data_3K1H # _entry.id 3K1H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3K1H RCSB RCSB055426 WWPDB D_1000055426 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3K1I _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3K1H _pdbx_database_status.recvd_initial_deposition_date 2009-09-28 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lam, W.W.L.' 1 'Ling, T.K.W.' 2 'Woo, E.J.' 3 'Au, S.W.N.' 4 # _citation.id primary _citation.title 'Molecular interaction of flagellar export chaperone FliS and cochaperone HP1076 in Helicobacter pylori' _citation.journal_abbrev 'Faseb J.' _citation.journal_volume 24 _citation.page_first 4020 _citation.page_last 4032 _citation.year 2010 _citation.journal_id_ASTM FAJOEC _citation.country US _citation.journal_id_ISSN 0892-6638 _citation.journal_id_CSD 2074 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20581225 _citation.pdbx_database_id_DOI 10.1096/fj.10-155242 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Lam, W.W.L.' 1 primary 'Woo, E.J.' 2 primary 'Kotaka, M.' 3 primary 'Tam, W.K.' 4 primary 'Leung, Y.C.' 5 primary 'Ling, T.K.W.' 6 primary 'Au, S.W.N.' 7 # _cell.entry_id 3K1H _cell.length_a 58.874 _cell.length_b 87.202 _cell.length_c 60.824 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3K1H _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative uncharacterized protein' 17989.537 1 ? ? 'Residues 21-171' ? 2 water nat water 18.015 82 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name HP1076 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HHHHHHMTNAIEKSQQIAKFSRDMKNINESVGALQVLQIACKKLFNKSMGLEDKDALQASIIKQELREIVENCQFLASPL FDTQLNIAINDEIFSMIVVNPLDLLENVGEFQAYLEEKLNEIKELLGYLSESLSNPKAFMPSFSNQSLKDLLSDNLRA ; _entity_poly.pdbx_seq_one_letter_code_can ;HHHHHHMTNAIEKSQQIAKFSRDMKNINESVGALQVLQIACKKLFNKSMGLEDKDALQASIIKQELREIVENCQFLASPL FDTQLNIAINDEIFSMIVVNPLDLLENVGEFQAYLEEKLNEIKELLGYLSESLSNPKAFMPSFSNQSLKDLLSDNLRA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 MET n 1 8 THR n 1 9 ASN n 1 10 ALA n 1 11 ILE n 1 12 GLU n 1 13 LYS n 1 14 SER n 1 15 GLN n 1 16 GLN n 1 17 ILE n 1 18 ALA n 1 19 LYS n 1 20 PHE n 1 21 SER n 1 22 ARG n 1 23 ASP n 1 24 MET n 1 25 LYS n 1 26 ASN n 1 27 ILE n 1 28 ASN n 1 29 GLU n 1 30 SER n 1 31 VAL n 1 32 GLY n 1 33 ALA n 1 34 LEU n 1 35 GLN n 1 36 VAL n 1 37 LEU n 1 38 GLN n 1 39 ILE n 1 40 ALA n 1 41 CYS n 1 42 LYS n 1 43 LYS n 1 44 LEU n 1 45 PHE n 1 46 ASN n 1 47 LYS n 1 48 SER n 1 49 MET n 1 50 GLY n 1 51 LEU n 1 52 GLU n 1 53 ASP n 1 54 LYS n 1 55 ASP n 1 56 ALA n 1 57 LEU n 1 58 GLN n 1 59 ALA n 1 60 SER n 1 61 ILE n 1 62 ILE n 1 63 LYS n 1 64 GLN n 1 65 GLU n 1 66 LEU n 1 67 ARG n 1 68 GLU n 1 69 ILE n 1 70 VAL n 1 71 GLU n 1 72 ASN n 1 73 CYS n 1 74 GLN n 1 75 PHE n 1 76 LEU n 1 77 ALA n 1 78 SER n 1 79 PRO n 1 80 LEU n 1 81 PHE n 1 82 ASP n 1 83 THR n 1 84 GLN n 1 85 LEU n 1 86 ASN n 1 87 ILE n 1 88 ALA n 1 89 ILE n 1 90 ASN n 1 91 ASP n 1 92 GLU n 1 93 ILE n 1 94 PHE n 1 95 SER n 1 96 MET n 1 97 ILE n 1 98 VAL n 1 99 VAL n 1 100 ASN n 1 101 PRO n 1 102 LEU n 1 103 ASP n 1 104 LEU n 1 105 LEU n 1 106 GLU n 1 107 ASN n 1 108 VAL n 1 109 GLY n 1 110 GLU n 1 111 PHE n 1 112 GLN n 1 113 ALA n 1 114 TYR n 1 115 LEU n 1 116 GLU n 1 117 GLU n 1 118 LYS n 1 119 LEU n 1 120 ASN n 1 121 GLU n 1 122 ILE n 1 123 LYS n 1 124 GLU n 1 125 LEU n 1 126 LEU n 1 127 GLY n 1 128 TYR n 1 129 LEU n 1 130 SER n 1 131 GLU n 1 132 SER n 1 133 LEU n 1 134 SER n 1 135 ASN n 1 136 PRO n 1 137 LYS n 1 138 ALA n 1 139 PHE n 1 140 MET n 1 141 PRO n 1 142 SER n 1 143 PHE n 1 144 SER n 1 145 ASN n 1 146 GLN n 1 147 SER n 1 148 LEU n 1 149 LYS n 1 150 ASP n 1 151 LEU n 1 152 LEU n 1 153 SER n 1 154 ASP n 1 155 ASN n 1 156 LEU n 1 157 ARG n 1 158 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene HP_1076 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 26695 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Helicobacter pylori' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 85962 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Rosetta 2' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pAc28m _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O25709_HELPY _struct_ref.pdbx_db_accession O25709 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TNAIEKSQQIAKFSRDMKNINESVGALQVLQIACKKLFNKSMGLEDKDALQASIIKQELREIVENCQFLASPLFDTQLNI AINDEIFSMIVVNPLDLLENVGEFQAYLEEKLNEIKELLGYLSESLSNPKAFMPSFSNQSLKDLLSDNLRA ; _struct_ref.pdbx_align_begin 21 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3K1H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 158 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O25709 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 171 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 21 _struct_ref_seq.pdbx_auth_seq_align_end 171 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3K1H HIS A 1 ? UNP O25709 ? ? 'EXPRESSION TAG' 14 1 1 3K1H HIS A 2 ? UNP O25709 ? ? 'EXPRESSION TAG' 15 2 1 3K1H HIS A 3 ? UNP O25709 ? ? 'EXPRESSION TAG' 16 3 1 3K1H HIS A 4 ? UNP O25709 ? ? 'EXPRESSION TAG' 17 4 1 3K1H HIS A 5 ? UNP O25709 ? ? 'EXPRESSION TAG' 18 5 1 3K1H HIS A 6 ? UNP O25709 ? ? 'EXPRESSION TAG' 19 6 1 3K1H MET A 7 ? UNP O25709 ? ? 'EXPRESSION TAG' 20 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3K1H _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.29 _exptl_crystal.density_percent_sol 46.34 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details '0.1M Bis-Tris, 27% PEG 3350, 0.2M Lithium sulfate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 289K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2008-10-26 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'double crystal monochromator' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97958 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'PAL/PLS BEAMLINE 6C1' _diffrn_source.pdbx_synchrotron_site PAL/PLS _diffrn_source.pdbx_synchrotron_beamline 6C1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97958 # _reflns.entry_id 3K1H _reflns.observed_criterion_sigma_I 2 _reflns.observed_criterion_sigma_F 2 _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 1.74 _reflns.number_obs 16258 _reflns.number_all ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs 0.056 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 45.8 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 7.4 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.74 _reflns_shell.d_res_low 1.8 _reflns_shell.percent_possible_all 90.4 _reflns_shell.Rmerge_I_obs 0.443 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 6.1 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1456 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3K1H _refine.ls_number_reflns_obs 15435 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 26.06 _refine.ls_d_res_high 1.74 _refine.ls_percent_reflns_obs 98.35 _refine.ls_R_factor_obs 0.21118 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.21006 _refine.ls_R_factor_R_free 0.23305 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 819 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.955 _refine.correlation_coeff_Fo_to_Fc_free 0.945 _refine.B_iso_mean 28.381 _refine.aniso_B[1][1] 0.11 _refine.aniso_B[2][2] -0.06 _refine.aniso_B[3][3] -0.05 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.110 _refine.pdbx_overall_ESU_R_Free 0.105 _refine.overall_SU_ML 0.082 _refine.overall_SU_B 5.698 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 906 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 82 _refine_hist.number_atoms_total 988 _refine_hist.d_res_high 1.74 _refine_hist.d_res_low 26.06 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.010 0.022 ? 914 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.169 1.996 ? 1230 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 4.685 5.000 ? 114 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 35.872 27.500 ? 44 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 13.679 15.000 ? 183 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 12.227 15.000 ? 2 'X-RAY DIFFRACTION' ? r_chiral_restr 0.081 0.200 ? 146 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.020 ? 665 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.682 1.500 ? 572 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.342 2.000 ? 920 'X-RAY DIFFRACTION' ? r_scbond_it 2.399 3.000 ? 342 'X-RAY DIFFRACTION' ? r_scangle_it 4.179 4.500 ? 310 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.737 _refine_ls_shell.d_res_low 1.782 _refine_ls_shell.number_reflns_R_work 997 _refine_ls_shell.R_factor_R_work 0.341 _refine_ls_shell.percent_reflns_obs 87.52 _refine_ls_shell.R_factor_R_free 0.414 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 55 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3K1H _struct.title 'Crystal structure of HP1076 from H.pylori' _struct.pdbx_descriptor 'Putative uncharacterized protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3K1H _struct_keywords.pdbx_keywords CHAPERONE _struct_keywords.text 'FliS interacting protein, hypothetical protein, CHAPERONE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 26 ? SER A 48 ? ASN A 39 SER A 61 1 ? 23 HELX_P HELX_P2 2 MET A 49 ? LYS A 54 ? MET A 62 LYS A 67 5 ? 6 HELX_P HELX_P3 3 ASP A 55 ? ASN A 72 ? ASP A 68 ASN A 85 1 ? 18 HELX_P HELX_P4 4 ASN A 100 ? GLU A 106 ? ASN A 113 GLU A 119 5 ? 7 HELX_P HELX_P5 5 ASN A 107 ? SER A 134 ? ASN A 120 SER A 147 1 ? 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 21 ? ASP A 23 ? SER A 34 ASP A 36 A 2 GLN A 84 ? ILE A 89 ? GLN A 97 ILE A 102 A 3 GLU A 92 ? MET A 96 ? GLU A 105 MET A 109 B 1 GLN A 74 ? PHE A 75 ? GLN A 87 PHE A 88 B 2 SER A 78 ? PRO A 79 ? SER A 91 PRO A 92 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 22 ? N ARG A 35 O ASN A 86 ? O ASN A 99 A 2 3 N LEU A 85 ? N LEU A 98 O MET A 96 ? O MET A 109 B 1 2 N PHE A 75 ? N PHE A 88 O SER A 78 ? O SER A 91 # _database_PDB_matrix.entry_id 3K1H _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3K1H _atom_sites.fract_transf_matrix[1][1] 0.016985 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011468 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016441 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 14 ? ? ? A . n A 1 2 HIS 2 15 ? ? ? A . n A 1 3 HIS 3 16 ? ? ? A . n A 1 4 HIS 4 17 ? ? ? A . n A 1 5 HIS 5 18 ? ? ? A . n A 1 6 HIS 6 19 ? ? ? A . n A 1 7 MET 7 20 ? ? ? A . n A 1 8 THR 8 21 ? ? ? A . n A 1 9 ASN 9 22 ? ? ? A . n A 1 10 ALA 10 23 ? ? ? A . n A 1 11 ILE 11 24 ? ? ? A . n A 1 12 GLU 12 25 ? ? ? A . n A 1 13 LYS 13 26 ? ? ? A . n A 1 14 SER 14 27 ? ? ? A . n A 1 15 GLN 15 28 ? ? ? A . n A 1 16 GLN 16 29 ? ? ? A . n A 1 17 ILE 17 30 ? ? ? A . n A 1 18 ALA 18 31 ? ? ? A . n A 1 19 LYS 19 32 ? ? ? A . n A 1 20 PHE 20 33 33 PHE ALA A . n A 1 21 SER 21 34 34 SER SER A . n A 1 22 ARG 22 35 35 ARG ARG A . n A 1 23 ASP 23 36 36 ASP ASP A . n A 1 24 MET 24 37 37 MET MET A . n A 1 25 LYS 25 38 38 LYS LYS A . n A 1 26 ASN 26 39 39 ASN ASN A . n A 1 27 ILE 27 40 40 ILE ILE A . n A 1 28 ASN 28 41 41 ASN ASN A . n A 1 29 GLU 29 42 42 GLU GLU A . n A 1 30 SER 30 43 43 SER SER A . n A 1 31 VAL 31 44 44 VAL VAL A . n A 1 32 GLY 32 45 45 GLY GLY A . n A 1 33 ALA 33 46 46 ALA ALA A . n A 1 34 LEU 34 47 47 LEU LEU A . n A 1 35 GLN 35 48 48 GLN GLN A . n A 1 36 VAL 36 49 49 VAL VAL A . n A 1 37 LEU 37 50 50 LEU LEU A . n A 1 38 GLN 38 51 51 GLN GLN A . n A 1 39 ILE 39 52 52 ILE ILE A . n A 1 40 ALA 40 53 53 ALA ALA A . n A 1 41 CYS 41 54 54 CYS CYS A . n A 1 42 LYS 42 55 55 LYS LYS A . n A 1 43 LYS 43 56 56 LYS LYS A . n A 1 44 LEU 44 57 57 LEU LEU A . n A 1 45 PHE 45 58 58 PHE PHE A . n A 1 46 ASN 46 59 59 ASN ASN A . n A 1 47 LYS 47 60 60 LYS LYS A . n A 1 48 SER 48 61 61 SER SER A . n A 1 49 MET 49 62 62 MET MET A . n A 1 50 GLY 50 63 63 GLY GLY A . n A 1 51 LEU 51 64 64 LEU LEU A . n A 1 52 GLU 52 65 65 GLU GLU A . n A 1 53 ASP 53 66 66 ASP ASP A . n A 1 54 LYS 54 67 67 LYS LYS A . n A 1 55 ASP 55 68 68 ASP ASP A . n A 1 56 ALA 56 69 69 ALA ALA A . n A 1 57 LEU 57 70 70 LEU LEU A . n A 1 58 GLN 58 71 71 GLN GLN A . n A 1 59 ALA 59 72 72 ALA ALA A . n A 1 60 SER 60 73 73 SER SER A . n A 1 61 ILE 61 74 74 ILE ILE A . n A 1 62 ILE 62 75 75 ILE ILE A . n A 1 63 LYS 63 76 76 LYS LYS A . n A 1 64 GLN 64 77 77 GLN GLN A . n A 1 65 GLU 65 78 78 GLU GLU A . n A 1 66 LEU 66 79 79 LEU LEU A . n A 1 67 ARG 67 80 80 ARG ARG A . n A 1 68 GLU 68 81 81 GLU GLU A . n A 1 69 ILE 69 82 82 ILE ILE A . n A 1 70 VAL 70 83 83 VAL VAL A . n A 1 71 GLU 71 84 84 GLU GLU A . n A 1 72 ASN 72 85 85 ASN ASN A . n A 1 73 CYS 73 86 86 CYS CYS A . n A 1 74 GLN 74 87 87 GLN GLN A . n A 1 75 PHE 75 88 88 PHE PHE A . n A 1 76 LEU 76 89 89 LEU LEU A . n A 1 77 ALA 77 90 90 ALA ALA A . n A 1 78 SER 78 91 91 SER SER A . n A 1 79 PRO 79 92 92 PRO PRO A . n A 1 80 LEU 80 93 93 LEU LEU A . n A 1 81 PHE 81 94 94 PHE PHE A . n A 1 82 ASP 82 95 95 ASP ASP A . n A 1 83 THR 83 96 96 THR THR A . n A 1 84 GLN 84 97 97 GLN GLN A . n A 1 85 LEU 85 98 98 LEU LEU A . n A 1 86 ASN 86 99 99 ASN ASN A . n A 1 87 ILE 87 100 100 ILE ILE A . n A 1 88 ALA 88 101 101 ALA ALA A . n A 1 89 ILE 89 102 102 ILE ILE A . n A 1 90 ASN 90 103 103 ASN ASN A . n A 1 91 ASP 91 104 104 ASP ASP A . n A 1 92 GLU 92 105 105 GLU GLU A . n A 1 93 ILE 93 106 106 ILE ILE A . n A 1 94 PHE 94 107 107 PHE PHE A . n A 1 95 SER 95 108 108 SER SER A . n A 1 96 MET 96 109 109 MET MET A . n A 1 97 ILE 97 110 110 ILE ILE A . n A 1 98 VAL 98 111 111 VAL VAL A . n A 1 99 VAL 99 112 112 VAL VAL A . n A 1 100 ASN 100 113 113 ASN ASN A . n A 1 101 PRO 101 114 114 PRO PRO A . n A 1 102 LEU 102 115 115 LEU LEU A . n A 1 103 ASP 103 116 116 ASP ASP A . n A 1 104 LEU 104 117 117 LEU LEU A . n A 1 105 LEU 105 118 118 LEU LEU A . n A 1 106 GLU 106 119 119 GLU GLU A . n A 1 107 ASN 107 120 120 ASN ASN A . n A 1 108 VAL 108 121 121 VAL VAL A . n A 1 109 GLY 109 122 122 GLY GLY A . n A 1 110 GLU 110 123 123 GLU GLU A . n A 1 111 PHE 111 124 124 PHE PHE A . n A 1 112 GLN 112 125 125 GLN GLN A . n A 1 113 ALA 113 126 126 ALA ALA A . n A 1 114 TYR 114 127 127 TYR TYR A . n A 1 115 LEU 115 128 128 LEU LEU A . n A 1 116 GLU 116 129 129 GLU GLU A . n A 1 117 GLU 117 130 130 GLU GLU A . n A 1 118 LYS 118 131 131 LYS LYS A . n A 1 119 LEU 119 132 132 LEU LEU A . n A 1 120 ASN 120 133 133 ASN ASN A . n A 1 121 GLU 121 134 134 GLU GLU A . n A 1 122 ILE 122 135 135 ILE ILE A . n A 1 123 LYS 123 136 136 LYS LYS A . n A 1 124 GLU 124 137 137 GLU GLU A . n A 1 125 LEU 125 138 138 LEU LEU A . n A 1 126 LEU 126 139 139 LEU LEU A . n A 1 127 GLY 127 140 140 GLY GLY A . n A 1 128 TYR 128 141 141 TYR TYR A . n A 1 129 LEU 129 142 142 LEU LEU A . n A 1 130 SER 130 143 143 SER SER A . n A 1 131 GLU 131 144 144 GLU GLU A . n A 1 132 SER 132 145 145 SER SER A . n A 1 133 LEU 133 146 146 LEU LEU A . n A 1 134 SER 134 147 147 SER SER A . n A 1 135 ASN 135 148 ? ? ? A . n A 1 136 PRO 136 149 ? ? ? A . n A 1 137 LYS 137 150 ? ? ? A . n A 1 138 ALA 138 151 ? ? ? A . n A 1 139 PHE 139 152 ? ? ? A . n A 1 140 MET 140 153 ? ? ? A . n A 1 141 PRO 141 154 ? ? ? A . n A 1 142 SER 142 155 ? ? ? A . n A 1 143 PHE 143 156 ? ? ? A . n A 1 144 SER 144 157 ? ? ? A . n A 1 145 ASN 145 158 ? ? ? A . n A 1 146 GLN 146 159 ? ? ? A . n A 1 147 SER 147 160 ? ? ? A . n A 1 148 LEU 148 161 ? ? ? A . n A 1 149 LYS 149 162 ? ? ? A . n A 1 150 ASP 150 163 ? ? ? A . n A 1 151 LEU 151 164 ? ? ? A . n A 1 152 LEU 152 165 ? ? ? A . n A 1 153 SER 153 166 ? ? ? A . n A 1 154 ASP 154 167 ? ? ? A . n A 1 155 ASN 155 168 ? ? ? A . n A 1 156 LEU 156 169 ? ? ? A . n A 1 157 ARG 157 170 ? ? ? A . n A 1 158 ALA 158 171 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 202 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-06-30 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2014-02-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 11.5680 _pdbx_refine_tls.origin_y 14.6020 _pdbx_refine_tls.origin_z -18.0960 _pdbx_refine_tls.T[1][1] 0.0435 _pdbx_refine_tls.T[2][2] 0.0124 _pdbx_refine_tls.T[3][3] 0.0116 _pdbx_refine_tls.T[1][2] -0.0186 _pdbx_refine_tls.T[1][3] 0.0037 _pdbx_refine_tls.T[2][3] -0.0052 _pdbx_refine_tls.L[1][1] 0.9969 _pdbx_refine_tls.L[2][2] 1.8120 _pdbx_refine_tls.L[3][3] 1.7873 _pdbx_refine_tls.L[1][2] 1.2621 _pdbx_refine_tls.L[1][3] 1.3246 _pdbx_refine_tls.L[2][3] 1.6023 _pdbx_refine_tls.S[1][1] -0.0604 _pdbx_refine_tls.S[1][2] 0.0808 _pdbx_refine_tls.S[1][3] -0.0208 _pdbx_refine_tls.S[2][1] -0.0140 _pdbx_refine_tls.S[2][2] 0.0791 _pdbx_refine_tls.S[2][3] -0.0436 _pdbx_refine_tls.S[3][1] -0.0965 _pdbx_refine_tls.S[3][2] 0.1129 _pdbx_refine_tls.S[3][3] -0.0186 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 33 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 147 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 SOLVE phasing . ? 2 REFMAC refinement 5.5.0072 ? 3 HKL-2000 'data reduction' . ? 4 SCALEPACK 'data scaling' . ? 5 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A PHE 33 ? CG ? A PHE 20 CG 2 1 Y 1 A PHE 33 ? CD1 ? A PHE 20 CD1 3 1 Y 1 A PHE 33 ? CD2 ? A PHE 20 CD2 4 1 Y 1 A PHE 33 ? CE1 ? A PHE 20 CE1 5 1 Y 1 A PHE 33 ? CE2 ? A PHE 20 CE2 6 1 Y 1 A PHE 33 ? CZ ? A PHE 20 CZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 14 ? A HIS 1 2 1 Y 1 A HIS 15 ? A HIS 2 3 1 Y 1 A HIS 16 ? A HIS 3 4 1 Y 1 A HIS 17 ? A HIS 4 5 1 Y 1 A HIS 18 ? A HIS 5 6 1 Y 1 A HIS 19 ? A HIS 6 7 1 Y 1 A MET 20 ? A MET 7 8 1 Y 1 A THR 21 ? A THR 8 9 1 Y 1 A ASN 22 ? A ASN 9 10 1 Y 1 A ALA 23 ? A ALA 10 11 1 Y 1 A ILE 24 ? A ILE 11 12 1 Y 1 A GLU 25 ? A GLU 12 13 1 Y 1 A LYS 26 ? A LYS 13 14 1 Y 1 A SER 27 ? A SER 14 15 1 Y 1 A GLN 28 ? A GLN 15 16 1 Y 1 A GLN 29 ? A GLN 16 17 1 Y 1 A ILE 30 ? A ILE 17 18 1 Y 1 A ALA 31 ? A ALA 18 19 1 Y 1 A LYS 32 ? A LYS 19 20 1 Y 1 A ASN 148 ? A ASN 135 21 1 Y 1 A PRO 149 ? A PRO 136 22 1 Y 1 A LYS 150 ? A LYS 137 23 1 Y 1 A ALA 151 ? A ALA 138 24 1 Y 1 A PHE 152 ? A PHE 139 25 1 Y 1 A MET 153 ? A MET 140 26 1 Y 1 A PRO 154 ? A PRO 141 27 1 Y 1 A SER 155 ? A SER 142 28 1 Y 1 A PHE 156 ? A PHE 143 29 1 Y 1 A SER 157 ? A SER 144 30 1 Y 1 A ASN 158 ? A ASN 145 31 1 Y 1 A GLN 159 ? A GLN 146 32 1 Y 1 A SER 160 ? A SER 147 33 1 Y 1 A LEU 161 ? A LEU 148 34 1 Y 1 A LYS 162 ? A LYS 149 35 1 Y 1 A ASP 163 ? A ASP 150 36 1 Y 1 A LEU 164 ? A LEU 151 37 1 Y 1 A LEU 165 ? A LEU 152 38 1 Y 1 A SER 166 ? A SER 153 39 1 Y 1 A ASP 167 ? A ASP 154 40 1 Y 1 A ASN 168 ? A ASN 155 41 1 Y 1 A LEU 169 ? A LEU 156 42 1 Y 1 A ARG 170 ? A ARG 157 43 1 Y 1 A ALA 171 ? A ALA 158 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 1 1 HOH HOH A . B 2 HOH 2 2 2 HOH HOH A . B 2 HOH 3 3 3 HOH HOH A . B 2 HOH 4 4 4 HOH HOH A . B 2 HOH 5 5 5 HOH HOH A . B 2 HOH 6 6 6 HOH HOH A . B 2 HOH 7 7 7 HOH HOH A . B 2 HOH 8 9 9 HOH HOH A . B 2 HOH 9 10 10 HOH HOH A . B 2 HOH 10 11 11 HOH HOH A . B 2 HOH 11 12 12 HOH HOH A . B 2 HOH 12 13 13 HOH HOH A . B 2 HOH 13 172 21 HOH HOH A . B 2 HOH 14 173 22 HOH HOH A . B 2 HOH 15 174 23 HOH HOH A . B 2 HOH 16 175 24 HOH HOH A . B 2 HOH 17 176 25 HOH HOH A . B 2 HOH 18 177 26 HOH HOH A . B 2 HOH 19 178 27 HOH HOH A . B 2 HOH 20 179 28 HOH HOH A . B 2 HOH 21 180 29 HOH HOH A . B 2 HOH 22 181 30 HOH HOH A . B 2 HOH 23 182 31 HOH HOH A . B 2 HOH 24 183 32 HOH HOH A . B 2 HOH 25 184 33 HOH HOH A . B 2 HOH 26 185 34 HOH HOH A . B 2 HOH 27 186 35 HOH HOH A . B 2 HOH 28 187 37 HOH HOH A . B 2 HOH 29 188 38 HOH HOH A . B 2 HOH 30 189 40 HOH HOH A . B 2 HOH 31 190 41 HOH HOH A . B 2 HOH 32 191 42 HOH HOH A . B 2 HOH 33 192 43 HOH HOH A . B 2 HOH 34 193 44 HOH HOH A . B 2 HOH 35 194 45 HOH HOH A . B 2 HOH 36 195 46 HOH HOH A . B 2 HOH 37 196 47 HOH HOH A . B 2 HOH 38 197 48 HOH HOH A . B 2 HOH 39 198 49 HOH HOH A . B 2 HOH 40 199 51 HOH HOH A . B 2 HOH 41 200 52 HOH HOH A . B 2 HOH 42 201 54 HOH HOH A . B 2 HOH 43 202 55 HOH HOH A . B 2 HOH 44 203 56 HOH HOH A . B 2 HOH 45 204 57 HOH HOH A . B 2 HOH 46 205 58 HOH HOH A . B 2 HOH 47 206 59 HOH HOH A . B 2 HOH 48 207 60 HOH HOH A . B 2 HOH 49 208 61 HOH HOH A . B 2 HOH 50 209 63 HOH HOH A . B 2 HOH 51 210 64 HOH HOH A . B 2 HOH 52 211 65 HOH HOH A . B 2 HOH 53 212 68 HOH HOH A . B 2 HOH 54 213 70 HOH HOH A . B 2 HOH 55 214 71 HOH HOH A . B 2 HOH 56 215 72 HOH HOH A . B 2 HOH 57 216 74 HOH HOH A . B 2 HOH 58 217 75 HOH HOH A . B 2 HOH 59 218 76 HOH HOH A . B 2 HOH 60 219 79 HOH HOH A . B 2 HOH 61 220 81 HOH HOH A . B 2 HOH 62 221 82 HOH HOH A . B 2 HOH 63 222 88 HOH HOH A . B 2 HOH 64 223 90 HOH HOH A . B 2 HOH 65 224 92 HOH HOH A . B 2 HOH 66 225 93 HOH HOH A . B 2 HOH 67 226 95 HOH HOH A . B 2 HOH 68 227 96 HOH HOH A . B 2 HOH 69 228 98 HOH HOH A . B 2 HOH 70 229 99 HOH HOH A . B 2 HOH 71 230 110 HOH HOH A . B 2 HOH 72 231 111 HOH HOH A . B 2 HOH 73 232 116 HOH HOH A . B 2 HOH 74 233 117 HOH HOH A . B 2 HOH 75 234 118 HOH HOH A . B 2 HOH 76 235 14 HOH HOH A . B 2 HOH 77 236 15 HOH HOH A . B 2 HOH 78 237 16 HOH HOH A . B 2 HOH 79 238 17 HOH HOH A . B 2 HOH 80 239 18 HOH HOH A . B 2 HOH 81 240 19 HOH HOH A . B 2 HOH 82 241 20 HOH HOH A . #