data_3IWH # _entry.id 3IWH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.357 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3IWH pdb_00003iwh 10.2210/pdb3iwh/pdb RCSB RCSB054951 ? ? WWPDB D_1000054951 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2009-09-15 _pdbx_database_PDB_obs_spr.pdb_id 3IWH _pdbx_database_PDB_obs_spr.replace_pdb_id 3EME _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3eme re-refinement unspecified TargetDB IDP00640 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3IWH _pdbx_database_status.recvd_initial_deposition_date 2009-09-02 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kim, Y.' 1 ? 'Chruszcz, M.' 2 ? 'Minor, W.' 3 0000-0001-7075-7090 'Edwards, A.' 4 ? 'Anderson, W.F.' 5 ? 'Joachimiak, A.' 6 ? 'Center for Structural Genomics of Infectious Diseases (CSGID)' 7 ? # _citation.id primary _citation.title 'Crystal Structure of Rhodanese-like Domain Protein from Staphylococcus aureus' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, Y.' 1 ? primary 'Chruszcz, M.' 2 ? primary 'Minor, W.' 3 0000-0001-7075-7090 primary 'Edwards, A.' 4 ? primary 'Anderson, W.F.' 5 ? primary 'Joachimiak, A.' 6 ? # _cell.entry_id 3IWH _cell.length_a 41.412 _cell.length_b 51.995 _cell.length_c 58.971 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3IWH _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Rhodanese-like domain protein' 11542.464 1 ? ? ? ? 2 non-polymer syn BETA-MERCAPTOETHANOL 78.133 1 ? ? ? ? 3 water nat water 18.015 184 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)KSITTDELKNKLLESKPVQIVDVRTDEETA(MSE)GYIPNAKLIP(MSE)DTIPDNLNSFNKNEIYYIVCAGGVR SAKVVEYLEANGIDAVNVEGG(MSE)HAWGDEGLEIKSI ; _entity_poly.pdbx_seq_one_letter_code_can ;MKSITTDELKNKLLESKPVQIVDVRTDEETAMGYIPNAKLIPMDTIPDNLNSFNKNEIYYIVCAGGVRSAKVVEYLEANG IDAVNVEGGMHAWGDEGLEIKSI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier IDP00640 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 LYS n 1 3 SER n 1 4 ILE n 1 5 THR n 1 6 THR n 1 7 ASP n 1 8 GLU n 1 9 LEU n 1 10 LYS n 1 11 ASN n 1 12 LYS n 1 13 LEU n 1 14 LEU n 1 15 GLU n 1 16 SER n 1 17 LYS n 1 18 PRO n 1 19 VAL n 1 20 GLN n 1 21 ILE n 1 22 VAL n 1 23 ASP n 1 24 VAL n 1 25 ARG n 1 26 THR n 1 27 ASP n 1 28 GLU n 1 29 GLU n 1 30 THR n 1 31 ALA n 1 32 MSE n 1 33 GLY n 1 34 TYR n 1 35 ILE n 1 36 PRO n 1 37 ASN n 1 38 ALA n 1 39 LYS n 1 40 LEU n 1 41 ILE n 1 42 PRO n 1 43 MSE n 1 44 ASP n 1 45 THR n 1 46 ILE n 1 47 PRO n 1 48 ASP n 1 49 ASN n 1 50 LEU n 1 51 ASN n 1 52 SER n 1 53 PHE n 1 54 ASN n 1 55 LYS n 1 56 ASN n 1 57 GLU n 1 58 ILE n 1 59 TYR n 1 60 TYR n 1 61 ILE n 1 62 VAL n 1 63 CYS n 1 64 ALA n 1 65 GLY n 1 66 GLY n 1 67 VAL n 1 68 ARG n 1 69 SER n 1 70 ALA n 1 71 LYS n 1 72 VAL n 1 73 VAL n 1 74 GLU n 1 75 TYR n 1 76 LEU n 1 77 GLU n 1 78 ALA n 1 79 ASN n 1 80 GLY n 1 81 ILE n 1 82 ASP n 1 83 ALA n 1 84 VAL n 1 85 ASN n 1 86 VAL n 1 87 GLU n 1 88 GLY n 1 89 GLY n 1 90 MSE n 1 91 HIS n 1 92 ALA n 1 93 TRP n 1 94 GLY n 1 95 ASP n 1 96 GLU n 1 97 GLY n 1 98 LEU n 1 99 GLU n 1 100 ILE n 1 101 LYS n 1 102 SER n 1 103 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SACOL1807 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain COL _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus subsp. aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 93062 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5HF17_STAAC _struct_ref.pdbx_db_accession Q5HF17 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKSITTDELKNKLLESKPVQIVDVRTDEETAMGYIPNAKLIPMDTIPDNLNSFNKNEIYYIVCAGGVRSAKVVEYLEANG IDAVNVEGGMHAWGDEGLEIKSI ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3IWH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 103 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5HF17 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 103 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 103 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BME non-polymer . BETA-MERCAPTOETHANOL ? 'C2 H6 O S' 78.133 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3IWH _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.75 _exptl_crystal.density_percent_sol 55.28 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2008-02-16 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'double crystal monochromator' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9793 1.0 2 0.9795 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.9793, 0.9795' # _reflns.entry_id 3IWH _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 39 _reflns.d_resolution_high 2.0 _reflns.number_obs 8559 _reflns.number_all ? _reflns.percent_possible_obs 98.9 _reflns.pdbx_Rmerge_I_obs 0.075 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 11.2 _reflns.B_iso_Wilson_estimate 23.8 _reflns.pdbx_redundancy 5.3 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.0 _reflns_shell.d_res_low 2.07 _reflns_shell.percent_possible_all 97.1 _reflns_shell.Rmerge_I_obs 0.27 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.8 _reflns_shell.pdbx_redundancy 3.9 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1633 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3IWH _refine.ls_number_reflns_obs 8559 _refine.ls_number_reflns_all 8559 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 15.62 _refine.ls_d_res_high 2.00 _refine.ls_percent_reflns_obs 99.76 _refine.ls_R_factor_obs 0.193 _refine.ls_R_factor_all 0.193 _refine.ls_R_factor_R_work 0.191 _refine.ls_R_factor_R_free 0.234 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 428 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.947 _refine.correlation_coeff_Fo_to_Fc_free 0.931 _refine.B_iso_mean 22.976 _refine.aniso_B[1][1] 0.30 _refine.aniso_B[2][2] 1.21 _refine.aniso_B[3][3] -1.51 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.189 _refine.pdbx_overall_ESU_R_Free 0.166 _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 785 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.number_atoms_solvent 184 _refine_hist.number_atoms_total 973 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 15.62 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.017 0.022 ? 871 'X-RAY DIFFRACTION' ? r_bond_other_d 0.000 0.020 ? 569 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.488 1.974 ? 1186 'X-RAY DIFFRACTION' ? r_angle_other_deg 4.290 3.000 ? 1417 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.461 5.000 ? 115 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 42.863 27.381 ? 42 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 15.997 15.000 ? 158 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 16.724 15.000 ? 2 'X-RAY DIFFRACTION' ? r_chiral_restr 0.104 0.200 ? 132 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.020 ? 1006 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.007 0.020 ? 147 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.061 1.500 ? 551 'X-RAY DIFFRACTION' ? r_mcbond_other 0.000 1.500 ? 223 'X-RAY DIFFRACTION' ? r_mcangle_it 1.997 2.000 ? 899 'X-RAY DIFFRACTION' ? r_scbond_it 3.247 3.000 ? 320 'X-RAY DIFFRACTION' ? r_scangle_it 5.415 4.500 ? 287 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.000 _refine_ls_shell.d_res_low 2.051 _refine_ls_shell.number_reflns_R_work 589 _refine_ls_shell.R_factor_R_work 0.244 _refine_ls_shell.percent_reflns_obs 99.84 _refine_ls_shell.R_factor_R_free 0.275 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 37 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 626 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3IWH _struct.title 'Crystal Structure of Rhodanese-like Domain Protein from Staphylococcus aureus' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3IWH _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text ;Rhodanese, alpha-beta-alpha sandwich, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 5 ? LYS A 12 ? THR A 5 LYS A 12 1 ? 8 HELX_P HELX_P2 2 LEU A 13 ? GLU A 15 ? LEU A 13 GLU A 15 5 ? 3 HELX_P HELX_P3 3 THR A 26 ? ALA A 31 ? THR A 26 ALA A 31 1 ? 6 HELX_P HELX_P4 4 PRO A 42 ? PHE A 53 ? PRO A 42 PHE A 53 5 ? 12 HELX_P HELX_P5 5 VAL A 67 ? ALA A 78 ? VAL A 67 ALA A 78 1 ? 12 HELX_P HELX_P6 6 GLY A 88 ? GLY A 94 ? GLY A 88 GLY A 94 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A MSE 1 C ? ? ? 1_555 A LYS 2 N ? ? A MSE 1 A LYS 2 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale2 covale both ? A ALA 31 C ? ? ? 1_555 A MSE 32 N ? ? A ALA 31 A MSE 32 1_555 ? ? ? ? ? ? ? 1.341 ? ? covale3 covale both ? A MSE 32 C ? ? ? 1_555 A GLY 33 N ? ? A MSE 32 A GLY 33 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale4 covale both ? A PRO 42 C ? ? ? 1_555 A MSE 43 N ? ? A PRO 42 A MSE 43 1_555 ? ? ? ? ? ? ? 1.311 ? ? covale5 covale both ? A MSE 43 C ? ? ? 1_555 A ASP 44 N A ? A MSE 43 A ASP 44 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale6 covale both ? A MSE 43 C ? ? ? 1_555 A ASP 44 N B ? A MSE 43 A ASP 44 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale7 covale both ? A GLY 89 C ? ? ? 1_555 A MSE 90 N ? ? A GLY 89 A MSE 90 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale8 covale both ? A MSE 90 C ? ? ? 1_555 A HIS 91 N ? ? A MSE 90 A HIS 91 1_555 ? ? ? ? ? ? ? 1.332 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 3 ? ILE A 4 ? SER A 3 ILE A 4 A 2 ASP A 82 ? VAL A 86 ? ASP A 82 VAL A 86 A 3 ILE A 58 ? VAL A 62 ? ILE A 58 VAL A 62 A 4 GLN A 20 ? ASP A 23 ? GLN A 20 ASP A 23 A 5 LYS A 39 ? LEU A 40 ? LYS A 39 LEU A 40 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 4 ? N ILE A 4 O ASN A 85 ? O ASN A 85 A 2 3 O VAL A 84 ? O VAL A 84 N ILE A 61 ? N ILE A 61 A 3 4 O TYR A 60 ? O TYR A 60 N GLN A 20 ? N GLN A 20 A 4 5 N ILE A 21 ? N ILE A 21 O LYS A 39 ? O LYS A 39 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id BME _struct_site.pdbx_auth_seq_id 300 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 8 _struct_site.details 'BINDING SITE FOR RESIDUE BME A 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 CYS A 63 ? CYS A 63 . ? 1_555 ? 2 AC1 8 ALA A 64 ? ALA A 64 . ? 1_555 ? 3 AC1 8 GLY A 65 ? GLY A 65 . ? 1_555 ? 4 AC1 8 GLY A 66 ? GLY A 66 . ? 1_555 ? 5 AC1 8 VAL A 67 ? VAL A 67 . ? 1_555 ? 6 AC1 8 ARG A 68 ? ARG A 68 . ? 1_555 ? 7 AC1 8 LYS A 101 ? LYS A 101 . ? 4_445 ? 8 AC1 8 SER A 102 ? SER A 102 . ? 4_445 ? # _database_PDB_matrix.entry_id 3IWH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3IWH _atom_sites.fract_transf_matrix[1][1] 0.024148 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019233 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016957 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 MSE 32 32 32 MSE MSE A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 MSE 43 43 43 MSE MSE A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 MSE 90 90 90 MSE MSE A . n A 1 91 HIS 91 91 91 HIS HIS A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 TRP 93 93 93 TRP TRP A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 ILE 103 103 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Center for Structural Genomics of Infectious Diseases' _pdbx_SG_project.initial_of_center CSGID # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BME 1 300 300 BME BME A . C 3 HOH 1 301 301 HOH HOH A . C 3 HOH 2 302 302 HOH HOH A . C 3 HOH 3 303 303 HOH HOH A . C 3 HOH 4 304 304 HOH HOH A . C 3 HOH 5 305 305 HOH HOH A . C 3 HOH 6 306 306 HOH HOH A . C 3 HOH 7 307 307 HOH HOH A . C 3 HOH 8 308 308 HOH HOH A . C 3 HOH 9 309 309 HOH HOH A . C 3 HOH 10 310 310 HOH HOH A . C 3 HOH 11 311 311 HOH HOH A . C 3 HOH 12 312 312 HOH HOH A . C 3 HOH 13 313 313 HOH HOH A . C 3 HOH 14 314 314 HOH HOH A . C 3 HOH 15 315 315 HOH HOH A . C 3 HOH 16 316 316 HOH HOH A . C 3 HOH 17 317 317 HOH HOH A . C 3 HOH 18 318 318 HOH HOH A . C 3 HOH 19 319 319 HOH HOH A . C 3 HOH 20 320 320 HOH HOH A . C 3 HOH 21 321 321 HOH HOH A . C 3 HOH 22 322 322 HOH HOH A . C 3 HOH 23 323 323 HOH HOH A . C 3 HOH 24 324 324 HOH HOH A . C 3 HOH 25 325 325 HOH HOH A . C 3 HOH 26 326 326 HOH HOH A . C 3 HOH 27 327 327 HOH HOH A . C 3 HOH 28 328 328 HOH HOH A . C 3 HOH 29 329 329 HOH HOH A . C 3 HOH 30 330 330 HOH HOH A . C 3 HOH 31 331 331 HOH HOH A . C 3 HOH 32 332 332 HOH HOH A . C 3 HOH 33 333 333 HOH HOH A . C 3 HOH 34 334 334 HOH HOH A . C 3 HOH 35 335 335 HOH HOH A . C 3 HOH 36 336 336 HOH HOH A . C 3 HOH 37 337 337 HOH HOH A . C 3 HOH 38 338 338 HOH HOH A . C 3 HOH 39 339 339 HOH HOH A . C 3 HOH 40 340 340 HOH HOH A . C 3 HOH 41 341 341 HOH HOH A . C 3 HOH 42 342 342 HOH HOH A . C 3 HOH 43 343 343 HOH HOH A . C 3 HOH 44 344 344 HOH HOH A . C 3 HOH 45 345 345 HOH HOH A . C 3 HOH 46 346 346 HOH HOH A . C 3 HOH 47 347 347 HOH HOH A . C 3 HOH 48 348 348 HOH HOH A . C 3 HOH 49 349 349 HOH HOH A . C 3 HOH 50 350 350 HOH HOH A . C 3 HOH 51 351 351 HOH HOH A . C 3 HOH 52 352 352 HOH HOH A . C 3 HOH 53 353 353 HOH HOH A . C 3 HOH 54 354 354 HOH HOH A . C 3 HOH 55 355 355 HOH HOH A . C 3 HOH 56 356 356 HOH HOH A . C 3 HOH 57 357 357 HOH HOH A . C 3 HOH 58 358 358 HOH HOH A . C 3 HOH 59 359 359 HOH HOH A . C 3 HOH 60 360 360 HOH HOH A . C 3 HOH 61 361 361 HOH HOH A . C 3 HOH 62 362 362 HOH HOH A . C 3 HOH 63 363 363 HOH HOH A . C 3 HOH 64 364 364 HOH HOH A . C 3 HOH 65 365 365 HOH HOH A . C 3 HOH 66 366 366 HOH HOH A . C 3 HOH 67 367 367 HOH HOH A . C 3 HOH 68 368 368 HOH HOH A . C 3 HOH 69 369 369 HOH HOH A . C 3 HOH 70 370 370 HOH HOH A . C 3 HOH 71 371 371 HOH HOH A . C 3 HOH 72 372 372 HOH HOH A . C 3 HOH 73 373 373 HOH HOH A . C 3 HOH 74 374 374 HOH HOH A . C 3 HOH 75 375 375 HOH HOH A . C 3 HOH 76 376 376 HOH HOH A . C 3 HOH 77 377 377 HOH HOH A . C 3 HOH 78 378 378 HOH HOH A . C 3 HOH 79 379 379 HOH HOH A . C 3 HOH 80 380 380 HOH HOH A . C 3 HOH 81 381 381 HOH HOH A . C 3 HOH 82 382 382 HOH HOH A . C 3 HOH 83 383 383 HOH HOH A . C 3 HOH 84 384 384 HOH HOH A . C 3 HOH 85 385 385 HOH HOH A . C 3 HOH 86 386 386 HOH HOH A . C 3 HOH 87 387 387 HOH HOH A . C 3 HOH 88 388 388 HOH HOH A . C 3 HOH 89 389 389 HOH HOH A . C 3 HOH 90 390 390 HOH HOH A . C 3 HOH 91 391 391 HOH HOH A . C 3 HOH 92 392 392 HOH HOH A . C 3 HOH 93 393 393 HOH HOH A . C 3 HOH 94 394 394 HOH HOH A . C 3 HOH 95 395 395 HOH HOH A . C 3 HOH 96 396 396 HOH HOH A . C 3 HOH 97 397 397 HOH HOH A . C 3 HOH 98 398 398 HOH HOH A . C 3 HOH 99 399 399 HOH HOH A . C 3 HOH 100 400 400 HOH HOH A . C 3 HOH 101 401 401 HOH HOH A . C 3 HOH 102 402 402 HOH HOH A . C 3 HOH 103 403 403 HOH HOH A . C 3 HOH 104 404 404 HOH HOH A . C 3 HOH 105 405 405 HOH HOH A . C 3 HOH 106 406 406 HOH HOH A . C 3 HOH 107 407 407 HOH HOH A . C 3 HOH 108 408 408 HOH HOH A . C 3 HOH 109 409 409 HOH HOH A . C 3 HOH 110 410 410 HOH HOH A . C 3 HOH 111 411 411 HOH HOH A . C 3 HOH 112 412 412 HOH HOH A . C 3 HOH 113 413 413 HOH HOH A . C 3 HOH 114 414 414 HOH HOH A . C 3 HOH 115 415 415 HOH HOH A . C 3 HOH 116 416 416 HOH HOH A . C 3 HOH 117 417 417 HOH HOH A . C 3 HOH 118 418 418 HOH HOH A . C 3 HOH 119 419 419 HOH HOH A . C 3 HOH 120 420 420 HOH HOH A . C 3 HOH 121 421 421 HOH HOH A . C 3 HOH 122 422 422 HOH HOH A . C 3 HOH 123 423 423 HOH HOH A . C 3 HOH 124 424 424 HOH HOH A . C 3 HOH 125 425 425 HOH HOH A . C 3 HOH 126 426 426 HOH HOH A . C 3 HOH 127 427 427 HOH HOH A . C 3 HOH 128 428 428 HOH HOH A . C 3 HOH 129 429 429 HOH HOH A . C 3 HOH 130 430 430 HOH HOH A . C 3 HOH 131 431 431 HOH HOH A . C 3 HOH 132 432 432 HOH HOH A . C 3 HOH 133 433 433 HOH HOH A . C 3 HOH 134 434 434 HOH HOH A . C 3 HOH 135 435 435 HOH HOH A . C 3 HOH 136 436 436 HOH HOH A . C 3 HOH 137 437 437 HOH HOH A . C 3 HOH 138 438 438 HOH HOH A . C 3 HOH 139 439 439 HOH HOH A . C 3 HOH 140 440 440 HOH HOH A . C 3 HOH 141 441 441 HOH HOH A . C 3 HOH 142 442 442 HOH HOH A . C 3 HOH 143 443 443 HOH HOH A . C 3 HOH 144 444 444 HOH HOH A . C 3 HOH 145 445 445 HOH HOH A . C 3 HOH 146 446 446 HOH HOH A . C 3 HOH 147 447 447 HOH HOH A . C 3 HOH 148 448 448 HOH HOH A . C 3 HOH 149 449 449 HOH HOH A . C 3 HOH 150 450 450 HOH HOH A . C 3 HOH 151 451 451 HOH HOH A . C 3 HOH 152 452 452 HOH HOH A . C 3 HOH 153 453 453 HOH HOH A . C 3 HOH 154 454 454 HOH HOH A . C 3 HOH 155 455 455 HOH HOH A . C 3 HOH 156 456 456 HOH HOH A . C 3 HOH 157 457 457 HOH HOH A . C 3 HOH 158 458 458 HOH HOH A . C 3 HOH 159 459 459 HOH HOH A . C 3 HOH 160 460 460 HOH HOH A . C 3 HOH 161 461 461 HOH HOH A . C 3 HOH 162 462 462 HOH HOH A . C 3 HOH 163 463 463 HOH HOH A . C 3 HOH 164 464 464 HOH HOH A . C 3 HOH 165 465 465 HOH HOH A . C 3 HOH 166 466 466 HOH HOH A . C 3 HOH 167 467 467 HOH HOH A . C 3 HOH 168 468 468 HOH HOH A . C 3 HOH 169 469 469 HOH HOH A . C 3 HOH 170 470 470 HOH HOH A . C 3 HOH 171 471 471 HOH HOH A . C 3 HOH 172 472 472 HOH HOH A . C 3 HOH 173 473 473 HOH HOH A . C 3 HOH 174 474 474 HOH HOH A . C 3 HOH 175 475 475 HOH HOH A . C 3 HOH 176 476 476 HOH HOH A . C 3 HOH 177 477 477 HOH HOH A . C 3 HOH 178 478 478 HOH HOH A . C 3 HOH 179 479 479 HOH HOH A . C 3 HOH 180 480 480 HOH HOH A . C 3 HOH 181 481 481 HOH HOH A . C 3 HOH 182 482 482 HOH HOH A . C 3 HOH 183 483 483 HOH HOH A . C 3 HOH 184 484 484 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 32 A MSE 32 ? MET SELENOMETHIONINE 3 A MSE 43 A MSE 43 ? MET SELENOMETHIONINE 4 A MSE 90 A MSE 90 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-09-15 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2019-07-24 4 'Structure model' 1 3 2022-04-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Source and taxonomy' 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' 8 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 3 'Structure model' struct_conn 3 4 'Structure model' audit_author 4 4 'Structure model' citation_author 5 4 'Structure model' database_2 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.classification' 2 3 'Structure model' '_software.name' 3 3 'Structure model' '_software.version' 4 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_audit_author.identifier_ORCID' 6 4 'Structure model' '_citation_author.identifier_ORCID' 7 4 'Structure model' '_database_2.pdbx_DOI' 8 4 'Structure model' '_database_2.pdbx_database_accession' 9 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 10 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 11 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.5.0072 ? 1 HKL-3000 'data collection' . ? 2 CNS refinement . ? 3 SBC-Collect 'data collection' . ? 4 HKL-2000 'data reduction' . ? 5 HKL-3000 'data scaling' . ? 6 CNS phasing . ? 7 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PRO 42 ? ? O A HOH 436 ? ? 2.06 2 1 O A HOH 393 ? ? O A HOH 428 ? ? 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 37 ? ? 80.06 -1.22 2 1 CYS A 63 ? B -135.16 -159.83 3 1 VAL A 67 ? ? -96.39 -62.24 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id ILE _pdbx_unobs_or_zero_occ_residues.auth_seq_id 103 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id ILE _pdbx_unobs_or_zero_occ_residues.label_seq_id 103 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 BETA-MERCAPTOETHANOL BME 3 water HOH #