data_3JW6 # _entry.id 3JW6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3JW6 pdb_00003jw6 10.2210/pdb3jw6/pdb RCSB RCSB055235 ? ? WWPDB D_1000055235 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-12-08 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-11-01 4 'Structure model' 1 3 2018-07-25 5 'Structure model' 1 4 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' 7 4 'Structure model' 'Source and taxonomy' 8 4 'Structure model' 'Structure summary' 9 5 'Structure model' 'Data collection' 10 5 'Structure model' 'Database references' 11 5 'Structure model' 'Derived calculations' 12 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' entity 3 4 'Structure model' entity_src_gen 4 4 'Structure model' entity_src_nat 5 4 'Structure model' pdbx_struct_mod_residue 6 4 'Structure model' software 7 4 'Structure model' struct_ref_seq_dif 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' database_2 11 5 'Structure model' pdbx_entry_details 12 5 'Structure model' pdbx_modification_feature 13 5 'Structure model' struct_conn 14 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_entity.src_method' 2 4 'Structure model' '_pdbx_struct_mod_residue.details' 3 4 'Structure model' '_struct_ref_seq_dif.details' 4 5 'Structure model' '_database_2.pdbx_DOI' 5 5 'Structure model' '_database_2.pdbx_database_accession' 6 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 7 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 8 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 9 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.entry_id 3JW6 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2009-09-17 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3JVB _pdbx_database_related.details 'Polyhedrin protein of Wiseana spp. nucleopolyhedrosis virus' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Coulibaly, F.' 1 'Chiu, E.' 2 'Metcalf, P.' 3 # _citation.id primary _citation.title 'The atomic structure of baculovirus polyhedra reveals the independent emergence of infectious crystals in DNA and RNA viruses' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 106 _citation.page_first 22205 _citation.page_last 22210 _citation.year 2009 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20007786 _citation.pdbx_database_id_DOI 10.1073/pnas.0910686106 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Coulibaly, F.' 1 ? primary 'Chiu, E.' 2 ? primary 'Gutmann, S.' 3 ? primary 'Rajendran, C.' 4 ? primary 'Haebel, P.W.' 5 ? primary 'Ikeda, K.' 6 ? primary 'Mori, H.' 7 ? primary 'Ward, V.K.' 8 ? primary 'Schulze-Briese, C.' 9 ? primary 'Metcalf, P.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Polyhedrin 29018.131 1 ? G25D ? ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 3 water nat water 18.015 74 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Major occlusion protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)PDYSYRPTIGRTYVYDNKYYKNLDAVIKNAKRKKHFAEHEIEEATLDPLDNYLVAEDPFLGPGKNQKLTLFKEIR NVKPDT(MSE)KLVVGWKGKEFYRETWTRF(MSE)EDSFPIVNDQEV(MSE)DVFLVVN(MSE)RPTRPNRCYKFLAQHA LRCDPDYVPHDVIRIVEPSWVGSNNEYRISLAKKGGGCPI(MSE)NLHSEYTNSFEQFIDRVIWENFYKPIVYIGTDSAE EEEILLEVSLVFKVKEFAPDAPLFTGPAY ; _entity_poly.pdbx_seq_one_letter_code_can ;MPDYSYRPTIGRTYVYDNKYYKNLDAVIKNAKRKKHFAEHEIEEATLDPLDNYLVAEDPFLGPGKNQKLTLFKEIRNVKP DTMKLVVGWKGKEFYRETWTRFMEDSFPIVNDQEVMDVFLVVNMRPTRPNRCYKFLAQHALRCDPDYVPHDVIRIVEPSW VGSNNEYRISLAKKGGGCPIMNLHSEYTNSFEQFIDRVIWENFYKPIVYIGTDSAEEEEILLEVSLVFKVKEFAPDAPLF TGPAY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 PRO n 1 3 ASP n 1 4 TYR n 1 5 SER n 1 6 TYR n 1 7 ARG n 1 8 PRO n 1 9 THR n 1 10 ILE n 1 11 GLY n 1 12 ARG n 1 13 THR n 1 14 TYR n 1 15 VAL n 1 16 TYR n 1 17 ASP n 1 18 ASN n 1 19 LYS n 1 20 TYR n 1 21 TYR n 1 22 LYS n 1 23 ASN n 1 24 LEU n 1 25 ASP n 1 26 ALA n 1 27 VAL n 1 28 ILE n 1 29 LYS n 1 30 ASN n 1 31 ALA n 1 32 LYS n 1 33 ARG n 1 34 LYS n 1 35 LYS n 1 36 HIS n 1 37 PHE n 1 38 ALA n 1 39 GLU n 1 40 HIS n 1 41 GLU n 1 42 ILE n 1 43 GLU n 1 44 GLU n 1 45 ALA n 1 46 THR n 1 47 LEU n 1 48 ASP n 1 49 PRO n 1 50 LEU n 1 51 ASP n 1 52 ASN n 1 53 TYR n 1 54 LEU n 1 55 VAL n 1 56 ALA n 1 57 GLU n 1 58 ASP n 1 59 PRO n 1 60 PHE n 1 61 LEU n 1 62 GLY n 1 63 PRO n 1 64 GLY n 1 65 LYS n 1 66 ASN n 1 67 GLN n 1 68 LYS n 1 69 LEU n 1 70 THR n 1 71 LEU n 1 72 PHE n 1 73 LYS n 1 74 GLU n 1 75 ILE n 1 76 ARG n 1 77 ASN n 1 78 VAL n 1 79 LYS n 1 80 PRO n 1 81 ASP n 1 82 THR n 1 83 MSE n 1 84 LYS n 1 85 LEU n 1 86 VAL n 1 87 VAL n 1 88 GLY n 1 89 TRP n 1 90 LYS n 1 91 GLY n 1 92 LYS n 1 93 GLU n 1 94 PHE n 1 95 TYR n 1 96 ARG n 1 97 GLU n 1 98 THR n 1 99 TRP n 1 100 THR n 1 101 ARG n 1 102 PHE n 1 103 MSE n 1 104 GLU n 1 105 ASP n 1 106 SER n 1 107 PHE n 1 108 PRO n 1 109 ILE n 1 110 VAL n 1 111 ASN n 1 112 ASP n 1 113 GLN n 1 114 GLU n 1 115 VAL n 1 116 MSE n 1 117 ASP n 1 118 VAL n 1 119 PHE n 1 120 LEU n 1 121 VAL n 1 122 VAL n 1 123 ASN n 1 124 MSE n 1 125 ARG n 1 126 PRO n 1 127 THR n 1 128 ARG n 1 129 PRO n 1 130 ASN n 1 131 ARG n 1 132 CYS n 1 133 TYR n 1 134 LYS n 1 135 PHE n 1 136 LEU n 1 137 ALA n 1 138 GLN n 1 139 HIS n 1 140 ALA n 1 141 LEU n 1 142 ARG n 1 143 CYS n 1 144 ASP n 1 145 PRO n 1 146 ASP n 1 147 TYR n 1 148 VAL n 1 149 PRO n 1 150 HIS n 1 151 ASP n 1 152 VAL n 1 153 ILE n 1 154 ARG n 1 155 ILE n 1 156 VAL n 1 157 GLU n 1 158 PRO n 1 159 SER n 1 160 TRP n 1 161 VAL n 1 162 GLY n 1 163 SER n 1 164 ASN n 1 165 ASN n 1 166 GLU n 1 167 TYR n 1 168 ARG n 1 169 ILE n 1 170 SER n 1 171 LEU n 1 172 ALA n 1 173 LYS n 1 174 LYS n 1 175 GLY n 1 176 GLY n 1 177 GLY n 1 178 CYS n 1 179 PRO n 1 180 ILE n 1 181 MSE n 1 182 ASN n 1 183 LEU n 1 184 HIS n 1 185 SER n 1 186 GLU n 1 187 TYR n 1 188 THR n 1 189 ASN n 1 190 SER n 1 191 PHE n 1 192 GLU n 1 193 GLN n 1 194 PHE n 1 195 ILE n 1 196 ASP n 1 197 ARG n 1 198 VAL n 1 199 ILE n 1 200 TRP n 1 201 GLU n 1 202 ASN n 1 203 PHE n 1 204 TYR n 1 205 LYS n 1 206 PRO n 1 207 ILE n 1 208 VAL n 1 209 TYR n 1 210 ILE n 1 211 GLY n 1 212 THR n 1 213 ASP n 1 214 SER n 1 215 ALA n 1 216 GLU n 1 217 GLU n 1 218 GLU n 1 219 GLU n 1 220 ILE n 1 221 LEU n 1 222 LEU n 1 223 GLU n 1 224 VAL n 1 225 SER n 1 226 LEU n 1 227 VAL n 1 228 PHE n 1 229 LYS n 1 230 VAL n 1 231 LYS n 1 232 GLU n 1 233 PHE n 1 234 ALA n 1 235 PRO n 1 236 ASP n 1 237 ALA n 1 238 PRO n 1 239 LEU n 1 240 PHE n 1 241 THR n 1 242 GLY n 1 243 PRO n 1 244 ALA n 1 245 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 245 _entity_src_gen.gene_src_common_name AcMNPV _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PH, P29, POLH' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Autographa californica nuclear polyhedrosis virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 46015 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell Sf21 _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line sf9 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type baculovirus _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Crystals were purified from Sf21 cells infected by the Autographa californica Multicapsid Nucleopolyhedrovirus (AcMNPV)' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 TYR 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 TYR 6 6 ? ? ? A . n A 1 7 ARG 7 7 ? ? ? A . n A 1 8 PRO 8 8 ? ? ? A . n A 1 9 THR 9 9 ? ? ? A . n A 1 10 ILE 10 10 ? ? ? A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 LYS 29 29 ? ? ? A . n A 1 30 ASN 30 30 ? ? ? A . n A 1 31 ALA 31 31 ? ? ? A . n A 1 32 LYS 32 32 ? ? ? A . n A 1 33 ARG 33 33 ? ? ? A . n A 1 34 LYS 34 34 ? ? ? A . n A 1 35 LYS 35 35 ? ? ? A . n A 1 36 HIS 36 36 ? ? ? A . n A 1 37 PHE 37 37 ? ? ? A . n A 1 38 ALA 38 38 ? ? ? A . n A 1 39 GLU 39 39 ? ? ? A . n A 1 40 HIS 40 40 ? ? ? A . n A 1 41 GLU 41 41 ? ? ? A . n A 1 42 ILE 42 42 ? ? ? A . n A 1 43 GLU 43 43 ? ? ? A . n A 1 44 GLU 44 44 ? ? ? A . n A 1 45 ALA 45 45 ? ? ? A . n A 1 46 THR 46 46 ? ? ? A . n A 1 47 LEU 47 47 ? ? ? A . n A 1 48 ASP 48 48 ? ? ? A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 MSE 83 83 83 MSE MSE A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 TRP 89 89 89 TRP TRP A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 TRP 99 99 99 TRP TRP A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 MSE 103 103 103 MSE MSE A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 MSE 116 116 116 MSE MSE A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 MSE 124 124 124 MSE MSE A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 ASN 130 130 130 ASN ASN A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 CYS 132 132 132 CYS CYS A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 HIS 139 139 139 HIS HIS A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 ARG 142 142 ? ? ? A . n A 1 143 CYS 143 143 ? ? ? A . n A 1 144 ASP 144 144 ? ? ? A . n A 1 145 PRO 145 145 ? ? ? A . n A 1 146 ASP 146 146 ? ? ? A . n A 1 147 TYR 147 147 147 TYR TYR A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 HIS 150 150 150 HIS HIS A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 PRO 158 158 158 PRO PRO A . n A 1 159 SER 159 159 159 SER SER A . n A 1 160 TRP 160 160 160 TRP TRP A . n A 1 161 VAL 161 161 161 VAL VAL A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 ASN 164 164 164 ASN ASN A . n A 1 165 ASN 165 165 165 ASN ASN A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 TYR 167 167 167 TYR TYR A . n A 1 168 ARG 168 168 168 ARG ARG A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 LYS 173 173 ? ? ? A . n A 1 174 LYS 174 174 ? ? ? A . n A 1 175 GLY 175 175 ? ? ? A . n A 1 176 GLY 176 176 ? ? ? A . n A 1 177 GLY 177 177 ? ? ? A . n A 1 178 CYS 178 178 ? ? ? A . n A 1 179 PRO 179 179 ? ? ? A . n A 1 180 ILE 180 180 ? ? ? A . n A 1 181 MSE 181 181 ? ? ? A . n A 1 182 ASN 182 182 ? ? ? A . n A 1 183 LEU 183 183 ? ? ? A . n A 1 184 HIS 184 184 ? ? ? A . n A 1 185 SER 185 185 ? ? ? A . n A 1 186 GLU 186 186 ? ? ? A . n A 1 187 TYR 187 187 ? ? ? A . n A 1 188 THR 188 188 188 THR THR A . n A 1 189 ASN 189 189 189 ASN ASN A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 PHE 191 191 191 PHE PHE A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 GLN 193 193 193 GLN GLN A . n A 1 194 PHE 194 194 194 PHE PHE A . n A 1 195 ILE 195 195 195 ILE ILE A . n A 1 196 ASP 196 196 196 ASP ASP A . n A 1 197 ARG 197 197 197 ARG ARG A . n A 1 198 VAL 198 198 198 VAL VAL A . n A 1 199 ILE 199 199 ? ? ? A . n A 1 200 TRP 200 200 ? ? ? A . n A 1 201 GLU 201 201 ? ? ? A . n A 1 202 ASN 202 202 ? ? ? A . n A 1 203 PHE 203 203 203 PHE PHE A . n A 1 204 TYR 204 204 204 TYR TYR A . n A 1 205 LYS 205 205 205 LYS LYS A . n A 1 206 PRO 206 206 206 PRO PRO A . n A 1 207 ILE 207 207 207 ILE ILE A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 TYR 209 209 209 TYR TYR A . n A 1 210 ILE 210 210 210 ILE ILE A . n A 1 211 GLY 211 211 211 GLY GLY A . n A 1 212 THR 212 212 212 THR THR A . n A 1 213 ASP 213 213 213 ASP ASP A . n A 1 214 SER 214 214 214 SER SER A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 GLU 216 216 216 GLU GLU A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 GLU 218 218 218 GLU GLU A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 ILE 220 220 220 ILE ILE A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 VAL 224 224 224 VAL VAL A . n A 1 225 SER 225 225 225 SER SER A . n A 1 226 LEU 226 226 226 LEU LEU A . n A 1 227 VAL 227 227 227 VAL VAL A . n A 1 228 PHE 228 228 228 PHE PHE A . n A 1 229 LYS 229 229 229 LYS LYS A . n A 1 230 VAL 230 230 230 VAL VAL A . n A 1 231 LYS 231 231 231 LYS LYS A . n A 1 232 GLU 232 232 232 GLU GLU A . n A 1 233 PHE 233 233 233 PHE PHE A . n A 1 234 ALA 234 234 234 ALA ALA A . n A 1 235 PRO 235 235 235 PRO PRO A . n A 1 236 ASP 236 236 236 ASP ASP A . n A 1 237 ALA 237 237 237 ALA ALA A . n A 1 238 PRO 238 238 238 PRO PRO A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 PHE 240 240 240 PHE PHE A . n A 1 241 THR 241 241 241 THR THR A . n A 1 242 GLY 242 242 242 GLY GLY A . n A 1 243 PRO 243 243 243 PRO PRO A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 TYR 245 245 245 TYR TYR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 246 246 EDO EDO A . C 3 HOH 1 247 247 HOH HOH A . C 3 HOH 2 248 248 HOH HOH A . C 3 HOH 3 249 249 HOH HOH A . C 3 HOH 4 250 250 HOH HOH A . C 3 HOH 5 251 251 HOH HOH A . C 3 HOH 6 252 252 HOH HOH A . C 3 HOH 7 253 253 HOH HOH A . C 3 HOH 8 254 254 HOH HOH A . C 3 HOH 9 255 255 HOH HOH A . C 3 HOH 10 256 256 HOH HOH A . C 3 HOH 11 257 257 HOH HOH A . C 3 HOH 12 258 258 HOH HOH A . C 3 HOH 13 259 259 HOH HOH A . C 3 HOH 14 260 260 HOH HOH A . C 3 HOH 15 261 261 HOH HOH A . C 3 HOH 16 262 262 HOH HOH A . C 3 HOH 17 263 263 HOH HOH A . C 3 HOH 18 264 264 HOH HOH A . C 3 HOH 19 265 265 HOH HOH A . C 3 HOH 20 266 266 HOH HOH A . C 3 HOH 21 267 267 HOH HOH A . C 3 HOH 22 268 268 HOH HOH A . C 3 HOH 23 269 269 HOH HOH A . C 3 HOH 24 270 270 HOH HOH A . C 3 HOH 25 271 271 HOH HOH A . C 3 HOH 26 272 272 HOH HOH A . C 3 HOH 27 273 273 HOH HOH A . C 3 HOH 28 274 274 HOH HOH A . C 3 HOH 29 275 275 HOH HOH A . C 3 HOH 30 276 276 HOH HOH A . C 3 HOH 31 277 277 HOH HOH A . C 3 HOH 32 278 278 HOH HOH A . C 3 HOH 33 279 279 HOH HOH A . C 3 HOH 34 280 280 HOH HOH A . C 3 HOH 35 281 281 HOH HOH A . C 3 HOH 36 282 282 HOH HOH A . C 3 HOH 37 283 283 HOH HOH A . C 3 HOH 38 284 284 HOH HOH A . C 3 HOH 39 285 285 HOH HOH A . C 3 HOH 40 286 286 HOH HOH A . C 3 HOH 41 287 287 HOH HOH A . C 3 HOH 42 288 288 HOH HOH A . C 3 HOH 43 289 289 HOH HOH A . C 3 HOH 44 290 290 HOH HOH A . C 3 HOH 45 291 291 HOH HOH A . C 3 HOH 46 292 292 HOH HOH A . C 3 HOH 47 293 293 HOH HOH A . C 3 HOH 48 294 294 HOH HOH A . C 3 HOH 49 295 295 HOH HOH A . C 3 HOH 50 296 296 HOH HOH A . C 3 HOH 51 297 297 HOH HOH A . C 3 HOH 52 298 298 HOH HOH A . C 3 HOH 53 299 299 HOH HOH A . C 3 HOH 54 300 300 HOH HOH A . C 3 HOH 55 301 301 HOH HOH A . C 3 HOH 56 302 302 HOH HOH A . C 3 HOH 57 303 303 HOH HOH A . C 3 HOH 58 304 304 HOH HOH A . C 3 HOH 59 305 305 HOH HOH A . C 3 HOH 60 306 306 HOH HOH A . C 3 HOH 61 307 307 HOH HOH A . C 3 HOH 62 308 308 HOH HOH A . C 3 HOH 63 309 309 HOH HOH A . C 3 HOH 64 310 310 HOH HOH A . C 3 HOH 65 311 311 HOH HOH A . C 3 HOH 66 312 312 HOH HOH A . C 3 HOH 67 313 313 HOH HOH A . C 3 HOH 68 314 314 HOH HOH A . C 3 HOH 69 315 315 HOH HOH A . C 3 HOH 70 316 316 HOH HOH A . C 3 HOH 71 317 317 HOH HOH A . C 3 HOH 72 318 318 HOH HOH A . C 3 HOH 73 319 319 HOH HOH A . C 3 HOH 74 320 320 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 19 ? CG ? A LYS 19 CG 2 1 Y 1 A LYS 19 ? CD ? A LYS 19 CD 3 1 Y 1 A LYS 19 ? CE ? A LYS 19 CE 4 1 Y 1 A LYS 19 ? NZ ? A LYS 19 NZ 5 1 Y 1 A ASP 51 ? CG ? A ASP 51 CG 6 1 Y 1 A ASP 51 ? OD1 ? A ASP 51 OD1 7 1 Y 1 A ASP 51 ? OD2 ? A ASP 51 OD2 8 1 Y 1 A TYR 147 ? CG ? A TYR 147 CG 9 1 Y 1 A TYR 147 ? CD1 ? A TYR 147 CD1 10 1 Y 1 A TYR 147 ? CD2 ? A TYR 147 CD2 11 1 Y 1 A TYR 147 ? CE1 ? A TYR 147 CE1 12 1 Y 1 A TYR 147 ? CE2 ? A TYR 147 CE2 13 1 Y 1 A TYR 147 ? CZ ? A TYR 147 CZ 14 1 Y 1 A TYR 147 ? OH ? A TYR 147 OH 15 1 Y 1 A ARG 197 ? CG ? A ARG 197 CG 16 1 Y 1 A ARG 197 ? CD ? A ARG 197 CD 17 1 Y 1 A ARG 197 ? NE ? A ARG 197 NE 18 1 Y 1 A ARG 197 ? CZ ? A ARG 197 CZ 19 1 Y 1 A ARG 197 ? NH1 ? A ARG 197 NH1 20 1 Y 1 A ARG 197 ? NH2 ? A ARG 197 NH2 21 1 Y 1 A VAL 198 ? CG1 ? A VAL 198 CG1 22 1 Y 1 A VAL 198 ? CG2 ? A VAL 198 CG2 # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 3 SHARP . ? package 'Eric de La Fortelle' sharp-develop@globalphasing.com phasing http://www.globalphasing.com/sharp/ ? ? 4 PDB_EXTRACT 3.005 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 5 MAR345 . ? ? ? ? 'data collection' ? ? ? 6 BUSTER-TNT 2.8.0 ? ? ? ? refinement ? ? ? # _cell.entry_id 3JW6 _cell.length_a 103.183 _cell.length_b 103.183 _cell.length_c 103.183 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3JW6 _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? # _exptl.crystals_number 5 _exptl.entry_id 3JW6 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.pdbx_mosaicity 0.477 _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.density_Matthews 1.579947 _exptl_crystal.density_diffrn ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_percent_sol 22.149273 _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.temp 300 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details 'Natural intracellular crystals were directly purified from Sf21 cells infected by the AcMNPV baculovirus, pH 7, temperature 300K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MAR CCD 165 mm' _diffrn_detector.pdbx_collection_date 2007-02-17 _diffrn_detector.details 'MD2 microdiffractometer' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'SAGITALLY HORIZONTAL FOCUSSING SI(111) MERIDIONALLY VERTICAL FOCUSSING RH-COATED MIRROR' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9789 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9789 _diffrn_source.pdbx_synchrotron_site SLS _diffrn_source.pdbx_synchrotron_beamline X06SA # _reflns.entry_id 3JW6 _reflns.d_resolution_high 2.300 _reflns.d_resolution_low 20.000 _reflns.number_obs 8256 _reflns.pdbx_Rmerge_I_obs 0.149 _reflns.pdbx_netI_over_sigmaI 6.200 _reflns.pdbx_chi_squared 0.998 _reflns.pdbx_redundancy 6.600 _reflns.percent_possible_obs 99.700 _reflns.observed_criterion_sigma_F -3.0 _reflns.observed_criterion_sigma_I -3.0 _reflns.number_all 8281 _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate 31.1 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.38 _reflns_shell.number_measured_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_unique_obs ? _reflns_shell.Rmerge_I_obs 0.550 _reflns_shell.meanI_over_sigI_obs 3.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared 0.963 _reflns_shell.pdbx_redundancy 6.30 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 800 _reflns_shell.percent_possible_all 99.10 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3JW6 _refine.ls_d_res_high 2.300 _refine.ls_d_res_low 18.840 _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.7 _refine.ls_number_reflns_obs 8240 _refine.ls_number_reflns_all 8240 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ;Residue ACys132 forms a disulfide bond with residue BCys132 of symmetry molecule 4566. By symmetry, this also implies that residue BCys132 forms a disulfide bond with residue ACys132 of symmetry molecule 4566. ; _refine.ls_R_factor_all 0.166 _refine.ls_R_factor_obs 0.166 _refine.ls_R_factor_R_work 0.161 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.214 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 9.840 _refine.ls_number_reflns_R_free 811 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 24.422 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model Isotropic _refine.aniso_B[1][1] 0.000 _refine.aniso_B[2][2] 0.000 _refine.aniso_B[3][3] 0.000 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.947 _refine.correlation_coeff_Fo_to_Fc_free 0.918 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.solvent_model_details ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MIR _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 87.92 _refine.B_iso_min 7.20 _refine.occupancy_max 1.00 _refine.occupancy_min 0.50 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3JW6 _refine_analyze.Luzzati_coordinate_error_obs 0.199 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1577 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.number_atoms_solvent 74 _refine_hist.number_atoms_total 1655 _refine_hist.d_res_high 2.300 _refine_hist.d_res_low 18.840 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function o_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? o_angle_deg 1.04 ? ? ? 'X-RAY DIFFRACTION' ? o_dihedral_angle_d 18.55 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 2.300 _refine_ls_shell.d_res_low 2.570 _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.number_reflns_R_work 2069 _refine_ls_shell.R_factor_all 0.171 _refine_ls_shell.R_factor_R_work 0.164 _refine_ls_shell.R_factor_R_free 0.235 _refine_ls_shell.percent_reflns_R_free 10.000 _refine_ls_shell.number_reflns_R_free 230 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 2299 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3JW6 _struct.title 'Crystal structure of AcMNPV baculovirus polyhedra' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3JW6 _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'Jelly-roll, disulfide bond, domain swapping, Viral occlusion body, VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PYHD_NPVAC _struct_ref.pdbx_db_accession P04871 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPDYSYRPTIGRTYVYDNKYYKNLGAVIKNAKRKKHFAEHEIEEATLDPLDNYLVAEDPFLGPGKNQKLTLFKEIRNVKP DTMKLVVGWKGKEFYRETWTRFMEDSFPIVNDQEVMDVFLVVNMRPTRPNRCYKFLAQHALRCDPDYVPHDVIRIVEPSW VGSNNEYRISLAKKGGGCPIMNLHSEYTNSFEQFIDRVIWENFYKPIVYIGTDSAEEEEILLEVSLVFKVKEFAPDAPLF TGPAY ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3JW6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 245 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04871 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 245 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 245 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 3JW6 _struct_ref_seq_dif.mon_id ASP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 25 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P04871 _struct_ref_seq_dif.db_mon_id GLY _struct_ref_seq_dif.pdbx_seq_db_seq_num 25 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 25 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dodecameric _pdbx_struct_assembly.oligomeric_count 12 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 56170 ? 1 MORE -266 ? 1 'SSA (A^2)' 107520 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 103.1830000000 0.0000000000 -1.0000000000 0.0000000000 103.1830000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 103.1830000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 103.1830000000 4 'crystal symmetry operation' 4_566 x,-y+1,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 103.1830000000 0.0000000000 0.0000000000 -1.0000000000 103.1830000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_566 z,-x+1,-y+1 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 103.1830000000 0.0000000000 -1.0000000000 0.0000000000 103.1830000000 7 'crystal symmetry operation' 7_665 -z+1,-x+1,y 0.0000000000 0.0000000000 -1.0000000000 103.1830000000 -1.0000000000 0.0000000000 0.0000000000 103.1830000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_656 -z+1,x,-y+1 0.0000000000 0.0000000000 -1.0000000000 103.1830000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 103.1830000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_656 -y+1,z,-x+1 0.0000000000 -1.0000000000 0.0000000000 103.1830000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 103.1830000000 11 'crystal symmetry operation' 11_566 y,-z+1,-x+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 103.1830000000 -1.0000000000 0.0000000000 0.0000000000 103.1830000000 12 'crystal symmetry operation' 12_665 -y+1,-z+1,x 0.0000000000 -1.0000000000 0.0000000000 103.1830000000 0.0000000000 0.0000000000 -1.0000000000 103.1830000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # _struct_biol.id 1 _struct_biol.details ;POLYHEDRA ARE VIRUS-CONTAINING CRYSTALS, WHICH REPRESENT THE MAIN INFECTIOUS FORM OF BACULOVIRUS. THE BIOLOGICAL ASSEMBLY IS THE WHOLE CRYSTAL. DODECAMERS OF THE POLYHEDRIN PROTEIN ARE PUTATIVE BUILDING BLOCKS OF THE CRYSTAL, WHICH ARE GENERATED BY THE SYMMETRY OPERATIONS. ; # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 23 ? ILE A 28 ? ASN A 23 ILE A 28 1 ? 6 HELX_P HELX_P2 2 PRO A 49 ? TYR A 53 ? PRO A 49 TYR A 53 5 ? 5 HELX_P HELX_P3 3 LYS A 90 ? PHE A 107 ? LYS A 90 PHE A 107 1 ? 18 HELX_P HELX_P4 4 SER A 190 ? ARG A 197 ? SER A 190 ARG A 197 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 132 SG B ? ? 1_555 A CYS 132 SG B ? A CYS 132 A CYS 132 4_566 ? ? ? ? ? ? ? 2.416 ? ? covale1 covale both ? A THR 82 C ? ? ? 1_555 A MSE 83 N ? ? A THR 82 A MSE 83 1_555 ? ? ? ? ? ? ? 1.345 ? ? covale2 covale both ? A MSE 83 C ? ? ? 1_555 A LYS 84 N ? ? A MSE 83 A LYS 84 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale3 covale both ? A PHE 102 C ? ? ? 1_555 A MSE 103 N ? ? A PHE 102 A MSE 103 1_555 ? ? ? ? ? ? ? 1.346 ? ? covale4 covale both ? A MSE 103 C ? ? ? 1_555 A GLU 104 N ? ? A MSE 103 A GLU 104 1_555 ? ? ? ? ? ? ? 1.350 ? ? covale5 covale both ? A VAL 115 C ? ? ? 1_555 A MSE 116 N ? ? A VAL 115 A MSE 116 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale6 covale both ? A MSE 116 C ? ? ? 1_555 A ASP 117 N ? ? A MSE 116 A ASP 117 1_555 ? ? ? ? ? ? ? 1.353 ? ? covale7 covale both ? A ASN 123 C ? ? ? 1_555 A MSE 124 N ? ? A ASN 123 A MSE 124 1_555 ? ? ? ? ? ? ? 1.343 ? ? covale8 covale both ? A MSE 124 C ? ? ? 1_555 A ARG 125 N ? ? A MSE 124 A ARG 125 1_555 ? ? ? ? ? ? ? 1.329 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 83 ? . . . . MSE A 83 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 103 ? . . . . MSE A 103 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 116 ? . . . . MSE A 116 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 124 ? . . . . MSE A 124 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 CYS A 132 B CYS A 132 B CYS A 132 ? 1_555 CYS A 132 ? 4_566 SG SG . . . None 'Disulfide bridge' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PHE 107 A . ? PHE 107 A PRO 108 A ? PRO 108 A 1 -0.40 2 PHE 107 A . ? PHE 107 A PRO 108 A ? PRO 108 A 1 0.53 3 GLY 242 A . ? GLY 242 A PRO 243 A ? PRO 243 A 1 -2.34 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 4 ? C ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel C 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 13 ? TYR A 16 ? THR A 13 TYR A 16 A 2 LYS A 19 ? LYS A 22 ? LYS A 19 LYS A 22 B 1 LYS A 65 ? VAL A 78 ? LYS A 65 VAL A 78 B 2 GLU A 218 ? PHE A 233 ? GLU A 218 PHE A 233 B 3 ASP A 112 ? PRO A 126 ? ASP A 112 PRO A 126 B 4 GLU A 166 ? SER A 170 ? GLU A 166 SER A 170 C 1 VAL A 152 ? ARG A 154 ? VAL A 152 ARG A 154 C 2 THR A 82 ? LEU A 85 ? THR A 82 LEU A 85 C 3 ILE A 207 ? THR A 212 ? ILE A 207 THR A 212 C 4 PHE A 135 ? ALA A 140 ? PHE A 135 ALA A 140 C 5 SER A 159 ? TRP A 160 ? SER A 159 TRP A 160 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 14 ? N TYR A 14 O TYR A 21 ? O TYR A 21 B 1 2 N GLU A 74 ? N GLU A 74 O LEU A 222 ? O LEU A 222 B 2 3 O SER A 225 ? O SER A 225 N VAL A 121 ? N VAL A 121 B 3 4 N LEU A 120 ? N LEU A 120 O ILE A 169 ? O ILE A 169 C 1 2 O ILE A 153 ? O ILE A 153 N MSE A 83 ? N MSE A 83 C 2 3 N LYS A 84 ? N LYS A 84 O ILE A 210 ? O ILE A 210 C 3 4 O GLY A 211 ? O GLY A 211 N LEU A 136 ? N LEU A 136 C 4 5 N ALA A 137 ? N ALA A 137 O SER A 159 ? O SER A 159 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id EDO _struct_site.pdbx_auth_seq_id 246 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE EDO A 246' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ARG A 154 ? ARG A 154 . ? 8_656 ? 2 AC1 4 VAL A 156 ? VAL A 156 . ? 8_656 ? 3 AC1 4 GLU A 232 ? GLU A 232 . ? 1_555 ? 4 AC1 4 HOH C . ? HOH A 284 . ? 8_656 ? # _pdbx_entry_details.entry_id 3JW6 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 63 ? ? -48.76 151.12 2 1 PHE A 233 ? ? -112.20 75.82 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 83 A MSE 83 ? MET 'modified residue' 2 A MSE 103 A MSE 103 ? MET 'modified residue' 3 A MSE 116 A MSE 116 ? MET 'modified residue' 4 A MSE 124 A MSE 124 ? MET 'modified residue' # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 308 ? C HOH . 2 1 A HOH 309 ? C HOH . # _phasing.method MIR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A TYR 4 ? A TYR 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A TYR 6 ? A TYR 6 7 1 Y 1 A ARG 7 ? A ARG 7 8 1 Y 1 A PRO 8 ? A PRO 8 9 1 Y 1 A THR 9 ? A THR 9 10 1 Y 1 A ILE 10 ? A ILE 10 11 1 Y 1 A LYS 29 ? A LYS 29 12 1 Y 1 A ASN 30 ? A ASN 30 13 1 Y 1 A ALA 31 ? A ALA 31 14 1 Y 1 A LYS 32 ? A LYS 32 15 1 Y 1 A ARG 33 ? A ARG 33 16 1 Y 1 A LYS 34 ? A LYS 34 17 1 Y 1 A LYS 35 ? A LYS 35 18 1 Y 1 A HIS 36 ? A HIS 36 19 1 Y 1 A PHE 37 ? A PHE 37 20 1 Y 1 A ALA 38 ? A ALA 38 21 1 Y 1 A GLU 39 ? A GLU 39 22 1 Y 1 A HIS 40 ? A HIS 40 23 1 Y 1 A GLU 41 ? A GLU 41 24 1 Y 1 A ILE 42 ? A ILE 42 25 1 Y 1 A GLU 43 ? A GLU 43 26 1 Y 1 A GLU 44 ? A GLU 44 27 1 Y 1 A ALA 45 ? A ALA 45 28 1 Y 1 A THR 46 ? A THR 46 29 1 Y 1 A LEU 47 ? A LEU 47 30 1 Y 1 A ASP 48 ? A ASP 48 31 1 Y 1 A ARG 142 ? A ARG 142 32 1 Y 1 A CYS 143 ? A CYS 143 33 1 Y 1 A ASP 144 ? A ASP 144 34 1 Y 1 A PRO 145 ? A PRO 145 35 1 Y 1 A ASP 146 ? A ASP 146 36 1 Y 1 A LYS 173 ? A LYS 173 37 1 Y 1 A LYS 174 ? A LYS 174 38 1 Y 1 A GLY 175 ? A GLY 175 39 1 Y 1 A GLY 176 ? A GLY 176 40 1 Y 1 A GLY 177 ? A GLY 177 41 1 Y 1 A CYS 178 ? A CYS 178 42 1 Y 1 A PRO 179 ? A PRO 179 43 1 Y 1 A ILE 180 ? A ILE 180 44 1 Y 1 A MSE 181 ? A MSE 181 45 1 Y 1 A ASN 182 ? A ASN 182 46 1 Y 1 A LEU 183 ? A LEU 183 47 1 Y 1 A HIS 184 ? A HIS 184 48 1 Y 1 A SER 185 ? A SER 185 49 1 Y 1 A GLU 186 ? A GLU 186 50 1 Y 1 A TYR 187 ? A TYR 187 51 1 Y 1 A ILE 199 ? A ILE 199 52 1 Y 1 A TRP 200 ? A TRP 200 53 1 Y 1 A GLU 201 ? A GLU 201 54 1 Y 1 A ASN 202 ? A ASN 202 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MSE N N N N 240 MSE CA C N S 241 MSE C C N N 242 MSE O O N N 243 MSE OXT O N N 244 MSE CB C N N 245 MSE CG C N N 246 MSE SE SE N N 247 MSE CE C N N 248 MSE H H N N 249 MSE H2 H N N 250 MSE HA H N N 251 MSE HXT H N N 252 MSE HB2 H N N 253 MSE HB3 H N N 254 MSE HG2 H N N 255 MSE HG3 H N N 256 MSE HE1 H N N 257 MSE HE2 H N N 258 MSE HE3 H N N 259 PHE N N N N 260 PHE CA C N S 261 PHE C C N N 262 PHE O O N N 263 PHE CB C N N 264 PHE CG C Y N 265 PHE CD1 C Y N 266 PHE CD2 C Y N 267 PHE CE1 C Y N 268 PHE CE2 C Y N 269 PHE CZ C Y N 270 PHE OXT O N N 271 PHE H H N N 272 PHE H2 H N N 273 PHE HA H N N 274 PHE HB2 H N N 275 PHE HB3 H N N 276 PHE HD1 H N N 277 PHE HD2 H N N 278 PHE HE1 H N N 279 PHE HE2 H N N 280 PHE HZ H N N 281 PHE HXT H N N 282 PRO N N N N 283 PRO CA C N S 284 PRO C C N N 285 PRO O O N N 286 PRO CB C N N 287 PRO CG C N N 288 PRO CD C N N 289 PRO OXT O N N 290 PRO H H N N 291 PRO HA H N N 292 PRO HB2 H N N 293 PRO HB3 H N N 294 PRO HG2 H N N 295 PRO HG3 H N N 296 PRO HD2 H N N 297 PRO HD3 H N N 298 PRO HXT H N N 299 SER N N N N 300 SER CA C N S 301 SER C C N N 302 SER O O N N 303 SER CB C N N 304 SER OG O N N 305 SER OXT O N N 306 SER H H N N 307 SER H2 H N N 308 SER HA H N N 309 SER HB2 H N N 310 SER HB3 H N N 311 SER HG H N N 312 SER HXT H N N 313 THR N N N N 314 THR CA C N S 315 THR C C N N 316 THR O O N N 317 THR CB C N R 318 THR OG1 O N N 319 THR CG2 C N N 320 THR OXT O N N 321 THR H H N N 322 THR H2 H N N 323 THR HA H N N 324 THR HB H N N 325 THR HG1 H N N 326 THR HG21 H N N 327 THR HG22 H N N 328 THR HG23 H N N 329 THR HXT H N N 330 TRP N N N N 331 TRP CA C N S 332 TRP C C N N 333 TRP O O N N 334 TRP CB C N N 335 TRP CG C Y N 336 TRP CD1 C Y N 337 TRP CD2 C Y N 338 TRP NE1 N Y N 339 TRP CE2 C Y N 340 TRP CE3 C Y N 341 TRP CZ2 C Y N 342 TRP CZ3 C Y N 343 TRP CH2 C Y N 344 TRP OXT O N N 345 TRP H H N N 346 TRP H2 H N N 347 TRP HA H N N 348 TRP HB2 H N N 349 TRP HB3 H N N 350 TRP HD1 H N N 351 TRP HE1 H N N 352 TRP HE3 H N N 353 TRP HZ2 H N N 354 TRP HZ3 H N N 355 TRP HH2 H N N 356 TRP HXT H N N 357 TYR N N N N 358 TYR CA C N S 359 TYR C C N N 360 TYR O O N N 361 TYR CB C N N 362 TYR CG C Y N 363 TYR CD1 C Y N 364 TYR CD2 C Y N 365 TYR CE1 C Y N 366 TYR CE2 C Y N 367 TYR CZ C Y N 368 TYR OH O N N 369 TYR OXT O N N 370 TYR H H N N 371 TYR H2 H N N 372 TYR HA H N N 373 TYR HB2 H N N 374 TYR HB3 H N N 375 TYR HD1 H N N 376 TYR HD2 H N N 377 TYR HE1 H N N 378 TYR HE2 H N N 379 TYR HH H N N 380 TYR HXT H N N 381 VAL N N N N 382 VAL CA C N S 383 VAL C C N N 384 VAL O O N N 385 VAL CB C N N 386 VAL CG1 C N N 387 VAL CG2 C N N 388 VAL OXT O N N 389 VAL H H N N 390 VAL H2 H N N 391 VAL HA H N N 392 VAL HB H N N 393 VAL HG11 H N N 394 VAL HG12 H N N 395 VAL HG13 H N N 396 VAL HG21 H N N 397 VAL HG22 H N N 398 VAL HG23 H N N 399 VAL HXT H N N 400 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MSE N CA sing N N 227 MSE N H sing N N 228 MSE N H2 sing N N 229 MSE CA C sing N N 230 MSE CA CB sing N N 231 MSE CA HA sing N N 232 MSE C O doub N N 233 MSE C OXT sing N N 234 MSE OXT HXT sing N N 235 MSE CB CG sing N N 236 MSE CB HB2 sing N N 237 MSE CB HB3 sing N N 238 MSE CG SE sing N N 239 MSE CG HG2 sing N N 240 MSE CG HG3 sing N N 241 MSE SE CE sing N N 242 MSE CE HE1 sing N N 243 MSE CE HE2 sing N N 244 MSE CE HE3 sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 SER N CA sing N N 286 SER N H sing N N 287 SER N H2 sing N N 288 SER CA C sing N N 289 SER CA CB sing N N 290 SER CA HA sing N N 291 SER C O doub N N 292 SER C OXT sing N N 293 SER CB OG sing N N 294 SER CB HB2 sing N N 295 SER CB HB3 sing N N 296 SER OG HG sing N N 297 SER OXT HXT sing N N 298 THR N CA sing N N 299 THR N H sing N N 300 THR N H2 sing N N 301 THR CA C sing N N 302 THR CA CB sing N N 303 THR CA HA sing N N 304 THR C O doub N N 305 THR C OXT sing N N 306 THR CB OG1 sing N N 307 THR CB CG2 sing N N 308 THR CB HB sing N N 309 THR OG1 HG1 sing N N 310 THR CG2 HG21 sing N N 311 THR CG2 HG22 sing N N 312 THR CG2 HG23 sing N N 313 THR OXT HXT sing N N 314 TRP N CA sing N N 315 TRP N H sing N N 316 TRP N H2 sing N N 317 TRP CA C sing N N 318 TRP CA CB sing N N 319 TRP CA HA sing N N 320 TRP C O doub N N 321 TRP C OXT sing N N 322 TRP CB CG sing N N 323 TRP CB HB2 sing N N 324 TRP CB HB3 sing N N 325 TRP CG CD1 doub Y N 326 TRP CG CD2 sing Y N 327 TRP CD1 NE1 sing Y N 328 TRP CD1 HD1 sing N N 329 TRP CD2 CE2 doub Y N 330 TRP CD2 CE3 sing Y N 331 TRP NE1 CE2 sing Y N 332 TRP NE1 HE1 sing N N 333 TRP CE2 CZ2 sing Y N 334 TRP CE3 CZ3 doub Y N 335 TRP CE3 HE3 sing N N 336 TRP CZ2 CH2 doub Y N 337 TRP CZ2 HZ2 sing N N 338 TRP CZ3 CH2 sing Y N 339 TRP CZ3 HZ3 sing N N 340 TRP CH2 HH2 sing N N 341 TRP OXT HXT sing N N 342 TYR N CA sing N N 343 TYR N H sing N N 344 TYR N H2 sing N N 345 TYR CA C sing N N 346 TYR CA CB sing N N 347 TYR CA HA sing N N 348 TYR C O doub N N 349 TYR C OXT sing N N 350 TYR CB CG sing N N 351 TYR CB HB2 sing N N 352 TYR CB HB3 sing N N 353 TYR CG CD1 doub Y N 354 TYR CG CD2 sing Y N 355 TYR CD1 CE1 sing Y N 356 TYR CD1 HD1 sing N N 357 TYR CD2 CE2 doub Y N 358 TYR CD2 HD2 sing N N 359 TYR CE1 CZ doub Y N 360 TYR CE1 HE1 sing N N 361 TYR CE2 CZ sing Y N 362 TYR CE2 HE2 sing N N 363 TYR CZ OH sing N N 364 TYR OH HH sing N N 365 TYR OXT HXT sing N N 366 VAL N CA sing N N 367 VAL N H sing N N 368 VAL N H2 sing N N 369 VAL CA C sing N N 370 VAL CA CB sing N N 371 VAL CA HA sing N N 372 VAL C O doub N N 373 VAL C OXT sing N N 374 VAL CB CG1 sing N N 375 VAL CB CG2 sing N N 376 VAL CB HB sing N N 377 VAL CG1 HG11 sing N N 378 VAL CG1 HG12 sing N N 379 VAL CG1 HG13 sing N N 380 VAL CG2 HG21 sing N N 381 VAL CG2 HG22 sing N N 382 VAL CG2 HG23 sing N N 383 VAL OXT HXT sing N N 384 # _atom_sites.entry_id 3JW6 _atom_sites.fract_transf_matrix[1][1] 0.009692 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009692 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009692 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_