ASN 54 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 503 ? 1_555 103.8 ? 9 O ? A VAL 57 ? A VAL 57 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 503 ? 1_555 89.8 ? 10 OE2 ? A GLU 62 ? A GLU 62 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 503 ? 1_555 93.2 ? 11 OE2 ? A GLU 52 ? A GLU 52 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 406 ? 1_555 86.4 ? 12 O ? A ASN 54 ? A ASN 54 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 406 ? 1_555 88.6 ? 13 O ? A VAL 57 ? A VAL 57 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 406 ? 1_555 108.2 ? 14 OE2 ? A GLU 62 ? A GLU 62 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 406 ? 1_555 77.0 ? 15 O ? F HOH . ? A HOH 503 ? 1_555 CA ? D CA . ? A CA 303 ? 1_555 O ? F HOH . ? A HOH 406 ? 1_555 159.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-10-27 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-03-21 4 'Structure model' 1 3 2018-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation_author # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_citation_author.name' # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 SHELX . ? package 'George M. Sheldrick' gsheldr@shelx.uni-ac.gwdg.de refinement http://shelx.uni-ac.gwdg.de/SHELX/ Fortran_77 ? 2 PDB_EXTRACT 3.005 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 3 SAINT . ? ? ? ? 'data reduction' ? ? ? 4 SADABS . ? ? ? ? 'data scaling' ? ? ? 5 SHELXD . ? ? ? ? phasing ? ? ? 6 SHELXL-97 . ? ? ? ? refinement ? ? ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A TYR 206 ? ? CG A TYR 206 ? ? CD2 A TYR 206 ? ? 124.64 121.00 3.64 0.60 N 2 1 CB A TYR 212 ? ? CG A TYR 212 ? ? CD1 A TYR 212 ? ? 117.36 121.00 -3.64 0.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 12 ? ? -119.49 73.02 2 1 ASP A 53 ? ? -121.10 -78.15 3 1 SER A 177 ? ? -35.95 133.95 4 1 SER A 192 ? ? -123.76 -65.06 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 49 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.087 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 44 ? OG ? A SER 44 OG 2 1 Y 1 A LYS 91 ? CG ? A LYS 91 CG 3 1 Y 1 A LYS 91 ? CD ? A LYS 91 CD 4 1 Y 1 A LYS 91 ? CE ? A LYS 91 CE 5 1 Y 1 A LYS 91 ? NZ ? A LYS 91 NZ 6 1 Y 1 A SER 98 ? OG ? A SER 98 OG 7 1 Y 1 A ARG 99 ? CZ ? A ARG 99 CZ 8 1 Y 1 A ARG 99 ? NH1 ? A ARG 99 NH1 9 1 Y 1 A ARG 99 ? NH2 ? A ARG 99 NH2 10 1 Y 1 A GLN 115 ? NE2 ? A GLN 115 NE2 11 1 Y 1 A LYS 125 ? CE ? A LYS 125 CE 12 1 Y 1 A LYS 125 ? NZ ? A LYS 125 NZ 13 1 Y 1 A SER 127 ? OG ? A SER 127 OG 14 1 Y 1 A ASP 145 ? OD1 ? A ASP 145 OD1 15 1 Y 1 A ASP 145 ? OD2 ? A ASP 145 OD2 16 1 Y 1 A LYS 149 ? CD ? A LYS 149 CD 17 1 Y 1 A LYS 149 ? CE ? A LYS 149 CE 18 1 Y 1 A LYS 149 ? NZ ? A LYS 149 NZ 19 1 Y 1 A GLU 167 ? OE2 ? A GLU 167 OE2 20 1 Y 1 A LYS 170 ? NZ ? A LYS 170 NZ 21 1 Y 1 A LYS 200 ? CD ? A LYS 200 CD 22 1 Y 1 A LYS 200 ? CE ? A LYS 200 CE 23 1 Y 1 A LYS 200 ? NZ ? A LYS 200 NZ 24 1 Y 1 A SER 214 ? OG ? A SER 214 OG 25 1 Y 1 A LYS 217 ? CD ? A LYS 217 CD 26 1 Y 1 A LYS 217 ? CE ? A LYS 217 CE 27 1 Y 1 A LYS 217 ? NZ ? A LYS 217 NZ 28 1 Y 1 A GLN 218 ? CD ? A GLN 218 CD 29 1 Y 1 A GLN 218 ? OE1 ? A GLN 218 OE1 30 1 Y 1 A GLN 218 ? NE2 ? A GLN 218 NE2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '5-amino-2,4,6-tribromobenzene-1,3-dicarboxylic acid' BRV 3 BENZAMIDINE BEN 4 'CALCIUM ION' CA 5 'CHLORIDE ION' CL 6 water HOH #