data_3JW6
# 
_entry.id   3JW6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3JW6         pdb_00003jw6 10.2210/pdb3jw6/pdb 
RCSB  RCSB055235   ?            ?                   
WWPDB D_1000055235 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-12-08 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-01 
4 'Structure model' 1 3 2018-07-25 
5 'Structure model' 1 4 2024-11-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Refinement description'    
3  4 'Structure model' 'Data collection'           
4  4 'Structure model' 'Database references'       
5  4 'Structure model' 'Derived calculations'      
6  4 'Structure model' 'Refinement description'    
7  4 'Structure model' 'Source and taxonomy'       
8  4 'Structure model' 'Structure summary'         
9  5 'Structure model' 'Data collection'           
10 5 'Structure model' 'Database references'       
11 5 'Structure model' 'Derived calculations'      
12 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' software                  
2  4 'Structure model' entity                    
3  4 'Structure model' entity_src_gen            
4  4 'Structure model' entity_src_nat            
5  4 'Structure model' pdbx_struct_mod_residue   
6  4 'Structure model' software                  
7  4 'Structure model' struct_ref_seq_dif        
8  5 'Structure model' chem_comp_atom            
9  5 'Structure model' chem_comp_bond            
10 5 'Structure model' database_2                
11 5 'Structure model' pdbx_entry_details        
12 5 'Structure model' pdbx_modification_feature 
13 5 'Structure model' struct_conn               
14 5 'Structure model' struct_site               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_entity.src_method'                  
2 4 'Structure model' '_pdbx_struct_mod_residue.details'    
3 4 'Structure model' '_struct_ref_seq_dif.details'         
4 5 'Structure model' '_database_2.pdbx_DOI'                
5 5 'Structure model' '_database_2.pdbx_database_accession' 
6 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
7 5 'Structure model' '_struct_site.pdbx_auth_asym_id'      
8 5 'Structure model' '_struct_site.pdbx_auth_comp_id'      
9 5 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
_pdbx_database_status.entry_id                        3JW6 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2009-09-17 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3JVB 
_pdbx_database_related.details        'Polyhedrin protein of Wiseana spp. nucleopolyhedrosis virus' 
_pdbx_database_related.content_type   unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Coulibaly, F.' 1 
'Chiu, E.'      2 
'Metcalf, P.'   3 
# 
_citation.id                        primary 
_citation.title                     
'The atomic structure of baculovirus polyhedra reveals the independent emergence of infectious crystals in DNA and RNA viruses' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            106 
_citation.page_first                22205 
_citation.page_last                 22210 
_citation.year                      2009 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20007786 
_citation.pdbx_database_id_DOI      10.1073/pnas.0910686106 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Coulibaly, F.'      1  ? 
primary 'Chiu, E.'           2  ? 
primary 'Gutmann, S.'        3  ? 
primary 'Rajendran, C.'      4  ? 
primary 'Haebel, P.W.'       5  ? 
primary 'Ikeda, K.'          6  ? 
primary 'Mori, H.'           7  ? 
primary 'Ward, V.K.'         8  ? 
primary 'Schulze-Briese, C.' 9  ? 
primary 'Metcalf, P.'        10 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Polyhedrin     29018.131 1  ? G25D ? ? 
2 non-polymer syn 1,2-ETHANEDIOL 62.068    1  ? ?    ? ? 
3 water       nat water          18.015    74 ? ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Major occlusion protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)PDYSYRPTIGRTYVYDNKYYKNLDAVIKNAKRKKHFAEHEIEEATLDPLDNYLVAEDPFLGPGKNQKLTLFKEIR
NVKPDT(MSE)KLVVGWKGKEFYRETWTRF(MSE)EDSFPIVNDQEV(MSE)DVFLVVN(MSE)RPTRPNRCYKFLAQHA
LRCDPDYVPHDVIRIVEPSWVGSNNEYRISLAKKGGGCPI(MSE)NLHSEYTNSFEQFIDRVIWENFYKPIVYIGTDSAE
EEEILLEVSLVFKVKEFAPDAPLFTGPAY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPDYSYRPTIGRTYVYDNKYYKNLDAVIKNAKRKKHFAEHEIEEATLDPLDNYLVAEDPFLGPGKNQKLTLFKEIRNVKP
DTMKLVVGWKGKEFYRETWTRFMEDSFPIVNDQEVMDVFLVVNMRPTRPNRCYKFLAQHALRCDPDYVPHDVIRIVEPSW
VGSNNEYRISLAKKGGGCPIMNLHSEYTNSFEQFIDRVIWENFYKPIVYIGTDSAEEEEILLEVSLVFKVKEFAPDAPLF
TGPAY
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 1,2-ETHANEDIOL EDO 
3 water          HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   PRO n 
1 3   ASP n 
1 4   TYR n 
1 5   SER n 
1 6   TYR n 
1 7   ARG n 
1 8   PRO n 
1 9   THR n 
1 10  ILE n 
1 11  GLY n 
1 12  ARG n 
1 13  THR n 
1 14  TYR n 
1 15  VAL n 
1 16  TYR n 
1 17  ASP n 
1 18  ASN n 
1 19  LYS n 
1 20  TYR n 
1 21  TYR n 
1 22  LYS n 
1 23  ASN n 
1 24  LEU n 
1 25  ASP n 
1 26  ALA n 
1 27  VAL n 
1 28  ILE n 
1 29  LYS n 
1 30  ASN n 
1 31  ALA n 
1 32  LYS n 
1 33  ARG n 
1 34  LYS n 
1 35  LYS n 
1 36  HIS n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  HIS n 
1 41  GLU n 
1 42  ILE n 
1 43  GLU n 
1 44  GLU n 
1 45  ALA n 
1 46  THR n 
1 47  LEU n 
1 48  ASP n 
1 49  PRO n 
1 50  LEU n 
1 51  ASP n 
1 52  ASN n 
1 53  TYR n 
1 54  LEU n 
1 55  VAL n 
1 56  ALA n 
1 57  GLU n 
1 58  ASP n 
1 59  PRO n 
1 60  PHE n 
1 61  LEU n 
1 62  GLY n 
1 63  PRO n 
1 64  GLY n 
1 65  LYS n 
1 66  ASN n 
1 67  GLN n 
1 68  LYS n 
1 69  LEU n 
1 70  THR n 
1 71  LEU n 
1 72  PHE n 
1 73  LYS n 
1 74  GLU n 
1 75  ILE n 
1 76  ARG n 
1 77  ASN n 
1 78  VAL n 
1 79  LYS n 
1 80  PRO n 
1 81  ASP n 
1 82  THR n 
1 83  MSE n 
1 84  LYS n 
1 85  LEU n 
1 86  VAL n 
1 87  VAL n 
1 88  GLY n 
1 89  TRP n 
1 90  LYS n 
1 91  GLY n 
1 92  LYS n 
1 93  GLU n 
1 94  PHE n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  THR n 
1 99  TRP n 
1 100 THR n 
1 101 ARG n 
1 102 PHE n 
1 103 MSE n 
1 104 GLU n 
1 105 ASP n 
1 106 SER n 
1 107 PHE n 
1 108 PRO n 
1 109 ILE n 
1 110 VAL n 
1 111 ASN n 
1 112 ASP n 
1 113 GLN n 
1 114 GLU n 
1 115 VAL n 
1 116 MSE n 
1 117 ASP n 
1 118 VAL n 
1 119 PHE n 
1 120 LEU n 
1 121 VAL n 
1 122 VAL n 
1 123 ASN n 
1 124 MSE n 
1 125 ARG n 
1 126 PRO n 
1 127 THR n 
1 128 ARG n 
1 129 PRO n 
1 130 ASN n 
1 131 ARG n 
1 132 CYS n 
1 133 TYR n 
1 134 LYS n 
1 135 PHE n 
1 136 LEU n 
1 137 ALA n 
1 138 GLN n 
1 139 HIS n 
1 140 ALA n 
1 141 LEU n 
1 142 ARG n 
1 143 CYS n 
1 144 ASP n 
1 145 PRO n 
1 146 ASP n 
1 147 TYR n 
1 148 VAL n 
1 149 PRO n 
1 150 HIS n 
1 151 ASP n 
1 152 VAL n 
1 153 ILE n 
1 154 ARG n 
1 155 ILE n 
1 156 VAL n 
1 157 GLU n 
1 158 PRO n 
1 159 SER n 
1 160 TRP n 
1 161 VAL n 
1 162 GLY n 
1 163 SER n 
1 164 ASN n 
1 165 ASN n 
1 166 GLU n 
1 167 TYR n 
1 168 ARG n 
1 169 ILE n 
1 170 SER n 
1 171 LEU n 
1 172 ALA n 
1 173 LYS n 
1 174 LYS n 
1 175 GLY n 
1 176 GLY n 
1 177 GLY n 
1 178 CYS n 
1 179 PRO n 
1 180 ILE n 
1 181 MSE n 
1 182 ASN n 
1 183 LEU n 
1 184 HIS n 
1 185 SER n 
1 186 GLU n 
1 187 TYR n 
1 188 THR n 
1 189 ASN n 
1 190 SER n 
1 191 PHE n 
1 192 GLU n 
1 193 GLN n 
1 194 PHE n 
1 195 ILE n 
1 196 ASP n 
1 197 ARG n 
1 198 VAL n 
1 199 ILE n 
1 200 TRP n 
1 201 GLU n 
1 202 ASN n 
1 203 PHE n 
1 204 TYR n 
1 205 LYS n 
1 206 PRO n 
1 207 ILE n 
1 208 VAL n 
1 209 TYR n 
1 210 ILE n 
1 211 GLY n 
1 212 THR n 
1 213 ASP n 
1 214 SER n 
1 215 ALA n 
1 216 GLU n 
1 217 GLU n 
1 218 GLU n 
1 219 GLU n 
1 220 ILE n 
1 221 LEU n 
1 222 LEU n 
1 223 GLU n 
1 224 VAL n 
1 225 SER n 
1 226 LEU n 
1 227 VAL n 
1 228 PHE n 
1 229 LYS n 
1 230 VAL n 
1 231 LYS n 
1 232 GLU n 
1 233 PHE n 
1 234 ALA n 
1 235 PRO n 
1 236 ASP n 
1 237 ALA n 
1 238 PRO n 
1 239 LEU n 
1 240 PHE n 
1 241 THR n 
1 242 GLY n 
1 243 PRO n 
1 244 ALA n 
1 245 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   245 
_entity_src_gen.gene_src_common_name               AcMNPV 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PH, P29, POLH' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Autographa californica nuclear polyhedrosis virus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     46015 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 Sf21 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            sf9 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   
'Crystals were purified from Sf21 cells infected by the Autographa californica Multicapsid Nucleopolyhedrovirus (AcMNPV)' 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL   'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE        ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?                 'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE ?                 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?                 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MSE 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   ?   ?   ?   A . n 
A 1 4   TYR 4   4   ?   ?   ?   A . n 
A 1 5   SER 5   5   ?   ?   ?   A . n 
A 1 6   TYR 6   6   ?   ?   ?   A . n 
A 1 7   ARG 7   7   ?   ?   ?   A . n 
A 1 8   PRO 8   8   ?   ?   ?   A . n 
A 1 9   THR 9   9   ?   ?   ?   A . n 
A 1 10  ILE 10  10  ?   ?   ?   A . n 
A 1 11  GLY 11  11  11  GLY GLY A . n 
A 1 12  ARG 12  12  12  ARG ARG A . n 
A 1 13  THR 13  13  13  THR THR A . n 
A 1 14  TYR 14  14  14  TYR TYR A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  TYR 16  16  16  TYR TYR A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  ASN 18  18  18  ASN ASN A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  TYR 20  20  20  TYR TYR A . n 
A 1 21  TYR 21  21  21  TYR TYR A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  ASN 23  23  23  ASN ASN A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  ASP 25  25  25  ASP ASP A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  ILE 28  28  28  ILE ILE A . n 
A 1 29  LYS 29  29  ?   ?   ?   A . n 
A 1 30  ASN 30  30  ?   ?   ?   A . n 
A 1 31  ALA 31  31  ?   ?   ?   A . n 
A 1 32  LYS 32  32  ?   ?   ?   A . n 
A 1 33  ARG 33  33  ?   ?   ?   A . n 
A 1 34  LYS 34  34  ?   ?   ?   A . n 
A 1 35  LYS 35  35  ?   ?   ?   A . n 
A 1 36  HIS 36  36  ?   ?   ?   A . n 
A 1 37  PHE 37  37  ?   ?   ?   A . n 
A 1 38  ALA 38  38  ?   ?   ?   A . n 
A 1 39  GLU 39  39  ?   ?   ?   A . n 
A 1 40  HIS 40  40  ?   ?   ?   A . n 
A 1 41  GLU 41  41  ?   ?   ?   A . n 
A 1 42  ILE 42  42  ?   ?   ?   A . n 
A 1 43  GLU 43  43  ?   ?   ?   A . n 
A 1 44  GLU 44  44  ?   ?   ?   A . n 
A 1 45  ALA 45  45  ?   ?   ?   A . n 
A 1 46  THR 46  46  ?   ?   ?   A . n 
A 1 47  LEU 47  47  ?   ?   ?   A . n 
A 1 48  ASP 48  48  ?   ?   ?   A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  ASN 52  52  52  ASN ASN A . n 
A 1 53  TYR 53  53  53  TYR TYR A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  LEU 61  61  61  LEU LEU A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  GLN 67  67  67  GLN GLN A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  PHE 72  72  72  PHE PHE A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  GLU 74  74  74  GLU GLU A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  ASN 77  77  77  ASN ASN A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  ASP 81  81  81  ASP ASP A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  MSE 83  83  83  MSE MSE A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  VAL 86  86  86  VAL VAL A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  TRP 89  89  89  TRP TRP A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  PHE 94  94  94  PHE PHE A . n 
A 1 95  TYR 95  95  95  TYR TYR A . n 
A 1 96  ARG 96  96  96  ARG ARG A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  THR 98  98  98  THR THR A . n 
A 1 99  TRP 99  99  99  TRP TRP A . n 
A 1 100 THR 100 100 100 THR THR A . n 
A 1 101 ARG 101 101 101 ARG ARG A . n 
A 1 102 PHE 102 102 102 PHE PHE A . n 
A 1 103 MSE 103 103 103 MSE MSE A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 SER 106 106 106 SER SER A . n 
A 1 107 PHE 107 107 107 PHE PHE A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 ILE 109 109 109 ILE ILE A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 ASN 111 111 111 ASN ASN A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 GLN 113 113 113 GLN GLN A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 MSE 116 116 116 MSE MSE A . n 
A 1 117 ASP 117 117 117 ASP ASP A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 PHE 119 119 119 PHE PHE A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 VAL 121 121 121 VAL VAL A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 ASN 123 123 123 ASN ASN A . n 
A 1 124 MSE 124 124 124 MSE MSE A . n 
A 1 125 ARG 125 125 125 ARG ARG A . n 
A 1 126 PRO 126 126 126 PRO PRO A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 ARG 128 128 128 ARG ARG A . n 
A 1 129 PRO 129 129 129 PRO PRO A . n 
A 1 130 ASN 130 130 130 ASN ASN A . n 
A 1 131 ARG 131 131 131 ARG ARG A . n 
A 1 132 CYS 132 132 132 CYS CYS A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 PHE 135 135 135 PHE PHE A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 GLN 138 138 138 GLN GLN A . n 
A 1 139 HIS 139 139 139 HIS HIS A . n 
A 1 140 ALA 140 140 140 ALA ALA A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 ARG 142 142 ?   ?   ?   A . n 
A 1 143 CYS 143 143 ?   ?   ?   A . n 
A 1 144 ASP 144 144 ?   ?   ?   A . n 
A 1 145 PRO 145 145 ?   ?   ?   A . n 
A 1 146 ASP 146 146 ?   ?   ?   A . n 
A 1 147 TYR 147 147 147 TYR TYR A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 HIS 150 150 150 HIS HIS A . n 
A 1 151 ASP 151 151 151 ASP ASP A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 ILE 153 153 153 ILE ILE A . n 
A 1 154 ARG 154 154 154 ARG ARG A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 VAL 156 156 156 VAL VAL A . n 
A 1 157 GLU 157 157 157 GLU GLU A . n 
A 1 158 PRO 158 158 158 PRO PRO A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 TRP 160 160 160 TRP TRP A . n 
A 1 161 VAL 161 161 161 VAL VAL A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 ASN 164 164 164 ASN ASN A . n 
A 1 165 ASN 165 165 165 ASN ASN A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 TYR 167 167 167 TYR TYR A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 ILE 169 169 169 ILE ILE A . n 
A 1 170 SER 170 170 170 SER SER A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 LYS 173 173 ?   ?   ?   A . n 
A 1 174 LYS 174 174 ?   ?   ?   A . n 
A 1 175 GLY 175 175 ?   ?   ?   A . n 
A 1 176 GLY 176 176 ?   ?   ?   A . n 
A 1 177 GLY 177 177 ?   ?   ?   A . n 
A 1 178 CYS 178 178 ?   ?   ?   A . n 
A 1 179 PRO 179 179 ?   ?   ?   A . n 
A 1 180 ILE 180 180 ?   ?   ?   A . n 
A 1 181 MSE 181 181 ?   ?   ?   A . n 
A 1 182 ASN 182 182 ?   ?   ?   A . n 
A 1 183 LEU 183 183 ?   ?   ?   A . n 
A 1 184 HIS 184 184 ?   ?   ?   A . n 
A 1 185 SER 185 185 ?   ?   ?   A . n 
A 1 186 GLU 186 186 ?   ?   ?   A . n 
A 1 187 TYR 187 187 ?   ?   ?   A . n 
A 1 188 THR 188 188 188 THR THR A . n 
A 1 189 ASN 189 189 189 ASN ASN A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 PHE 191 191 191 PHE PHE A . n 
A 1 192 GLU 192 192 192 GLU GLU A . n 
A 1 193 GLN 193 193 193 GLN GLN A . n 
A 1 194 PHE 194 194 194 PHE PHE A . n 
A 1 195 ILE 195 195 195 ILE ILE A . n 
A 1 196 ASP 196 196 196 ASP ASP A . n 
A 1 197 ARG 197 197 197 ARG ARG A . n 
A 1 198 VAL 198 198 198 VAL VAL A . n 
A 1 199 ILE 199 199 ?   ?   ?   A . n 
A 1 200 TRP 200 200 ?   ?   ?   A . n 
A 1 201 GLU 201 201 ?   ?   ?   A . n 
A 1 202 ASN 202 202 ?   ?   ?   A . n 
A 1 203 PHE 203 203 203 PHE PHE A . n 
A 1 204 TYR 204 204 204 TYR TYR A . n 
A 1 205 LYS 205 205 205 LYS LYS A . n 
A 1 206 PRO 206 206 206 PRO PRO A . n 
A 1 207 ILE 207 207 207 ILE ILE A . n 
A 1 208 VAL 208 208 208 VAL VAL A . n 
A 1 209 TYR 209 209 209 TYR TYR A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 GLY 211 211 211 GLY GLY A . n 
A 1 212 THR 212 212 212 THR THR A . n 
A 1 213 ASP 213 213 213 ASP ASP A . n 
A 1 214 SER 214 214 214 SER SER A . n 
A 1 215 ALA 215 215 215 ALA ALA A . n 
A 1 216 GLU 216 216 216 GLU GLU A . n 
A 1 217 GLU 217 217 217 GLU GLU A . n 
A 1 218 GLU 218 218 218 GLU GLU A . n 
A 1 219 GLU 219 219 219 GLU GLU A . n 
A 1 220 ILE 220 220 220 ILE ILE A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 GLU 223 223 223 GLU GLU A . n 
A 1 224 VAL 224 224 224 VAL VAL A . n 
A 1 225 SER 225 225 225 SER SER A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 VAL 227 227 227 VAL VAL A . n 
A 1 228 PHE 228 228 228 PHE PHE A . n 
A 1 229 LYS 229 229 229 LYS LYS A . n 
A 1 230 VAL 230 230 230 VAL VAL A . n 
A 1 231 LYS 231 231 231 LYS LYS A . n 
A 1 232 GLU 232 232 232 GLU GLU A . n 
A 1 233 PHE 233 233 233 PHE PHE A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 ASP 236 236 236 ASP ASP A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 PRO 238 238 238 PRO PRO A . n 
A 1 239 LEU 239 239 239 LEU LEU A . n 
A 1 240 PHE 240 240 240 PHE PHE A . n 
A 1 241 THR 241 241 241 THR THR A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 PRO 243 243 243 PRO PRO A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 TYR 245 245 245 TYR TYR A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 EDO 1  246 246 EDO EDO A . 
C 3 HOH 1  247 247 HOH HOH A . 
C 3 HOH 2  248 248 HOH HOH A . 
C 3 HOH 3  249 249 HOH HOH A . 
C 3 HOH 4  250 250 HOH HOH A . 
C 3 HOH 5  251 251 HOH HOH A . 
C 3 HOH 6  252 252 HOH HOH A . 
C 3 HOH 7  253 253 HOH HOH A . 
C 3 HOH 8  254 254 HOH HOH A . 
C 3 HOH 9  255 255 HOH HOH A . 
C 3 HOH 10 256 256 HOH HOH A . 
C 3 HOH 11 257 257 HOH HOH A . 
C 3 HOH 12 258 258 HOH HOH A . 
C 3 HOH 13 259 259 HOH HOH A . 
C 3 HOH 14 260 260 HOH HOH A . 
C 3 HOH 15 261 261 HOH HOH A . 
C 3 HOH 16 262 262 HOH HOH A . 
C 3 HOH 17 263 263 HOH HOH A . 
C 3 HOH 18 264 264 HOH HOH A . 
C 3 HOH 19 265 265 HOH HOH A . 
C 3 HOH 20 266 266 HOH HOH A . 
C 3 HOH 21 267 267 HOH HOH A . 
C 3 HOH 22 268 268 HOH HOH A . 
C 3 HOH 23 269 269 HOH HOH A . 
C 3 HOH 24 270 270 HOH HOH A . 
C 3 HOH 25 271 271 HOH HOH A . 
C 3 HOH 26 272 272 HOH HOH A . 
C 3 HOH 27 273 273 HOH HOH A . 
C 3 HOH 28 274 274 HOH HOH A . 
C 3 HOH 29 275 275 HOH HOH A . 
C 3 HOH 30 276 276 HOH HOH A . 
C 3 HOH 31 277 277 HOH HOH A . 
C 3 HOH 32 278 278 HOH HOH A . 
C 3 HOH 33 279 279 HOH HOH A . 
C 3 HOH 34 280 280 HOH HOH A . 
C 3 HOH 35 281 281 HOH HOH A . 
C 3 HOH 36 282 282 HOH HOH A . 
C 3 HOH 37 283 283 HOH HOH A . 
C 3 HOH 38 284 284 HOH HOH A . 
C 3 HOH 39 285 285 HOH HOH A . 
C 3 HOH 40 286 286 HOH HOH A . 
C 3 HOH 41 287 287 HOH HOH A . 
C 3 HOH 42 288 288 HOH HOH A . 
C 3 HOH 43 289 289 HOH HOH A . 
C 3 HOH 44 290 290 HOH HOH A . 
C 3 HOH 45 291 291 HOH HOH A . 
C 3 HOH 46 292 292 HOH HOH A . 
C 3 HOH 47 293 293 HOH HOH A . 
C 3 HOH 48 294 294 HOH HOH A . 
C 3 HOH 49 295 295 HOH HOH A . 
C 3 HOH 50 296 296 HOH HOH A . 
C 3 HOH 51 297 297 HOH HOH A . 
C 3 HOH 52 298 298 HOH HOH A . 
C 3 HOH 53 299 299 HOH HOH A . 
C 3 HOH 54 300 300 HOH HOH A . 
C 3 HOH 55 301 301 HOH HOH A . 
C 3 HOH 56 302 302 HOH HOH A . 
C 3 HOH 57 303 303 HOH HOH A . 
C 3 HOH 58 304 304 HOH HOH A . 
C 3 HOH 59 305 305 HOH HOH A . 
C 3 HOH 60 306 306 HOH HOH A . 
C 3 HOH 61 307 307 HOH HOH A . 
C 3 HOH 62 308 308 HOH HOH A . 
C 3 HOH 63 309 309 HOH HOH A . 
C 3 HOH 64 310 310 HOH HOH A . 
C 3 HOH 65 311 311 HOH HOH A . 
C 3 HOH 66 312 312 HOH HOH A . 
C 3 HOH 67 313 313 HOH HOH A . 
C 3 HOH 68 314 314 HOH HOH A . 
C 3 HOH 69 315 315 HOH HOH A . 
C 3 HOH 70 316 316 HOH HOH A . 
C 3 HOH 71 317 317 HOH HOH A . 
C 3 HOH 72 318 318 HOH HOH A . 
C 3 HOH 73 319 319 HOH HOH A . 
C 3 HOH 74 320 320 HOH HOH A . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 19  ? CG  ? A LYS 19  CG  
2  1 Y 1 A LYS 19  ? CD  ? A LYS 19  CD  
3  1 Y 1 A LYS 19  ? CE  ? A LYS 19  CE  
4  1 Y 1 A LYS 19  ? NZ  ? A LYS 19  NZ  
5  1 Y 1 A ASP 51  ? CG  ? A ASP 51  CG  
6  1 Y 1 A ASP 51  ? OD1 ? A ASP 51  OD1 
7  1 Y 1 A ASP 51  ? OD2 ? A ASP 51  OD2 
8  1 Y 1 A TYR 147 ? CG  ? A TYR 147 CG  
9  1 Y 1 A TYR 147 ? CD1 ? A TYR 147 CD1 
10 1 Y 1 A TYR 147 ? CD2 ? A TYR 147 CD2 
11 1 Y 1 A TYR 147 ? CE1 ? A TYR 147 CE1 
12 1 Y 1 A TYR 147 ? CE2 ? A TYR 147 CE2 
13 1 Y 1 A TYR 147 ? CZ  ? A TYR 147 CZ  
14 1 Y 1 A TYR 147 ? OH  ? A TYR 147 OH  
15 1 Y 1 A ARG 197 ? CG  ? A ARG 197 CG  
16 1 Y 1 A ARG 197 ? CD  ? A ARG 197 CD  
17 1 Y 1 A ARG 197 ? NE  ? A ARG 197 NE  
18 1 Y 1 A ARG 197 ? CZ  ? A ARG 197 CZ  
19 1 Y 1 A ARG 197 ? NH1 ? A ARG 197 NH1 
20 1 Y 1 A ARG 197 ? NH2 ? A ARG 197 NH2 
21 1 Y 1 A VAL 198 ? CG1 ? A VAL 198 CG1 
22 1 Y 1 A VAL 198 ? CG2 ? A VAL 198 CG2 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .     ?               package 'Zbyszek Otwinowski'  hkl@hkl-xray.com                'data reduction'  
http://www.hkl-xray.com/                  ?   ? 
2 SCALEPACK   .     ?               package 'Zbyszek Otwinowski'  hkl@hkl-xray.com                'data scaling'    
http://www.hkl-xray.com/                  ?   ? 
3 SHARP       .     ?               package 'Eric de La Fortelle' sharp-develop@globalphasing.com phasing           
http://www.globalphasing.com/sharp/       ?   ? 
4 PDB_EXTRACT 3.005 'June 11, 2008' package PDB                   help@deposit.rcsb.org           'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 
5 MAR345      .     ?               ?       ?                     ?                               'data collection' ? ?   ? 
6 BUSTER-TNT  2.8.0 ?               ?       ?                     ?                               refinement        ? ?   ? 
# 
_cell.entry_id           3JW6 
_cell.length_a           103.183 
_cell.length_b           103.183 
_cell.length_c           103.183 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3JW6 
_symmetry.space_group_name_H-M             'I 2 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                197 
_symmetry.space_group_name_Hall            ? 
# 
_exptl.crystals_number   5 
_exptl.entry_id          3JW6 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        0.477 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      1.579947 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   22.149273 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'Natural intracellular crystals were directly purified from Sf21 cells infected by the AcMNPV baculovirus, pH 7, temperature 300K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 165 mm' 
_diffrn_detector.pdbx_collection_date   2007-02-17 
_diffrn_detector.details                'MD2 microdiffractometer' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    
'SAGITALLY HORIZONTAL FOCUSSING SI(111) MERIDIONALLY VERTICAL FOCUSSING RH-COATED MIRROR' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9789 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9789 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
# 
_reflns.entry_id                     3JW6 
_reflns.d_resolution_high            2.300 
_reflns.d_resolution_low             20.000 
_reflns.number_obs                   8256 
_reflns.pdbx_Rmerge_I_obs            0.149 
_reflns.pdbx_netI_over_sigmaI        6.200 
_reflns.pdbx_chi_squared             0.998 
_reflns.pdbx_redundancy              6.600 
_reflns.percent_possible_obs         99.700 
_reflns.observed_criterion_sigma_F   -3.0 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.number_all                   8281 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        31.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.38 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.550 
_reflns_shell.meanI_over_sigI_obs    3.8 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       0.963 
_reflns_shell.pdbx_redundancy        6.30 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      800 
_reflns_shell.percent_possible_all   99.10 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3JW6 
_refine.ls_d_res_high                            2.300 
_refine.ls_d_res_low                             18.840 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_number_reflns_obs                     8240 
_refine.ls_number_reflns_all                     8240 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;Residue ACys132 forms a disulfide bond with residue BCys132 of symmetry molecule 4566. By symmetry, this also implies that residue BCys132 forms a disulfide bond with residue ACys132 of symmetry molecule 4566.
;
_refine.ls_R_factor_all                          0.166 
_refine.ls_R_factor_obs                          0.166 
_refine.ls_R_factor_R_work                       0.161 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.214 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 9.840 
_refine.ls_number_reflns_R_free                  811 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               24.422 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.aniso_B[1][1]                            0.000 
_refine.aniso_B[2][2]                            0.000 
_refine.aniso_B[3][3]                            0.000 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.947 
_refine.correlation_coeff_Fo_to_Fc_free          0.918 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                87.92 
_refine.B_iso_min                                7.20 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.50 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3JW6 
_refine_analyze.Luzzati_coordinate_error_obs    0.199 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1577 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             74 
_refine_hist.number_atoms_total               1655 
_refine_hist.d_res_high                       2.300 
_refine_hist.d_res_low                        18.840 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
o_bond_d           0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_deg        1.04  ? ? ? 'X-RAY DIFFRACTION' ? 
o_dihedral_angle_d 18.55 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.570 
_refine_ls_shell.pdbx_total_number_of_bins_used   5 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.number_reflns_R_work             2069 
_refine_ls_shell.R_factor_all                     0.171 
_refine_ls_shell.R_factor_R_work                  0.164 
_refine_ls_shell.R_factor_R_free                  0.235 
_refine_ls_shell.percent_reflns_R_free            10.000 
_refine_ls_shell.number_reflns_R_free             230 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2299 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3JW6 
_struct.title                     'Crystal structure of AcMNPV baculovirus polyhedra' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3JW6 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
_struct_keywords.text            'Jelly-roll, disulfide bond, domain swapping, Viral occlusion body, VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PYHD_NPVAC 
_struct_ref.pdbx_db_accession          P04871 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MPDYSYRPTIGRTYVYDNKYYKNLGAVIKNAKRKKHFAEHEIEEATLDPLDNYLVAEDPFLGPGKNQKLTLFKEIRNVKP
DTMKLVVGWKGKEFYRETWTRFMEDSFPIVNDQEVMDVFLVVNMRPTRPNRCYKFLAQHALRCDPDYVPHDVIRIVEPSW
VGSNNEYRISLAKKGGGCPIMNLHSEYTNSFEQFIDRVIWENFYKPIVYIGTDSAEEEEILLEVSLVFKVKEFAPDAPLF
TGPAY
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3JW6 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 245 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04871 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  245 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       245 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             3JW6 
_struct_ref_seq_dif.mon_id                       ASP 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      25 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P04871 
_struct_ref_seq_dif.db_mon_id                    GLY 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          25 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            25 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dodecameric 
_pdbx_struct_assembly.oligomeric_count     12 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 56170  ? 
1 MORE         -266   ? 
1 'SSA (A^2)'  107520 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4,5,6,7,8,9,10,11,12 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1  'identity operation'         1_555  x,y,z       1.0000000000  0.0000000000  0.0000000000  0.0000000000   0.0000000000  
1.0000000000  0.0000000000  0.0000000000   0.0000000000  0.0000000000  1.0000000000  0.0000000000   
2  'crystal symmetry operation' 2_665  -x+1,-y+1,z -1.0000000000 0.0000000000  0.0000000000  103.1830000000 0.0000000000  
-1.0000000000 0.0000000000  103.1830000000 0.0000000000  0.0000000000  1.0000000000  0.0000000000   
3  'crystal symmetry operation' 3_656  -x+1,y,-z+1 -1.0000000000 0.0000000000  0.0000000000  103.1830000000 0.0000000000  
1.0000000000  0.0000000000  0.0000000000   0.0000000000  0.0000000000  -1.0000000000 103.1830000000 
4  'crystal symmetry operation' 4_566  x,-y+1,-z+1 1.0000000000  0.0000000000  0.0000000000  0.0000000000   0.0000000000  
-1.0000000000 0.0000000000  103.1830000000 0.0000000000  0.0000000000  -1.0000000000 103.1830000000 
5  'crystal symmetry operation' 5_555  z,x,y       0.0000000000  0.0000000000  1.0000000000  0.0000000000   1.0000000000  
0.0000000000  0.0000000000  0.0000000000   0.0000000000  1.0000000000  0.0000000000  0.0000000000   
6  'crystal symmetry operation' 6_566  z,-x+1,-y+1 0.0000000000  0.0000000000  1.0000000000  0.0000000000   -1.0000000000 
0.0000000000  0.0000000000  103.1830000000 0.0000000000  -1.0000000000 0.0000000000  103.1830000000 
7  'crystal symmetry operation' 7_665  -z+1,-x+1,y 0.0000000000  0.0000000000  -1.0000000000 103.1830000000 -1.0000000000 
0.0000000000  0.0000000000  103.1830000000 0.0000000000  1.0000000000  0.0000000000  0.0000000000   
8  'crystal symmetry operation' 8_656  -z+1,x,-y+1 0.0000000000  0.0000000000  -1.0000000000 103.1830000000 1.0000000000  
0.0000000000  0.0000000000  0.0000000000   0.0000000000  -1.0000000000 0.0000000000  103.1830000000 
9  'crystal symmetry operation' 9_555  y,z,x       0.0000000000  1.0000000000  0.0000000000  0.0000000000   0.0000000000  
0.0000000000  1.0000000000  0.0000000000   1.0000000000  0.0000000000  0.0000000000  0.0000000000   
10 'crystal symmetry operation' 10_656 -y+1,z,-x+1 0.0000000000  -1.0000000000 0.0000000000  103.1830000000 0.0000000000  
0.0000000000  1.0000000000  0.0000000000   -1.0000000000 0.0000000000  0.0000000000  103.1830000000 
11 'crystal symmetry operation' 11_566 y,-z+1,-x+1 0.0000000000  1.0000000000  0.0000000000  0.0000000000   0.0000000000  
0.0000000000  -1.0000000000 103.1830000000 -1.0000000000 0.0000000000  0.0000000000  103.1830000000 
12 'crystal symmetry operation' 12_665 -y+1,-z+1,x 0.0000000000  -1.0000000000 0.0000000000  103.1830000000 0.0000000000  
0.0000000000  -1.0000000000 103.1830000000 1.0000000000  0.0000000000  0.0000000000  0.0000000000   
# 
_struct_biol.id        1 
_struct_biol.details   
;POLYHEDRA ARE VIRUS-CONTAINING CRYSTALS, WHICH REPRESENT THE MAIN INFECTIOUS FORM OF BACULOVIRUS. THE BIOLOGICAL ASSEMBLY IS THE WHOLE CRYSTAL. DODECAMERS OF THE POLYHEDRIN PROTEIN ARE PUTATIVE BUILDING BLOCKS OF THE CRYSTAL, WHICH ARE GENERATED BY THE SYMMETRY OPERATIONS.
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 23  ? ILE A 28  ? ASN A 23  ILE A 28  1 ? 6  
HELX_P HELX_P2 2 PRO A 49  ? TYR A 53  ? PRO A 49  TYR A 53  5 ? 5  
HELX_P HELX_P3 3 LYS A 90  ? PHE A 107 ? LYS A 90  PHE A 107 1 ? 18 
HELX_P HELX_P4 4 SER A 190 ? ARG A 197 ? SER A 190 ARG A 197 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 132 SG B ? ? 1_555 A CYS 132 SG B ? A CYS 132 A CYS 132 4_566 ? ? ? ? ? ? ? 2.416 ? ? 
covale1 covale both ? A THR 82  C  ? ? ? 1_555 A MSE 83  N  ? ? A THR 82  A MSE 83  1_555 ? ? ? ? ? ? ? 1.345 ? ? 
covale2 covale both ? A MSE 83  C  ? ? ? 1_555 A LYS 84  N  ? ? A MSE 83  A LYS 84  1_555 ? ? ? ? ? ? ? 1.340 ? ? 
covale3 covale both ? A PHE 102 C  ? ? ? 1_555 A MSE 103 N  ? ? A PHE 102 A MSE 103 1_555 ? ? ? ? ? ? ? 1.346 ? ? 
covale4 covale both ? A MSE 103 C  ? ? ? 1_555 A GLU 104 N  ? ? A MSE 103 A GLU 104 1_555 ? ? ? ? ? ? ? 1.350 ? ? 
covale5 covale both ? A VAL 115 C  ? ? ? 1_555 A MSE 116 N  ? ? A VAL 115 A MSE 116 1_555 ? ? ? ? ? ? ? 1.340 ? ? 
covale6 covale both ? A MSE 116 C  ? ? ? 1_555 A ASP 117 N  ? ? A MSE 116 A ASP 117 1_555 ? ? ? ? ? ? ? 1.353 ? ? 
covale7 covale both ? A ASN 123 C  ? ? ? 1_555 A MSE 124 N  ? ? A ASN 123 A MSE 124 1_555 ? ? ? ? ? ? ? 1.343 ? ? 
covale8 covale both ? A MSE 124 C  ? ? ? 1_555 A ARG 125 N  ? ? A MSE 124 A ARG 125 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 MSE A 83  ? .   . .   . MSE A 83  ? 1_555 .   . .   . .     .  .  MET 1 MSE Selenomethionine 'Named protein modification' 
2 MSE A 103 ? .   . .   . MSE A 103 ? 1_555 .   . .   . .     .  .  MET 1 MSE Selenomethionine 'Named protein modification' 
3 MSE A 116 ? .   . .   . MSE A 116 ? 1_555 .   . .   . .     .  .  MET 1 MSE Selenomethionine 'Named protein modification' 
4 MSE A 124 ? .   . .   . MSE A 124 ? 1_555 .   . .   . .     .  .  MET 1 MSE Selenomethionine 'Named protein modification' 
5 CYS A 132 B CYS A 132 B CYS A 132 ? 1_555 CYS A 132 ? 4_566 SG SG .   . .   None             'Disulfide bridge'           
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 107 A . ? PHE 107 A PRO 108 A ? PRO 108 A 1 -0.40 
2 PHE 107 A . ? PHE 107 A PRO 108 A ? PRO 108 A 1 0.53  
3 GLY 242 A . ? GLY 242 A PRO 243 A ? PRO 243 A 1 -2.34 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
C ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 13  ? TYR A 16  ? THR A 13  TYR A 16  
A 2 LYS A 19  ? LYS A 22  ? LYS A 19  LYS A 22  
B 1 LYS A 65  ? VAL A 78  ? LYS A 65  VAL A 78  
B 2 GLU A 218 ? PHE A 233 ? GLU A 218 PHE A 233 
B 3 ASP A 112 ? PRO A 126 ? ASP A 112 PRO A 126 
B 4 GLU A 166 ? SER A 170 ? GLU A 166 SER A 170 
C 1 VAL A 152 ? ARG A 154 ? VAL A 152 ARG A 154 
C 2 THR A 82  ? LEU A 85  ? THR A 82  LEU A 85  
C 3 ILE A 207 ? THR A 212 ? ILE A 207 THR A 212 
C 4 PHE A 135 ? ALA A 140 ? PHE A 135 ALA A 140 
C 5 SER A 159 ? TRP A 160 ? SER A 159 TRP A 160 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 14  ? N TYR A 14  O TYR A 21  ? O TYR A 21  
B 1 2 N GLU A 74  ? N GLU A 74  O LEU A 222 ? O LEU A 222 
B 2 3 O SER A 225 ? O SER A 225 N VAL A 121 ? N VAL A 121 
B 3 4 N LEU A 120 ? N LEU A 120 O ILE A 169 ? O ILE A 169 
C 1 2 O ILE A 153 ? O ILE A 153 N MSE A 83  ? N MSE A 83  
C 2 3 N LYS A 84  ? N LYS A 84  O ILE A 210 ? O ILE A 210 
C 3 4 O GLY A 211 ? O GLY A 211 N LEU A 136 ? N LEU A 136 
C 4 5 N ALA A 137 ? N ALA A 137 O SER A 159 ? O SER A 159 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    EDO 
_struct_site.pdbx_auth_seq_id     246 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE EDO A 246' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 ARG A 154 ? ARG A 154 . ? 8_656 ? 
2 AC1 4 VAL A 156 ? VAL A 156 . ? 8_656 ? 
3 AC1 4 GLU A 232 ? GLU A 232 . ? 1_555 ? 
4 AC1 4 HOH C .   ? HOH A 284 . ? 8_656 ? 
# 
_pdbx_entry_details.entry_id                   3JW6 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO A 63  ? ? -48.76  151.12 
2 1 PHE A 233 ? ? -112.20 75.82  
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 83  A MSE 83  ? MET 'modified residue' 
2 A MSE 103 A MSE 103 ? MET 'modified residue' 
3 A MSE 116 A MSE 116 ? MET 'modified residue' 
4 A MSE 124 A MSE 124 ? MET 'modified residue' 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 308 ? C HOH . 
2 1 A HOH 309 ? C HOH . 
# 
_phasing.method   MIR 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MSE 1   ? A MSE 1   
2  1 Y 1 A PRO 2   ? A PRO 2   
3  1 Y 1 A ASP 3   ? A ASP 3   
4  1 Y 1 A TYR 4   ? A TYR 4   
5  1 Y 1 A SER 5   ? A SER 5   
6  1 Y 1 A TYR 6   ? A TYR 6   
7  1 Y 1 A ARG 7   ? A ARG 7   
8  1 Y 1 A PRO 8   ? A PRO 8   
9  1 Y 1 A THR 9   ? A THR 9   
10 1 Y 1 A ILE 10  ? A ILE 10  
11 1 Y 1 A LYS 29  ? A LYS 29  
12 1 Y 1 A ASN 30  ? A ASN 30  
13 1 Y 1 A ALA 31  ? A ALA 31  
14 1 Y 1 A LYS 32  ? A LYS 32  
15 1 Y 1 A ARG 33  ? A ARG 33  
16 1 Y 1 A LYS 34  ? A LYS 34  
17 1 Y 1 A LYS 35  ? A LYS 35  
18 1 Y 1 A HIS 36  ? A HIS 36  
19 1 Y 1 A PHE 37  ? A PHE 37  
20 1 Y 1 A ALA 38  ? A ALA 38  
21 1 Y 1 A GLU 39  ? A GLU 39  
22 1 Y 1 A HIS 40  ? A HIS 40  
23 1 Y 1 A GLU 41  ? A GLU 41  
24 1 Y 1 A ILE 42  ? A ILE 42  
25 1 Y 1 A GLU 43  ? A GLU 43  
26 1 Y 1 A GLU 44  ? A GLU 44  
27 1 Y 1 A ALA 45  ? A ALA 45  
28 1 Y 1 A THR 46  ? A THR 46  
29 1 Y 1 A LEU 47  ? A LEU 47  
30 1 Y 1 A ASP 48  ? A ASP 48  
31 1 Y 1 A ARG 142 ? A ARG 142 
32 1 Y 1 A CYS 143 ? A CYS 143 
33 1 Y 1 A ASP 144 ? A ASP 144 
34 1 Y 1 A PRO 145 ? A PRO 145 
35 1 Y 1 A ASP 146 ? A ASP 146 
36 1 Y 1 A LYS 173 ? A LYS 173 
37 1 Y 1 A LYS 174 ? A LYS 174 
38 1 Y 1 A GLY 175 ? A GLY 175 
39 1 Y 1 A GLY 176 ? A GLY 176 
40 1 Y 1 A GLY 177 ? A GLY 177 
41 1 Y 1 A CYS 178 ? A CYS 178 
42 1 Y 1 A PRO 179 ? A PRO 179 
43 1 Y 1 A ILE 180 ? A ILE 180 
44 1 Y 1 A MSE 181 ? A MSE 181 
45 1 Y 1 A ASN 182 ? A ASN 182 
46 1 Y 1 A LEU 183 ? A LEU 183 
47 1 Y 1 A HIS 184 ? A HIS 184 
48 1 Y 1 A SER 185 ? A SER 185 
49 1 Y 1 A GLU 186 ? A GLU 186 
50 1 Y 1 A TYR 187 ? A TYR 187 
51 1 Y 1 A ILE 199 ? A ILE 199 
52 1 Y 1 A TRP 200 ? A TRP 200 
53 1 Y 1 A GLU 201 ? A GLU 201 
54 1 Y 1 A ASN 202 ? A ASN 202 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CYS N    N  N N 74  
CYS CA   C  N R 75  
CYS C    C  N N 76  
CYS O    O  N N 77  
CYS CB   C  N N 78  
CYS SG   S  N N 79  
CYS OXT  O  N N 80  
CYS H    H  N N 81  
CYS H2   H  N N 82  
CYS HA   H  N N 83  
CYS HB2  H  N N 84  
CYS HB3  H  N N 85  
CYS HG   H  N N 86  
CYS HXT  H  N N 87  
EDO C1   C  N N 88  
EDO O1   O  N N 89  
EDO C2   C  N N 90  
EDO O2   O  N N 91  
EDO H11  H  N N 92  
EDO H12  H  N N 93  
EDO HO1  H  N N 94  
EDO H21  H  N N 95  
EDO H22  H  N N 96  
EDO HO2  H  N N 97  
GLN N    N  N N 98  
GLN CA   C  N S 99  
GLN C    C  N N 100 
GLN O    O  N N 101 
GLN CB   C  N N 102 
GLN CG   C  N N 103 
GLN CD   C  N N 104 
GLN OE1  O  N N 105 
GLN NE2  N  N N 106 
GLN OXT  O  N N 107 
GLN H    H  N N 108 
GLN H2   H  N N 109 
GLN HA   H  N N 110 
GLN HB2  H  N N 111 
GLN HB3  H  N N 112 
GLN HG2  H  N N 113 
GLN HG3  H  N N 114 
GLN HE21 H  N N 115 
GLN HE22 H  N N 116 
GLN HXT  H  N N 117 
GLU N    N  N N 118 
GLU CA   C  N S 119 
GLU C    C  N N 120 
GLU O    O  N N 121 
GLU CB   C  N N 122 
GLU CG   C  N N 123 
GLU CD   C  N N 124 
GLU OE1  O  N N 125 
GLU OE2  O  N N 126 
GLU OXT  O  N N 127 
GLU H    H  N N 128 
GLU H2   H  N N 129 
GLU HA   H  N N 130 
GLU HB2  H  N N 131 
GLU HB3  H  N N 132 
GLU HG2  H  N N 133 
GLU HG3  H  N N 134 
GLU HE2  H  N N 135 
GLU HXT  H  N N 136 
GLY N    N  N N 137 
GLY CA   C  N N 138 
GLY C    C  N N 139 
GLY O    O  N N 140 
GLY OXT  O  N N 141 
GLY H    H  N N 142 
GLY H2   H  N N 143 
GLY HA2  H  N N 144 
GLY HA3  H  N N 145 
GLY HXT  H  N N 146 
HIS N    N  N N 147 
HIS CA   C  N S 148 
HIS C    C  N N 149 
HIS O    O  N N 150 
HIS CB   C  N N 151 
HIS CG   C  Y N 152 
HIS ND1  N  Y N 153 
HIS CD2  C  Y N 154 
HIS CE1  C  Y N 155 
HIS NE2  N  Y N 156 
HIS OXT  O  N N 157 
HIS H    H  N N 158 
HIS H2   H  N N 159 
HIS HA   H  N N 160 
HIS HB2  H  N N 161 
HIS HB3  H  N N 162 
HIS HD1  H  N N 163 
HIS HD2  H  N N 164 
HIS HE1  H  N N 165 
HIS HE2  H  N N 166 
HIS HXT  H  N N 167 
HOH O    O  N N 168 
HOH H1   H  N N 169 
HOH H2   H  N N 170 
ILE N    N  N N 171 
ILE CA   C  N S 172 
ILE C    C  N N 173 
ILE O    O  N N 174 
ILE CB   C  N S 175 
ILE CG1  C  N N 176 
ILE CG2  C  N N 177 
ILE CD1  C  N N 178 
ILE OXT  O  N N 179 
ILE H    H  N N 180 
ILE H2   H  N N 181 
ILE HA   H  N N 182 
ILE HB   H  N N 183 
ILE HG12 H  N N 184 
ILE HG13 H  N N 185 
ILE HG21 H  N N 186 
ILE HG22 H  N N 187 
ILE HG23 H  N N 188 
ILE HD11 H  N N 189 
ILE HD12 H  N N 190 
ILE HD13 H  N N 191 
ILE HXT  H  N N 192 
LEU N    N  N N 193 
LEU CA   C  N S 194 
LEU C    C  N N 195 
LEU O    O  N N 196 
LEU CB   C  N N 197 
LEU CG   C  N N 198 
LEU CD1  C  N N 199 
LEU CD2  C  N N 200 
LEU OXT  O  N N 201 
LEU H    H  N N 202 
LEU H2   H  N N 203 
LEU HA   H  N N 204 
LEU HB2  H  N N 205 
LEU HB3  H  N N 206 
LEU HG   H  N N 207 
LEU HD11 H  N N 208 
LEU HD12 H  N N 209 
LEU HD13 H  N N 210 
LEU HD21 H  N N 211 
LEU HD22 H  N N 212 
LEU HD23 H  N N 213 
LEU HXT  H  N N 214 
LYS N    N  N N 215 
LYS CA   C  N S 216 
LYS C    C  N N 217 
LYS O    O  N N 218 
LYS CB   C  N N 219 
LYS CG   C  N N 220 
LYS CD   C  N N 221 
LYS CE   C  N N 222 
LYS NZ   N  N N 223 
LYS OXT  O  N N 224 
LYS H    H  N N 225 
LYS H2   H  N N 226 
LYS HA   H  N N 227 
LYS HB2  H  N N 228 
LYS HB3  H  N N 229 
LYS HG2  H  N N 230 
LYS HG3  H  N N 231 
LYS HD2  H  N N 232 
LYS HD3  H  N N 233 
LYS HE2  H  N N 234 
LYS HE3  H  N N 235 
LYS HZ1  H  N N 236 
LYS HZ2  H  N N 237 
LYS HZ3  H  N N 238 
LYS HXT  H  N N 239 
MSE N    N  N N 240 
MSE CA   C  N S 241 
MSE C    C  N N 242 
MSE O    O  N N 243 
MSE OXT  O  N N 244 
MSE CB   C  N N 245 
MSE CG   C  N N 246 
MSE SE   SE N N 247 
MSE CE   C  N N 248 
MSE H    H  N N 249 
MSE H2   H  N N 250 
MSE HA   H  N N 251 
MSE HXT  H  N N 252 
MSE HB2  H  N N 253 
MSE HB3  H  N N 254 
MSE HG2  H  N N 255 
MSE HG3  H  N N 256 
MSE HE1  H  N N 257 
MSE HE2  H  N N 258 
MSE HE3  H  N N 259 
PHE N    N  N N 260 
PHE CA   C  N S 261 
PHE C    C  N N 262 
PHE O    O  N N 263 
PHE CB   C  N N 264 
PHE CG   C  Y N 265 
PHE CD1  C  Y N 266 
PHE CD2  C  Y N 267 
PHE CE1  C  Y N 268 
PHE CE2  C  Y N 269 
PHE CZ   C  Y N 270 
PHE OXT  O  N N 271 
PHE H    H  N N 272 
PHE H2   H  N N 273 
PHE HA   H  N N 274 
PHE HB2  H  N N 275 
PHE HB3  H  N N 276 
PHE HD1  H  N N 277 
PHE HD2  H  N N 278 
PHE HE1  H  N N 279 
PHE HE2  H  N N 280 
PHE HZ   H  N N 281 
PHE HXT  H  N N 282 
PRO N    N  N N 283 
PRO CA   C  N S 284 
PRO C    C  N N 285 
PRO O    O  N N 286 
PRO CB   C  N N 287 
PRO CG   C  N N 288 
PRO CD   C  N N 289 
PRO OXT  O  N N 290 
PRO H    H  N N 291 
PRO HA   H  N N 292 
PRO HB2  H  N N 293 
PRO HB3  H  N N 294 
PRO HG2  H  N N 295 
PRO HG3  H  N N 296 
PRO HD2  H  N N 297 
PRO HD3  H  N N 298 
PRO HXT  H  N N 299 
SER N    N  N N 300 
SER CA   C  N S 301 
SER C    C  N N 302 
SER O    O  N N 303 
SER CB   C  N N 304 
SER OG   O  N N 305 
SER OXT  O  N N 306 
SER H    H  N N 307 
SER H2   H  N N 308 
SER HA   H  N N 309 
SER HB2  H  N N 310 
SER HB3  H  N N 311 
SER HG   H  N N 312 
SER HXT  H  N N 313 
THR N    N  N N 314 
THR CA   C  N S 315 
THR C    C  N N 316 
THR O    O  N N 317 
THR CB   C  N R 318 
THR OG1  O  N N 319 
THR CG2  C  N N 320 
THR OXT  O  N N 321 
THR H    H  N N 322 
THR H2   H  N N 323 
THR HA   H  N N 324 
THR HB   H  N N 325 
THR HG1  H  N N 326 
THR HG21 H  N N 327 
THR HG22 H  N N 328 
THR HG23 H  N N 329 
THR HXT  H  N N 330 
TRP N    N  N N 331 
TRP CA   C  N S 332 
TRP C    C  N N 333 
TRP O    O  N N 334 
TRP CB   C  N N 335 
TRP CG   C  Y N 336 
TRP CD1  C  Y N 337 
TRP CD2  C  Y N 338 
TRP NE1  N  Y N 339 
TRP CE2  C  Y N 340 
TRP CE3  C  Y N 341 
TRP CZ2  C  Y N 342 
TRP CZ3  C  Y N 343 
TRP CH2  C  Y N 344 
TRP OXT  O  N N 345 
TRP H    H  N N 346 
TRP H2   H  N N 347 
TRP HA   H  N N 348 
TRP HB2  H  N N 349 
TRP HB3  H  N N 350 
TRP HD1  H  N N 351 
TRP HE1  H  N N 352 
TRP HE3  H  N N 353 
TRP HZ2  H  N N 354 
TRP HZ3  H  N N 355 
TRP HH2  H  N N 356 
TRP HXT  H  N N 357 
TYR N    N  N N 358 
TYR CA   C  N S 359 
TYR C    C  N N 360 
TYR O    O  N N 361 
TYR CB   C  N N 362 
TYR CG   C  Y N 363 
TYR CD1  C  Y N 364 
TYR CD2  C  Y N 365 
TYR CE1  C  Y N 366 
TYR CE2  C  Y N 367 
TYR CZ   C  Y N 368 
TYR OH   O  N N 369 
TYR OXT  O  N N 370 
TYR H    H  N N 371 
TYR H2   H  N N 372 
TYR HA   H  N N 373 
TYR HB2  H  N N 374 
TYR HB3  H  N N 375 
TYR HD1  H  N N 376 
TYR HD2  H  N N 377 
TYR HE1  H  N N 378 
TYR HE2  H  N N 379 
TYR HH   H  N N 380 
TYR HXT  H  N N 381 
VAL N    N  N N 382 
VAL CA   C  N S 383 
VAL C    C  N N 384 
VAL O    O  N N 385 
VAL CB   C  N N 386 
VAL CG1  C  N N 387 
VAL CG2  C  N N 388 
VAL OXT  O  N N 389 
VAL H    H  N N 390 
VAL H2   H  N N 391 
VAL HA   H  N N 392 
VAL HB   H  N N 393 
VAL HG11 H  N N 394 
VAL HG12 H  N N 395 
VAL HG13 H  N N 396 
VAL HG21 H  N N 397 
VAL HG22 H  N N 398 
VAL HG23 H  N N 399 
VAL HXT  H  N N 400 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
EDO C1  O1   sing N N 83  
EDO C1  C2   sing N N 84  
EDO C1  H11  sing N N 85  
EDO C1  H12  sing N N 86  
EDO O1  HO1  sing N N 87  
EDO C2  O2   sing N N 88  
EDO C2  H21  sing N N 89  
EDO C2  H22  sing N N 90  
EDO O2  HO2  sing N N 91  
GLN N   CA   sing N N 92  
GLN N   H    sing N N 93  
GLN N   H2   sing N N 94  
GLN CA  C    sing N N 95  
GLN CA  CB   sing N N 96  
GLN CA  HA   sing N N 97  
GLN C   O    doub N N 98  
GLN C   OXT  sing N N 99  
GLN CB  CG   sing N N 100 
GLN CB  HB2  sing N N 101 
GLN CB  HB3  sing N N 102 
GLN CG  CD   sing N N 103 
GLN CG  HG2  sing N N 104 
GLN CG  HG3  sing N N 105 
GLN CD  OE1  doub N N 106 
GLN CD  NE2  sing N N 107 
GLN NE2 HE21 sing N N 108 
GLN NE2 HE22 sing N N 109 
GLN OXT HXT  sing N N 110 
GLU N   CA   sing N N 111 
GLU N   H    sing N N 112 
GLU N   H2   sing N N 113 
GLU CA  C    sing N N 114 
GLU CA  CB   sing N N 115 
GLU CA  HA   sing N N 116 
GLU C   O    doub N N 117 
GLU C   OXT  sing N N 118 
GLU CB  CG   sing N N 119 
GLU CB  HB2  sing N N 120 
GLU CB  HB3  sing N N 121 
GLU CG  CD   sing N N 122 
GLU CG  HG2  sing N N 123 
GLU CG  HG3  sing N N 124 
GLU CD  OE1  doub N N 125 
GLU CD  OE2  sing N N 126 
GLU OE2 HE2  sing N N 127 
GLU OXT HXT  sing N N 128 
GLY N   CA   sing N N 129 
GLY N   H    sing N N 130 
GLY N   H2   sing N N 131 
GLY CA  C    sing N N 132 
GLY CA  HA2  sing N N 133 
GLY CA  HA3  sing N N 134 
GLY C   O    doub N N 135 
GLY C   OXT  sing N N 136 
GLY OXT HXT  sing N N 137 
HIS N   CA   sing N N 138 
HIS N   H    sing N N 139 
HIS N   H2   sing N N 140 
HIS CA  C    sing N N 141 
HIS CA  CB   sing N N 142 
HIS CA  HA   sing N N 143 
HIS C   O    doub N N 144 
HIS C   OXT  sing N N 145 
HIS CB  CG   sing N N 146 
HIS CB  HB2  sing N N 147 
HIS CB  HB3  sing N N 148 
HIS CG  ND1  sing Y N 149 
HIS CG  CD2  doub Y N 150 
HIS ND1 CE1  doub Y N 151 
HIS ND1 HD1  sing N N 152 
HIS CD2 NE2  sing Y N 153 
HIS CD2 HD2  sing N N 154 
HIS CE1 NE2  sing Y N 155 
HIS CE1 HE1  sing N N 156 
HIS NE2 HE2  sing N N 157 
HIS OXT HXT  sing N N 158 
HOH O   H1   sing N N 159 
HOH O   H2   sing N N 160 
ILE N   CA   sing N N 161 
ILE N   H    sing N N 162 
ILE N   H2   sing N N 163 
ILE CA  C    sing N N 164 
ILE CA  CB   sing N N 165 
ILE CA  HA   sing N N 166 
ILE C   O    doub N N 167 
ILE C   OXT  sing N N 168 
ILE CB  CG1  sing N N 169 
ILE CB  CG2  sing N N 170 
ILE CB  HB   sing N N 171 
ILE CG1 CD1  sing N N 172 
ILE CG1 HG12 sing N N 173 
ILE CG1 HG13 sing N N 174 
ILE CG2 HG21 sing N N 175 
ILE CG2 HG22 sing N N 176 
ILE CG2 HG23 sing N N 177 
ILE CD1 HD11 sing N N 178 
ILE CD1 HD12 sing N N 179 
ILE CD1 HD13 sing N N 180 
ILE OXT HXT  sing N N 181 
LEU N   CA   sing N N 182 
LEU N   H    sing N N 183 
LEU N   H2   sing N N 184 
LEU CA  C    sing N N 185 
LEU CA  CB   sing N N 186 
LEU CA  HA   sing N N 187 
LEU C   O    doub N N 188 
LEU C   OXT  sing N N 189 
LEU CB  CG   sing N N 190 
LEU CB  HB2  sing N N 191 
LEU CB  HB3  sing N N 192 
LEU CG  CD1  sing N N 193 
LEU CG  CD2  sing N N 194 
LEU CG  HG   sing N N 195 
LEU CD1 HD11 sing N N 196 
LEU CD1 HD12 sing N N 197 
LEU CD1 HD13 sing N N 198 
LEU CD2 HD21 sing N N 199 
LEU CD2 HD22 sing N N 200 
LEU CD2 HD23 sing N N 201 
LEU OXT HXT  sing N N 202 
LYS N   CA   sing N N 203 
LYS N   H    sing N N 204 
LYS N   H2   sing N N 205 
LYS CA  C    sing N N 206 
LYS CA  CB   sing N N 207 
LYS CA  HA   sing N N 208 
LYS C   O    doub N N 209 
LYS C   OXT  sing N N 210 
LYS CB  CG   sing N N 211 
LYS CB  HB2  sing N N 212 
LYS CB  HB3  sing N N 213 
LYS CG  CD   sing N N 214 
LYS CG  HG2  sing N N 215 
LYS CG  HG3  sing N N 216 
LYS CD  CE   sing N N 217 
LYS CD  HD2  sing N N 218 
LYS CD  HD3  sing N N 219 
LYS CE  NZ   sing N N 220 
LYS CE  HE2  sing N N 221 
LYS CE  HE3  sing N N 222 
LYS NZ  HZ1  sing N N 223 
LYS NZ  HZ2  sing N N 224 
LYS NZ  HZ3  sing N N 225 
LYS OXT HXT  sing N N 226 
MSE N   CA   sing N N 227 
MSE N   H    sing N N 228 
MSE N   H2   sing N N 229 
MSE CA  C    sing N N 230 
MSE CA  CB   sing N N 231 
MSE CA  HA   sing N N 232 
MSE C   O    doub N N 233 
MSE C   OXT  sing N N 234 
MSE OXT HXT  sing N N 235 
MSE CB  CG   sing N N 236 
MSE CB  HB2  sing N N 237 
MSE CB  HB3  sing N N 238 
MSE CG  SE   sing N N 239 
MSE CG  HG2  sing N N 240 
MSE CG  HG3  sing N N 241 
MSE SE  CE   sing N N 242 
MSE CE  HE1  sing N N 243 
MSE CE  HE2  sing N N 244 
MSE CE  HE3  sing N N 245 
PHE N   CA   sing N N 246 
PHE N   H    sing N N 247 
PHE N   H2   sing N N 248 
PHE CA  C    sing N N 249 
PHE CA  CB   sing N N 250 
PHE CA  HA   sing N N 251 
PHE C   O    doub N N 252 
PHE C   OXT  sing N N 253 
PHE CB  CG   sing N N 254 
PHE CB  HB2  sing N N 255 
PHE CB  HB3  sing N N 256 
PHE CG  CD1  doub Y N 257 
PHE CG  CD2  sing Y N 258 
PHE CD1 CE1  sing Y N 259 
PHE CD1 HD1  sing N N 260 
PHE CD2 CE2  doub Y N 261 
PHE CD2 HD2  sing N N 262 
PHE CE1 CZ   doub Y N 263 
PHE CE1 HE1  sing N N 264 
PHE CE2 CZ   sing Y N 265 
PHE CE2 HE2  sing N N 266 
PHE CZ  HZ   sing N N 267 
PHE OXT HXT  sing N N 268 
PRO N   CA   sing N N 269 
PRO N   CD   sing N N 270 
PRO N   H    sing N N 271 
PRO CA  C    sing N N 272 
PRO CA  CB   sing N N 273 
PRO CA  HA   sing N N 274 
PRO C   O    doub N N 275 
PRO C   OXT  sing N N 276 
PRO CB  CG   sing N N 277 
PRO CB  HB2  sing N N 278 
PRO CB  HB3  sing N N 279 
PRO CG  CD   sing N N 280 
PRO CG  HG2  sing N N 281 
PRO CG  HG3  sing N N 282 
PRO CD  HD2  sing N N 283 
PRO CD  HD3  sing N N 284 
PRO OXT HXT  sing N N 285 
SER N   CA   sing N N 286 
SER N   H    sing N N 287 
SER N   H2   sing N N 288 
SER CA  C    sing N N 289 
SER CA  CB   sing N N 290 
SER CA  HA   sing N N 291 
SER C   O    doub N N 292 
SER C   OXT  sing N N 293 
SER CB  OG   sing N N 294 
SER CB  HB2  sing N N 295 
SER CB  HB3  sing N N 296 
SER OG  HG   sing N N 297 
SER OXT HXT  sing N N 298 
THR N   CA   sing N N 299 
THR N   H    sing N N 300 
THR N   H2   sing N N 301 
THR CA  C    sing N N 302 
THR CA  CB   sing N N 303 
THR CA  HA   sing N N 304 
THR C   O    doub N N 305 
THR C   OXT  sing N N 306 
THR CB  OG1  sing N N 307 
THR CB  CG2  sing N N 308 
THR CB  HB   sing N N 309 
THR OG1 HG1  sing N N 310 
THR CG2 HG21 sing N N 311 
THR CG2 HG22 sing N N 312 
THR CG2 HG23 sing N N 313 
THR OXT HXT  sing N N 314 
TRP N   CA   sing N N 315 
TRP N   H    sing N N 316 
TRP N   H2   sing N N 317 
TRP CA  C    sing N N 318 
TRP CA  CB   sing N N 319 
TRP CA  HA   sing N N 320 
TRP C   O    doub N N 321 
TRP C   OXT  sing N N 322 
TRP CB  CG   sing N N 323 
TRP CB  HB2  sing N N 324 
TRP CB  HB3  sing N N 325 
TRP CG  CD1  doub Y N 326 
TRP CG  CD2  sing Y N 327 
TRP CD1 NE1  sing Y N 328 
TRP CD1 HD1  sing N N 329 
TRP CD2 CE2  doub Y N 330 
TRP CD2 CE3  sing Y N 331 
TRP NE1 CE2  sing Y N 332 
TRP NE1 HE1  sing N N 333 
TRP CE2 CZ2  sing Y N 334 
TRP CE3 CZ3  doub Y N 335 
TRP CE3 HE3  sing N N 336 
TRP CZ2 CH2  doub Y N 337 
TRP CZ2 HZ2  sing N N 338 
TRP CZ3 CH2  sing Y N 339 
TRP CZ3 HZ3  sing N N 340 
TRP CH2 HH2  sing N N 341 
TRP OXT HXT  sing N N 342 
TYR N   CA   sing N N 343 
TYR N   H    sing N N 344 
TYR N   H2   sing N N 345 
TYR CA  C    sing N N 346 
TYR CA  CB   sing N N 347 
TYR CA  HA   sing N N 348 
TYR C   O    doub N N 349 
TYR C   OXT  sing N N 350 
TYR CB  CG   sing N N 351 
TYR CB  HB2  sing N N 352 
TYR CB  HB3  sing N N 353 
TYR CG  CD1  doub Y N 354 
TYR CG  CD2  sing Y N 355 
TYR CD1 CE1  sing Y N 356 
TYR CD1 HD1  sing N N 357 
TYR CD2 CE2  doub Y N 358 
TYR CD2 HD2  sing N N 359 
TYR CE1 CZ   doub Y N 360 
TYR CE1 HE1  sing N N 361 
TYR CE2 CZ   sing Y N 362 
TYR CE2 HE2  sing N N 363 
TYR CZ  OH   sing N N 364 
TYR OH  HH   sing N N 365 
TYR OXT HXT  sing N N 366 
VAL N   CA   sing N N 367 
VAL N   H    sing N N 368 
VAL N   H2   sing N N 369 
VAL CA  C    sing N N 370 
VAL CA  CB   sing N N 371 
VAL CA  HA   sing N N 372 
VAL C   O    doub N N 373 
VAL C   OXT  sing N N 374 
VAL CB  CG1  sing N N 375 
VAL CB  CG2  sing N N 376 
VAL CB  HB   sing N N 377 
VAL CG1 HG11 sing N N 378 
VAL CG1 HG12 sing N N 379 
VAL CG1 HG13 sing N N 380 
VAL CG2 HG21 sing N N 381 
VAL CG2 HG22 sing N N 382 
VAL CG2 HG23 sing N N 383 
VAL OXT HXT  sing N N 384 
# 
_atom_sites.entry_id                    3JW6 
_atom_sites.fract_transf_matrix[1][1]   0.009692 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009692 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009692 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
SE 
# 
loop_