data_3JVN # _entry.id 3JVN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.313 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3JVN RCSB RCSB055216 WWPDB D_1000055216 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id VfR136 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 3JVN _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-09-17 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Forouhar, F.' 1 'Neely, H.' 2 'Seetharaman, J.' 3 'Mao, M.' 4 'Xiao, R.' 5 'Ciccosanti, C.' 6 'Zhao, L.' 7 'Everett, J.K.' 8 'Nair, R.' 9 'Acton, T.B.' 10 'Rost, B.' 11 'Montelione, G.T.' 12 'Tong, L.' 13 'Hunt, J.F.' 14 'Northeast Structural Genomics Consortium (NESG)' 15 # _citation.id primary _citation.title 'Northeast Structural Genomics Consortium Target VfR136' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Forouhar, F.' 1 ? primary 'Neely, H.' 2 ? primary 'Seetharaman, J.' 3 ? primary 'Mao, M.' 4 ? primary 'Xiao, R.' 5 ? primary 'Ciccosanti, C.' 6 ? primary 'Zhao, L.' 7 ? primary 'Everett, J.K.' 8 ? primary 'Nair, R.' 9 ? primary 'Acton, T.B.' 10 ? primary 'Rost, B.' 11 ? primary 'Montelione, G.T.' 12 ? primary 'Tong, L.' 13 ? primary 'Hunt, J.F.' 14 ? # _cell.entry_id 3JVN _cell.length_a 45.714 _cell.length_b 105.332 _cell.length_c 73.872 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.pdbx_unique_axis ? _cell.Z_PDB 8 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3JVN _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.Int_Tables_number 20 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Acetyltransferase 20214.938 1 2.3.1.- ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 water nat water 18.015 27 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)APVIRRAKEIDLYCLNSL(MSE)YKLHDEHHQQCPDLFKTASEIEEEKSIARYLDDPEC(MSE)VYVAE(MSE)D DVIIGFITGHFCELISTVSKLV(MSE)(MSE)ATIDELYIEKEYRREGVAEQL(MSE)(MSE)RIEQELKDYGVKEIFVE VWDFNKGALEFYNKQGLNEHIHYLRKPLNRLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MAPVIRRAKEIDLYCLNSLMYKLHDEHHQQCPDLFKTASEIEEEKSIARYLDDPECMVYVAEMDDVIIGFITGHFCELIS TVSKLVMMATIDELYIEKEYRREGVAEQLMMRIEQELKDYGVKEIFVEVWDFNKGALEFYNKQGLNEHIHYLRKPLNRLE HHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier VfR136 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ALA n 1 3 PRO n 1 4 VAL n 1 5 ILE n 1 6 ARG n 1 7 ARG n 1 8 ALA n 1 9 LYS n 1 10 GLU n 1 11 ILE n 1 12 ASP n 1 13 LEU n 1 14 TYR n 1 15 CYS n 1 16 LEU n 1 17 ASN n 1 18 SER n 1 19 LEU n 1 20 MSE n 1 21 TYR n 1 22 LYS n 1 23 LEU n 1 24 HIS n 1 25 ASP n 1 26 GLU n 1 27 HIS n 1 28 HIS n 1 29 GLN n 1 30 GLN n 1 31 CYS n 1 32 PRO n 1 33 ASP n 1 34 LEU n 1 35 PHE n 1 36 LYS n 1 37 THR n 1 38 ALA n 1 39 SER n 1 40 GLU n 1 41 ILE n 1 42 GLU n 1 43 GLU n 1 44 GLU n 1 45 LYS n 1 46 SER n 1 47 ILE n 1 48 ALA n 1 49 ARG n 1 50 TYR n 1 51 LEU n 1 52 ASP n 1 53 ASP n 1 54 PRO n 1 55 GLU n 1 56 CYS n 1 57 MSE n 1 58 VAL n 1 59 TYR n 1 60 VAL n 1 61 ALA n 1 62 GLU n 1 63 MSE n 1 64 ASP n 1 65 ASP n 1 66 VAL n 1 67 ILE n 1 68 ILE n 1 69 GLY n 1 70 PHE n 1 71 ILE n 1 72 THR n 1 73 GLY n 1 74 HIS n 1 75 PHE n 1 76 CYS n 1 77 GLU n 1 78 LEU n 1 79 ILE n 1 80 SER n 1 81 THR n 1 82 VAL n 1 83 SER n 1 84 LYS n 1 85 LEU n 1 86 VAL n 1 87 MSE n 1 88 MSE n 1 89 ALA n 1 90 THR n 1 91 ILE n 1 92 ASP n 1 93 GLU n 1 94 LEU n 1 95 TYR n 1 96 ILE n 1 97 GLU n 1 98 LYS n 1 99 GLU n 1 100 TYR n 1 101 ARG n 1 102 ARG n 1 103 GLU n 1 104 GLY n 1 105 VAL n 1 106 ALA n 1 107 GLU n 1 108 GLN n 1 109 LEU n 1 110 MSE n 1 111 MSE n 1 112 ARG n 1 113 ILE n 1 114 GLU n 1 115 GLN n 1 116 GLU n 1 117 LEU n 1 118 LYS n 1 119 ASP n 1 120 TYR n 1 121 GLY n 1 122 VAL n 1 123 LYS n 1 124 GLU n 1 125 ILE n 1 126 PHE n 1 127 VAL n 1 128 GLU n 1 129 VAL n 1 130 TRP n 1 131 ASP n 1 132 PHE n 1 133 ASN n 1 134 LYS n 1 135 GLY n 1 136 ALA n 1 137 LEU n 1 138 GLU n 1 139 PHE n 1 140 TYR n 1 141 ASN n 1 142 LYS n 1 143 GLN n 1 144 GLY n 1 145 LEU n 1 146 ASN n 1 147 GLU n 1 148 HIS n 1 149 ILE n 1 150 HIS n 1 151 TYR n 1 152 LEU n 1 153 ARG n 1 154 LYS n 1 155 PRO n 1 156 LEU n 1 157 ASN n 1 158 ARG n 1 159 LEU n 1 160 GLU n 1 161 HIS n 1 162 HIS n 1 163 HIS n 1 164 HIS n 1 165 HIS n 1 166 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene VF_1542 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ES114 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Vibrio fischeri' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 312309 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 700601 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+ Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector 'pET 21-23C' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name BL21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5E4K9_VIBF1 _struct_ref.pdbx_db_accession Q5E4K9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAPVIRRAKEIDLYCLNSLMYKLHDEHHQQCPDLFKTASEIEEEKSIARYLDDPECMVYVAEMDDVIIGFITGHFCELIS TVSKLVMMATIDELYIEKEYRREGVAEQLMMRIEQELKDYGVKEIFVEVWDFNKGALEFYNKQGLNEHIHYLRKPLNR ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3JVN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 158 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5E4K9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 158 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 158 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3JVN LEU A 159 ? UNP Q5E4K9 ? ? 'EXPRESSION TAG' 159 1 1 3JVN GLU A 160 ? UNP Q5E4K9 ? ? 'EXPRESSION TAG' 160 2 1 3JVN HIS A 161 ? UNP Q5E4K9 ? ? 'EXPRESSION TAG' 161 3 1 3JVN HIS A 162 ? UNP Q5E4K9 ? ? 'EXPRESSION TAG' 162 4 1 3JVN HIS A 163 ? UNP Q5E4K9 ? ? 'EXPRESSION TAG' 163 5 1 3JVN HIS A 164 ? UNP Q5E4K9 ? ? 'EXPRESSION TAG' 164 6 1 3JVN HIS A 165 ? UNP Q5E4K9 ? ? 'EXPRESSION TAG' 165 7 1 3JVN HIS A 166 ? UNP Q5E4K9 ? ? 'EXPRESSION TAG' 166 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 3JVN _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.20 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 44.08 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'microbatch, under oil' _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.pdbx_details ;Protein solution: 100mM NaCl, 5mM DTT, 0.02% NaN3, 10mM Tris-HCl (pH 7.5). Reservoir solution: 0.1M Bis Tris (pH 5.5), 1% PEG 3350, and 0.1M ammonium sulfate, microbatch, under oil, temperature 277K ; _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MAR CCD 165 mm' _diffrn_detector.pdbx_collection_date 2009-09-03 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A # _reflns.entry_id 3JVN _reflns.B_iso_Wilson_estimate 31.600 _reflns.observed_criterion_sigma_F 2 _reflns.observed_criterion_sigma_I 2 _reflns.d_resolution_high 2.6 _reflns.d_resolution_low 30 _reflns.number_all 10548 _reflns.number_obs 8101 _reflns.percent_possible_obs 76.8 _reflns.pdbx_Rmerge_I_obs 0.048 _reflns.pdbx_Rsym_value 0.054 _reflns.pdbx_netI_over_sigmaI 24.93 _reflns.pdbx_redundancy 3.6 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.60 _reflns_shell.d_res_low 2.69 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 52.3 _reflns_shell.Rmerge_I_obs 0.082 _reflns_shell.meanI_over_sigI_obs 7.97 _reflns_shell.pdbx_Rsym_value 0.101 _reflns_shell.pdbx_redundancy 2.3 _reflns_shell.number_unique_all 1051 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3JVN _refine.ls_d_res_high 2.610 _refine.ls_d_res_low 19.130 _refine.pdbx_ls_sigma_F 2.00 _refine.pdbx_data_cutoff_high_absF 318924.312 _refine.pdbx_data_cutoff_low_absF 0.000 _refine.ls_percent_reflns_obs 76.800 _refine.ls_number_reflns_obs 8088 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.ls_R_factor_R_work 0.233 _refine.ls_R_factor_R_free 0.273 _refine.ls_percent_reflns_R_free 5.200 _refine.ls_number_reflns_R_free 417 _refine.ls_R_factor_R_free_error 0.013 _refine.B_iso_mean 40.100 _refine.solvent_model_param_bsol 34.501 _refine.solvent_model_param_ksol 0.350 _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.aniso_B[1][1] -5.630 _refine.aniso_B[2][2] 14.500 _refine.aniso_B[3][3] -8.870 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.solvent_model_details 'FLAT MODEL' _refine.pdbx_ls_sigma_I 2.00 _refine.ls_number_reflns_all 10531 _refine.ls_R_factor_all 0.335 _refine.ls_R_factor_obs 0.334 _refine.ls_redundancy_reflns_obs ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.occupancy_max ? _refine.occupancy_min ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3JVN _refine_analyze.Luzzati_coordinate_error_obs 0.320 _refine_analyze.Luzzati_sigma_a_obs 0.220 _refine_analyze.Luzzati_d_res_low_obs 5.000 _refine_analyze.Luzzati_coordinate_error_free 0.380 _refine_analyze.Luzzati_sigma_a_free 0.440 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1002 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 27 _refine_hist.number_atoms_total 1034 _refine_hist.d_res_high 2.610 _refine_hist.d_res_low 19.130 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d ? 0.008 ? ? 'X-RAY DIFFRACTION' ? c_angle_deg ? 1.100 ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d ? 24.200 ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d ? 0.700 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 2.600 _refine_ls_shell.d_res_low 2.690 _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.percent_reflns_obs 48.400 _refine_ls_shell.number_reflns_R_work 482 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.300 _refine_ls_shell.R_factor_R_free 0.354 _refine_ls_shell.percent_reflns_R_free 5.100 _refine_ls_shell.number_reflns_R_free 26 _refine_ls_shell.R_factor_R_free_error 0.070 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 508 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3JVN _struct.title 'Crystal Structure of the acetyltransferase VF_1542 from Vibrio fischeri, Northeast Structural Genomics Consortium Target VfR136' _struct.pdbx_descriptor 'Acetyltransferase (E.C.2.3.1.-)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3JVN _struct_keywords.text ;alpha-beta protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Acyltransferase, Transferase ; _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 9 ? ILE A 11 ? LYS A 9 ILE A 11 5 ? 3 HELX_P HELX_P2 2 ASP A 12 ? CYS A 31 ? ASP A 12 CYS A 31 1 ? 20 HELX_P HELX_P3 3 SER A 46 ? ASP A 53 ? SER A 46 ASP A 53 1 ? 8 HELX_P HELX_P4 4 GLY A 104 ? ASP A 119 ? GLY A 104 ASP A 119 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A LEU 19 C ? ? ? 1_555 A MSE 20 N ? ? A LEU 19 A MSE 20 1_555 ? ? ? ? ? ? ? 1.331 ? covale2 covale both ? A MSE 20 C ? ? ? 1_555 A TYR 21 N ? ? A MSE 20 A TYR 21 1_555 ? ? ? ? ? ? ? 1.331 ? covale3 covale both ? A CYS 56 C ? ? ? 1_555 A MSE 57 N ? ? A CYS 56 A MSE 57 1_555 ? ? ? ? ? ? ? 1.326 ? covale4 covale both ? A MSE 57 C ? ? ? 1_555 A VAL 58 N ? ? A MSE 57 A VAL 58 1_555 ? ? ? ? ? ? ? 1.322 ? covale5 covale both ? A GLU 62 C ? ? ? 1_555 A MSE 63 N ? ? A GLU 62 A MSE 63 1_555 ? ? ? ? ? ? ? 1.328 ? covale6 covale both ? A MSE 63 C ? ? ? 1_555 A ASP 64 N ? ? A MSE 63 A ASP 64 1_555 ? ? ? ? ? ? ? 1.329 ? covale7 covale both ? A VAL 86 C ? ? ? 1_555 A MSE 87 N ? ? A VAL 86 A MSE 87 1_555 ? ? ? ? ? ? ? 1.322 ? covale8 covale both ? A MSE 87 C ? ? ? 1_555 A MSE 88 N ? ? A MSE 87 A MSE 88 1_555 ? ? ? ? ? ? ? 1.327 ? covale9 covale both ? A MSE 88 C ? ? ? 1_555 A ALA 89 N ? ? A MSE 88 A ALA 89 1_555 ? ? ? ? ? ? ? 1.323 ? covale10 covale both ? A LEU 109 C ? ? ? 1_555 A MSE 110 N ? ? A LEU 109 A MSE 110 1_555 ? ? ? ? ? ? ? 1.329 ? covale11 covale both ? A MSE 110 C ? ? ? 1_555 A MSE 111 N ? ? A MSE 110 A MSE 111 1_555 ? ? ? ? ? ? ? 1.330 ? covale12 covale both ? A MSE 111 C ? ? ? 1_555 A ARG 112 N ? ? A MSE 111 A ARG 112 1_555 ? ? ? ? ? ? ? 1.327 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 4 ? ARG A 7 ? VAL A 4 ARG A 7 A 2 CYS A 56 ? GLU A 62 ? CYS A 56 GLU A 62 A 3 ILE A 67 ? LEU A 78 ? ILE A 67 LEU A 78 A 4 VAL A 86 ? ILE A 96 ? VAL A 86 ILE A 96 A 5 GLU A 124 ? VAL A 127 ? GLU A 124 VAL A 127 A 6 GLY A 135 ? ALA A 136 ? GLY A 135 ALA A 136 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 4 ? N VAL A 4 O GLU A 62 ? O GLU A 62 A 2 3 N MSE A 57 ? N MSE A 57 O GLY A 73 ? O GLY A 73 A 3 4 N CYS A 76 ? N CYS A 76 O MSE A 88 ? O MSE A 88 A 4 5 N ILE A 91 ? N ILE A 91 O PHE A 126 ? O PHE A 126 A 5 6 N ILE A 125 ? N ILE A 125 O ALA A 136 ? O ALA A 136 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE SO4 A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ILE A 5 ? ILE A 5 . ? 1_555 ? 2 AC1 5 ARG A 6 ? ARG A 6 . ? 1_555 ? 3 AC1 5 ARG A 7 ? ARG A 7 . ? 1_555 ? 4 AC1 5 ARG A 112 ? ARG A 112 . ? 1_555 ? 5 AC1 5 HOH C . ? HOH A 167 . ? 1_555 ? # _database_PDB_matrix.entry_id 3JVN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.000000 _database_PDB_matrix.origx_vector[2] 0.000000 _database_PDB_matrix.origx_vector[3] 0.000000 # _atom_sites.entry_id 3JVN _atom_sites.fract_transf_matrix[1][1] 0.021875 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009494 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013537 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 MSE 20 20 20 MSE MSE A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 LEU 34 34 ? ? ? A . n A 1 35 PHE 35 35 ? ? ? A . n A 1 36 LYS 36 36 ? ? ? A . n A 1 37 THR 37 37 ? ? ? A . n A 1 38 ALA 38 38 ? ? ? A . n A 1 39 SER 39 39 ? ? ? A . n A 1 40 GLU 40 40 ? ? ? A . n A 1 41 ILE 41 41 ? ? ? A . n A 1 42 GLU 42 42 ? ? ? A . n A 1 43 GLU 43 43 ? ? ? A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 MSE 57 57 57 MSE MSE A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 MSE 63 63 63 MSE MSE A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 MSE 87 87 87 MSE MSE A . n A 1 88 MSE 88 88 88 MSE MSE A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 MSE 110 110 110 MSE MSE A . n A 1 111 MSE 111 111 111 MSE MSE A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 TYR 120 120 120 TYR TYR A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 TRP 130 130 130 TRP TRP A . n A 1 131 ASP 131 131 ? ? ? A . n A 1 132 PHE 132 132 ? ? ? A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 LEU 137 137 ? ? ? A . n A 1 138 GLU 138 138 ? ? ? A . n A 1 139 PHE 139 139 ? ? ? A . n A 1 140 TYR 140 140 ? ? ? A . n A 1 141 ASN 141 141 ? ? ? A . n A 1 142 LYS 142 142 ? ? ? A . n A 1 143 GLN 143 143 ? ? ? A . n A 1 144 GLY 144 144 ? ? ? A . n A 1 145 LEU 145 145 ? ? ? A . n A 1 146 ASN 146 146 ? ? ? A . n A 1 147 GLU 147 147 ? ? ? A . n A 1 148 HIS 148 148 ? ? ? A . n A 1 149 ILE 149 149 ? ? ? A . n A 1 150 HIS 150 150 ? ? ? A . n A 1 151 TYR 151 151 ? ? ? A . n A 1 152 LEU 152 152 ? ? ? A . n A 1 153 ARG 153 153 ? ? ? A . n A 1 154 LYS 154 154 ? ? ? A . n A 1 155 PRO 155 155 ? ? ? A . n A 1 156 LEU 156 156 ? ? ? A . n A 1 157 ASN 157 157 ? ? ? A . n A 1 158 ARG 158 158 ? ? ? A . n A 1 159 LEU 159 159 ? ? ? A . n A 1 160 GLU 160 160 ? ? ? A . n A 1 161 HIS 161 161 ? ? ? A . n A 1 162 HIS 162 162 ? ? ? A . n A 1 163 HIS 163 163 ? ? ? A . n A 1 164 HIS 164 164 ? ? ? A . n A 1 165 HIS 165 165 ? ? ? A . n A 1 166 HIS 166 166 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 201 201 SO4 SO4 A . C 3 HOH 1 167 1 HOH HOH A . C 3 HOH 2 168 2 HOH HOH A . C 3 HOH 3 169 3 HOH HOH A . C 3 HOH 4 170 4 HOH HOH A . C 3 HOH 5 171 5 HOH HOH A . C 3 HOH 6 172 6 HOH HOH A . C 3 HOH 7 173 8 HOH HOH A . C 3 HOH 8 174 9 HOH HOH A . C 3 HOH 9 175 10 HOH HOH A . C 3 HOH 10 176 11 HOH HOH A . C 3 HOH 11 177 12 HOH HOH A . C 3 HOH 12 178 13 HOH HOH A . C 3 HOH 13 179 14 HOH HOH A . C 3 HOH 14 180 15 HOH HOH A . C 3 HOH 15 181 16 HOH HOH A . C 3 HOH 16 182 17 HOH HOH A . C 3 HOH 17 183 18 HOH HOH A . C 3 HOH 18 184 19 HOH HOH A . C 3 HOH 19 185 20 HOH HOH A . C 3 HOH 20 186 21 HOH HOH A . C 3 HOH 21 187 22 HOH HOH A . C 3 HOH 22 188 23 HOH HOH A . C 3 HOH 23 189 24 HOH HOH A . C 3 HOH 24 190 25 HOH HOH A . C 3 HOH 25 191 26 HOH HOH A . C 3 HOH 26 192 27 HOH HOH A . C 3 HOH 27 193 28 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 20 A MSE 20 ? MET SELENOMETHIONINE 2 A MSE 57 A MSE 57 ? MET SELENOMETHIONINE 3 A MSE 63 A MSE 63 ? MET SELENOMETHIONINE 4 A MSE 87 A MSE 87 ? MET SELENOMETHIONINE 5 A MSE 88 A MSE 88 ? MET SELENOMETHIONINE 6 A MSE 110 A MSE 110 ? MET SELENOMETHIONINE 7 A MSE 111 A MSE 111 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1790 ? 1 MORE -41 ? 1 'SSA (A^2)' 15240 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_755 -x+2,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 91.4280000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 36.9360000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-09-29 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-11-01 4 'Structure model' 1 3 2019-08-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Source and taxonomy' 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' software 3 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.name' 2 4 'Structure model' '_software.contact_author' 3 4 'Structure model' '_software.contact_author_email' 4 4 'Structure model' '_software.language' 5 4 'Structure model' '_software.location' 6 4 'Structure model' '_software.name' 7 4 'Structure model' '_software.type' 8 4 'Structure model' '_software.version' 9 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal CNS 1.2 ? ? ? ? refinement ? ? ? 1 PDB_EXTRACT 3.00 'March. 27, 2007' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 2 ADSC Quantum ? ? ? ? 'data collection' ? ? ? 3 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 4 SCALEPACK . ? ? ? ? 'data scaling' ? ? ? 5 SnB 'then SOLVE/RESOLVE' ? ? ? ? phasing ? ? ? 6 REFMAC . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran_77 ? 7 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 46 ? ? -36.77 144.22 2 1 MSE A 63 ? ? -81.73 -81.85 3 1 ASP A 64 ? ? -92.82 -64.92 4 1 ASP A 65 ? ? -154.73 9.50 5 1 ASP A 92 ? ? -88.62 -70.16 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A LEU 34 ? A LEU 34 4 1 Y 1 A PHE 35 ? A PHE 35 5 1 Y 1 A LYS 36 ? A LYS 36 6 1 Y 1 A THR 37 ? A THR 37 7 1 Y 1 A ALA 38 ? A ALA 38 8 1 Y 1 A SER 39 ? A SER 39 9 1 Y 1 A GLU 40 ? A GLU 40 10 1 Y 1 A ILE 41 ? A ILE 41 11 1 Y 1 A GLU 42 ? A GLU 42 12 1 Y 1 A GLU 43 ? A GLU 43 13 1 Y 1 A ASP 131 ? A ASP 131 14 1 Y 1 A PHE 132 ? A PHE 132 15 1 Y 1 A LEU 137 ? A LEU 137 16 1 Y 1 A GLU 138 ? A GLU 138 17 1 Y 1 A PHE 139 ? A PHE 139 18 1 Y 1 A TYR 140 ? A TYR 140 19 1 Y 1 A ASN 141 ? A ASN 141 20 1 Y 1 A LYS 142 ? A LYS 142 21 1 Y 1 A GLN 143 ? A GLN 143 22 1 Y 1 A GLY 144 ? A GLY 144 23 1 Y 1 A LEU 145 ? A LEU 145 24 1 Y 1 A ASN 146 ? A ASN 146 25 1 Y 1 A GLU 147 ? A GLU 147 26 1 Y 1 A HIS 148 ? A HIS 148 27 1 Y 1 A ILE 149 ? A ILE 149 28 1 Y 1 A HIS 150 ? A HIS 150 29 1 Y 1 A TYR 151 ? A TYR 151 30 1 Y 1 A LEU 152 ? A LEU 152 31 1 Y 1 A ARG 153 ? A ARG 153 32 1 Y 1 A LYS 154 ? A LYS 154 33 1 Y 1 A PRO 155 ? A PRO 155 34 1 Y 1 A LEU 156 ? A LEU 156 35 1 Y 1 A ASN 157 ? A ASN 157 36 1 Y 1 A ARG 158 ? A ARG 158 37 1 Y 1 A LEU 159 ? A LEU 159 38 1 Y 1 A GLU 160 ? A GLU 160 39 1 Y 1 A HIS 161 ? A HIS 161 40 1 Y 1 A HIS 162 ? A HIS 162 41 1 Y 1 A HIS 163 ? A HIS 163 42 1 Y 1 A HIS 164 ? A HIS 164 43 1 Y 1 A HIS 165 ? A HIS 165 44 1 Y 1 A HIS 166 ? A HIS 166 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH #