data_3K47 # _entry.id 3K47 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.289 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3K47 RCSB RCSB055524 WWPDB D_1000055524 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3K45 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3K47 _pdbx_database_status.recvd_initial_deposition_date 2009-10-05 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cody, V.' 1 'Pace, J.' 2 'Queener, S.F.' 3 'Gangjee, A.' 4 # _citation.id primary _citation.title ;Design, synthesis, and X-ray crystal structures of 2,4-diaminofuro[2,3-d]pyrimidines as multireceptor tyrosine kinase and dihydrofolate reductase inhibitors. ; _citation.journal_abbrev Bioorg.Med.Chem. _citation.journal_volume 17 _citation.page_first 7324 _citation.page_last 7336 _citation.year 2009 _citation.journal_id_ASTM BMECEP _citation.country UK _citation.journal_id_ISSN 0968-0896 _citation.journal_id_CSD 1200 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19748785 _citation.pdbx_database_id_DOI 10.1016/j.bmc.2009.08.044 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Gangjee, A.' 1 primary 'Li, W.' 2 primary 'Lin, L.' 3 primary 'Zeng, Y.' 4 primary 'Ihnat, M.' 5 primary 'Warnke, L.A.' 6 primary 'Green, D.W.' 7 primary 'Cody, V.' 8 primary 'Pace, J.' 9 primary 'Queener, S.F.' 10 # _cell.entry_id 3K47 _cell.length_a 41.432 _cell.length_b 61.012 _cell.length_c 43.217 _cell.angle_alpha 90.00 _cell.angle_beta 117.79 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3K47 _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Dihydrofolate reductase' 21503.844 1 1.5.1.3 ? ? ? 2 non-polymer syn '5-[(1E)-2-(2-methoxyphenyl)prop-1-en-1-yl]furo[2,3-d]pyrimidine-2,4-diamine' 296.324 1 ? ? ? ? 3 non-polymer syn 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 745.421 1 ? ? ? ? 4 water nat water 18.015 117 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELK EPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLP EYPGVLSEVQEEKGIKYKFEVYEKKD ; _entity_poly.pdbx_seq_one_letter_code_can ;VRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELK EPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLP EYPGVLSEVQEEKGIKYKFEVYEKKD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 ARG n 1 3 PRO n 1 4 LEU n 1 5 ASN n 1 6 CYS n 1 7 ILE n 1 8 VAL n 1 9 ALA n 1 10 VAL n 1 11 SER n 1 12 GLN n 1 13 ASN n 1 14 MET n 1 15 GLY n 1 16 ILE n 1 17 GLY n 1 18 LYS n 1 19 ASN n 1 20 GLY n 1 21 ASP n 1 22 LEU n 1 23 PRO n 1 24 TRP n 1 25 PRO n 1 26 PRO n 1 27 LEU n 1 28 ARG n 1 29 ASN n 1 30 GLU n 1 31 PHE n 1 32 LYS n 1 33 TYR n 1 34 PHE n 1 35 GLN n 1 36 ARG n 1 37 MET n 1 38 THR n 1 39 THR n 1 40 THR n 1 41 SER n 1 42 SER n 1 43 VAL n 1 44 GLU n 1 45 GLY n 1 46 LYS n 1 47 GLN n 1 48 ASN n 1 49 LEU n 1 50 VAL n 1 51 ILE n 1 52 MET n 1 53 GLY n 1 54 ARG n 1 55 LYS n 1 56 THR n 1 57 TRP n 1 58 PHE n 1 59 SER n 1 60 ILE n 1 61 PRO n 1 62 GLU n 1 63 LYS n 1 64 ASN n 1 65 ARG n 1 66 PRO n 1 67 LEU n 1 68 LYS n 1 69 ASP n 1 70 ARG n 1 71 ILE n 1 72 ASN n 1 73 ILE n 1 74 VAL n 1 75 LEU n 1 76 SER n 1 77 ARG n 1 78 GLU n 1 79 LEU n 1 80 LYS n 1 81 GLU n 1 82 PRO n 1 83 PRO n 1 84 ARG n 1 85 GLY n 1 86 ALA n 1 87 HIS n 1 88 PHE n 1 89 LEU n 1 90 ALA n 1 91 LYS n 1 92 SER n 1 93 LEU n 1 94 ASP n 1 95 ASP n 1 96 ALA n 1 97 LEU n 1 98 ARG n 1 99 LEU n 1 100 ILE n 1 101 GLU n 1 102 GLN n 1 103 PRO n 1 104 GLU n 1 105 LEU n 1 106 ALA n 1 107 SER n 1 108 LYS n 1 109 VAL n 1 110 ASP n 1 111 MET n 1 112 VAL n 1 113 TRP n 1 114 ILE n 1 115 VAL n 1 116 GLY n 1 117 GLY n 1 118 SER n 1 119 SER n 1 120 VAL n 1 121 TYR n 1 122 GLN n 1 123 GLU n 1 124 ALA n 1 125 MET n 1 126 ASN n 1 127 GLN n 1 128 PRO n 1 129 GLY n 1 130 HIS n 1 131 LEU n 1 132 ARG n 1 133 LEU n 1 134 PHE n 1 135 VAL n 1 136 THR n 1 137 ARG n 1 138 ILE n 1 139 MET n 1 140 GLN n 1 141 GLU n 1 142 PHE n 1 143 GLU n 1 144 SER n 1 145 ASP n 1 146 THR n 1 147 PHE n 1 148 PHE n 1 149 PRO n 1 150 GLU n 1 151 ILE n 1 152 ASP n 1 153 LEU n 1 154 GLY n 1 155 LYS n 1 156 TYR n 1 157 LYS n 1 158 LEU n 1 159 LEU n 1 160 PRO n 1 161 GLU n 1 162 TYR n 1 163 PRO n 1 164 GLY n 1 165 VAL n 1 166 LEU n 1 167 SER n 1 168 GLU n 1 169 VAL n 1 170 GLN n 1 171 GLU n 1 172 GLU n 1 173 LYS n 1 174 GLY n 1 175 ILE n 1 176 LYS n 1 177 TYR n 1 178 LYS n 1 179 PHE n 1 180 GLU n 1 181 VAL n 1 182 TYR n 1 183 GLU n 1 184 LYS n 1 185 LYS n 1 186 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Dhfr _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain JM105 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PPH70D _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DYR_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P00375 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3K47 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 186 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00375 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 187 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 186 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 D09 non-polymer . '5-[(1E)-2-(2-methoxyphenyl)prop-1-en-1-yl]furo[2,3-d]pyrimidine-2,4-diamine' ? 'C16 H16 N4 O2' 296.324 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NDP non-polymer . 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' ? 'C21 H30 N7 O17 P3' 745.421 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3K47 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.25 _exptl_crystal.density_percent_sol 45.26 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.3 _exptl_crystal_grow.pdbx_details '200 MM TRIS, PH 8.3, 85 MM NA CACODYLATE, 25% PEG 4K, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 298K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 200 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV' _diffrn_detector.pdbx_collection_date 2005-05-24 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator GRAPHITE _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 3K47 _reflns.observed_criterion_sigma_I 1.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 23.850 _reflns.d_resolution_high 2.050 _reflns.number_obs 10815 _reflns.number_all ? _reflns.percent_possible_obs 94.8 _reflns.pdbx_Rmerge_I_obs 0.06300 _reflns.pdbx_Rsym_value 0.07900 _reflns.pdbx_netI_over_sigmaI 14.6000 _reflns.B_iso_Wilson_estimate 31.00 _reflns.pdbx_redundancy 2.800 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.05 _reflns_shell.d_res_low 2.10 _reflns_shell.percent_possible_all 92.8 _reflns_shell.Rmerge_I_obs 0.32000 _reflns_shell.pdbx_Rsym_value 0.32000 _reflns_shell.meanI_over_sigI_obs 2.600 _reflns_shell.pdbx_redundancy 2.80 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3K47 _refine.ls_number_reflns_obs 10812 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 21.57 _refine.ls_d_res_high 2.05 _refine.ls_percent_reflns_obs 94.2 _refine.ls_R_factor_obs 0.191 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.187 _refine.ls_R_factor_R_free 0.269 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.700 _refine.ls_number_reflns_R_free 536 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.960 _refine.correlation_coeff_Fo_to_Fc_free 0.916 _refine.B_iso_mean 32.48 _refine.aniso_B[1][1] 0.00000 _refine.aniso_B[2][2] 0.00000 _refine.aniso_B[3][3] -0.03000 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] -0.02000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'PDB ENTRY 2FZJ' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1513 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 70 _refine_hist.number_atoms_solvent 117 _refine_hist.number_atoms_total 1700 _refine_hist.d_res_high 2.05 _refine_hist.d_res_low 21.57 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.024 0.022 ? 1624 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 2.632 2.039 ? 2203 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 9.958 5.000 ? 185 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 35.375 24.167 ? 72 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 21.055 15.000 ? 291 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 18.387 15.000 ? 11 'X-RAY DIFFRACTION' ? r_chiral_restr 0.168 0.200 ? 234 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.010 0.020 ? 1215 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.254 0.200 ? 742 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.321 0.200 ? 1042 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.237 0.200 ? 116 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.225 0.200 ? 35 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.403 0.200 ? 10 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.311 1.500 ? 966 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.089 2.000 ? 1515 'X-RAY DIFFRACTION' ? r_scbond_it 3.171 3.000 ? 784 'X-RAY DIFFRACTION' ? r_scangle_it 4.525 4.500 ? 688 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.05 _refine_ls_shell.d_res_low 2.10 _refine_ls_shell.number_reflns_R_work 765 _refine_ls_shell.R_factor_R_work 0.2650 _refine_ls_shell.percent_reflns_obs 92.82 _refine_ls_shell.R_factor_R_free 0.3380 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 50 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3K47 _struct.title ;Alternate Binding Modes Observed for the E- and Z-Isomers of 2,4-Diaminofuro[2,3-d]pyrimidines as Ternary Complexes with NADPH and Mouse Dihydrofolate Reductase ; _struct.pdbx_descriptor 'Dihydrofolate reductase (E.C.1.5.1.3)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3K47 _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'MOUSE DIHYDROFOLATE REDUCTASE COFACTOR LIGAND COMPLEX, NADP, ONE-CARBON METABOLISM, OXIDOREDUCTASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 27 ? THR A 40 ? LEU A 27 THR A 40 1 ? 14 HELX_P HELX_P2 2 ARG A 54 ? ILE A 60 ? ARG A 54 ILE A 60 1 ? 7 HELX_P HELX_P3 3 PRO A 61 ? ARG A 65 ? PRO A 61 ARG A 65 5 ? 5 HELX_P HELX_P4 4 SER A 92 ? GLU A 101 ? SER A 92 GLU A 101 1 ? 10 HELX_P HELX_P5 5 GLY A 117 ? ASN A 126 ? GLY A 117 ASN A 126 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 65 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 65 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 66 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 66 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.37 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 8 ? B ? 8 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel B 1 2 ? parallel B 2 3 ? parallel B 3 4 ? parallel B 4 5 ? parallel B 5 6 ? parallel B 6 7 ? anti-parallel B 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 88 ? ALA A 90 ? PHE A 88 ALA A 90 A 2 ILE A 71 ? LEU A 75 ? ILE A 71 LEU A 75 A 3 GLN A 47 ? GLY A 53 ? GLN A 47 GLY A 53 A 4 VAL A 109 ? GLY A 116 ? VAL A 109 GLY A 116 A 5 LEU A 4 ? SER A 11 ? LEU A 4 SER A 11 A 6 LEU A 131 ? ILE A 138 ? LEU A 131 ILE A 138 A 7 ILE A 175 ? LYS A 184 ? ILE A 175 LYS A 184 A 8 LYS A 157 ? LEU A 158 ? LYS A 157 LEU A 158 B 1 PHE A 88 ? ALA A 90 ? PHE A 88 ALA A 90 B 2 ILE A 71 ? LEU A 75 ? ILE A 71 LEU A 75 B 3 GLN A 47 ? GLY A 53 ? GLN A 47 GLY A 53 B 4 VAL A 109 ? GLY A 116 ? VAL A 109 GLY A 116 B 5 LEU A 4 ? SER A 11 ? LEU A 4 SER A 11 B 6 LEU A 131 ? ILE A 138 ? LEU A 131 ILE A 138 B 7 ILE A 175 ? LYS A 184 ? ILE A 175 LYS A 184 B 8 GLN A 170 ? GLU A 172 ? GLN A 170 GLU A 172 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 88 ? O PHE A 88 N VAL A 74 ? N VAL A 74 A 2 3 O ILE A 73 ? O ILE A 73 N VAL A 50 ? N VAL A 50 A 3 4 N LEU A 49 ? N LEU A 49 O TRP A 113 ? O TRP A 113 A 4 5 O ILE A 114 ? O ILE A 114 N ASN A 5 ? N ASN A 5 A 5 6 N CYS A 6 ? N CYS A 6 O PHE A 134 ? O PHE A 134 A 6 7 N LEU A 131 ? N LEU A 131 O LYS A 184 ? O LYS A 184 A 7 8 O GLU A 183 ? O GLU A 183 N LYS A 157 ? N LYS A 157 B 1 2 O PHE A 88 ? O PHE A 88 N VAL A 74 ? N VAL A 74 B 2 3 O ILE A 73 ? O ILE A 73 N VAL A 50 ? N VAL A 50 B 3 4 N LEU A 49 ? N LEU A 49 O TRP A 113 ? O TRP A 113 B 4 5 O ILE A 114 ? O ILE A 114 N ASN A 5 ? N ASN A 5 B 5 6 N CYS A 6 ? N CYS A 6 O PHE A 134 ? O PHE A 134 B 6 7 N LEU A 131 ? N LEU A 131 O LYS A 184 ? O LYS A 184 B 7 8 O TYR A 177 ? O TYR A 177 N GLN A 170 ? N GLN A 170 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 ? ? ? ? ? 9 'BINDING SITE FOR RESIDUE D09 A 188' AC2 ? ? ? ? ? 26 'BINDING SITE FOR RESIDUE NDP A 187' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 ILE A 7 ? ILE A 7 . ? 1_555 ? 2 AC1 9 ALA A 9 ? ALA A 9 . ? 1_555 ? 3 AC1 9 GLU A 30 ? GLU A 30 . ? 1_555 ? 4 AC1 9 PHE A 31 ? PHE A 31 . ? 1_555 ? 5 AC1 9 PHE A 34 ? PHE A 34 . ? 1_555 ? 6 AC1 9 PRO A 61 ? PRO A 61 . ? 1_555 ? 7 AC1 9 TYR A 121 ? TYR A 121 . ? 1_555 ? 8 AC1 9 THR A 136 ? THR A 136 . ? 1_555 ? 9 AC1 9 HOH D . ? HOH A 237 . ? 1_555 ? 10 AC2 26 ALA A 9 ? ALA A 9 . ? 1_555 ? 11 AC2 26 ILE A 16 ? ILE A 16 . ? 1_555 ? 12 AC2 26 GLY A 17 ? GLY A 17 . ? 1_555 ? 13 AC2 26 GLY A 20 ? GLY A 20 . ? 1_555 ? 14 AC2 26 ASP A 21 ? ASP A 21 . ? 1_555 ? 15 AC2 26 LEU A 22 ? LEU A 22 . ? 1_555 ? 16 AC2 26 GLY A 53 ? GLY A 53 . ? 1_555 ? 17 AC2 26 ARG A 54 ? ARG A 54 . ? 1_555 ? 18 AC2 26 LYS A 55 ? LYS A 55 . ? 1_555 ? 19 AC2 26 THR A 56 ? THR A 56 . ? 1_555 ? 20 AC2 26 LEU A 75 ? LEU A 75 . ? 1_555 ? 21 AC2 26 SER A 76 ? SER A 76 . ? 1_555 ? 22 AC2 26 ARG A 77 ? ARG A 77 . ? 1_555 ? 23 AC2 26 GLU A 78 ? GLU A 78 . ? 1_555 ? 24 AC2 26 LYS A 91 ? LYS A 91 . ? 1_555 ? 25 AC2 26 SER A 92 ? SER A 92 . ? 1_555 ? 26 AC2 26 GLY A 117 ? GLY A 117 . ? 1_555 ? 27 AC2 26 SER A 118 ? SER A 118 . ? 1_555 ? 28 AC2 26 SER A 119 ? SER A 119 . ? 1_555 ? 29 AC2 26 TYR A 121 ? TYR A 121 . ? 1_555 ? 30 AC2 26 HOH D . ? HOH A 220 . ? 1_555 ? 31 AC2 26 HOH D . ? HOH A 235 . ? 1_555 ? 32 AC2 26 HOH D . ? HOH A 237 . ? 1_555 ? 33 AC2 26 HOH D . ? HOH A 256 . ? 1_555 ? 34 AC2 26 HOH D . ? HOH A 268 . ? 1_555 ? 35 AC2 26 HOH D . ? HOH A 281 . ? 1_555 ? # _database_PDB_matrix.entry_id 3K47 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3K47 _atom_sites.fract_transf_matrix[1][1] 0.024136 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.012717 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016390 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.026154 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 MET 111 111 111 MET MET A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 TRP 113 113 113 TRP TRP A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 TYR 121 121 121 TYR TYR A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 MET 125 125 125 MET MET A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 HIS 130 130 130 HIS HIS A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 MET 139 139 139 MET MET A . n A 1 140 GLN 140 140 140 GLN GLN A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 PHE 142 142 142 PHE PHE A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 TYR 156 156 156 TYR TYR A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 TYR 162 162 162 TYR TYR A . n A 1 163 PRO 163 163 163 PRO PRO A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 SER 167 167 167 SER SER A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 GLN 170 170 170 GLN GLN A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 LYS 173 173 173 LYS LYS A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 TYR 177 177 177 TYR TYR A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 PHE 179 179 179 PHE PHE A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 TYR 182 182 182 TYR TYR A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 ASP 186 186 186 ASP ASP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 D09 1 188 188 D09 D09 A . C 3 NDP 1 187 187 NDP NDP A . D 4 HOH 1 189 189 HOH HOH A . D 4 HOH 2 190 190 HOH HOH A . D 4 HOH 3 191 191 HOH HOH A . D 4 HOH 4 192 192 HOH HOH A . D 4 HOH 5 193 193 HOH HOH A . D 4 HOH 6 194 194 HOH HOH A . D 4 HOH 7 195 195 HOH HOH A . D 4 HOH 8 196 196 HOH HOH A . D 4 HOH 9 197 197 HOH HOH A . D 4 HOH 10 198 198 HOH HOH A . D 4 HOH 11 199 199 HOH HOH A . D 4 HOH 12 200 200 HOH HOH A . D 4 HOH 13 201 201 HOH HOH A . D 4 HOH 14 202 202 HOH HOH A . D 4 HOH 15 203 203 HOH HOH A . D 4 HOH 16 204 204 HOH HOH A . D 4 HOH 17 205 205 HOH HOH A . D 4 HOH 18 206 206 HOH HOH A . D 4 HOH 19 207 207 HOH HOH A . D 4 HOH 20 208 208 HOH HOH A . D 4 HOH 21 209 209 HOH HOH A . D 4 HOH 22 210 210 HOH HOH A . D 4 HOH 23 211 211 HOH HOH A . D 4 HOH 24 212 212 HOH HOH A . D 4 HOH 25 213 213 HOH HOH A . D 4 HOH 26 214 214 HOH HOH A . D 4 HOH 27 215 215 HOH HOH A . D 4 HOH 28 216 216 HOH HOH A . D 4 HOH 29 217 217 HOH HOH A . D 4 HOH 30 218 218 HOH HOH A . D 4 HOH 31 219 219 HOH HOH A . D 4 HOH 32 220 220 HOH HOH A . D 4 HOH 33 221 221 HOH HOH A . D 4 HOH 34 222 222 HOH HOH A . D 4 HOH 35 223 223 HOH HOH A . D 4 HOH 36 224 224 HOH HOH A . D 4 HOH 37 225 225 HOH HOH A . D 4 HOH 38 226 226 HOH HOH A . D 4 HOH 39 227 227 HOH HOH A . D 4 HOH 40 228 228 HOH HOH A . D 4 HOH 41 229 229 HOH HOH A . D 4 HOH 42 230 230 HOH HOH A . D 4 HOH 43 231 231 HOH HOH A . D 4 HOH 44 232 232 HOH HOH A . D 4 HOH 45 233 233 HOH HOH A . D 4 HOH 46 234 234 HOH HOH A . D 4 HOH 47 235 235 HOH HOH A . D 4 HOH 48 236 236 HOH HOH A . D 4 HOH 49 237 237 HOH HOH A . D 4 HOH 50 238 238 HOH HOH A . D 4 HOH 51 239 239 HOH HOH A . D 4 HOH 52 240 240 HOH HOH A . D 4 HOH 53 241 241 HOH HOH A . D 4 HOH 54 242 242 HOH HOH A . D 4 HOH 55 243 243 HOH HOH A . D 4 HOH 56 244 244 HOH HOH A . D 4 HOH 57 245 245 HOH HOH A . D 4 HOH 58 246 246 HOH HOH A . D 4 HOH 59 247 247 HOH HOH A . D 4 HOH 60 248 248 HOH HOH A . D 4 HOH 61 249 249 HOH HOH A . D 4 HOH 62 250 250 HOH HOH A . D 4 HOH 63 251 251 HOH HOH A . D 4 HOH 64 252 252 HOH HOH A . D 4 HOH 65 253 253 HOH HOH A . D 4 HOH 66 254 254 HOH HOH A . D 4 HOH 67 255 255 HOH HOH A . D 4 HOH 68 256 256 HOH HOH A . D 4 HOH 69 257 257 HOH HOH A . D 4 HOH 70 258 258 HOH HOH A . D 4 HOH 71 259 259 HOH HOH A . D 4 HOH 72 260 260 HOH HOH A . D 4 HOH 73 261 261 HOH HOH A . D 4 HOH 74 262 262 HOH HOH A . D 4 HOH 75 263 263 HOH HOH A . D 4 HOH 76 264 264 HOH HOH A . D 4 HOH 77 265 265 HOH HOH A . D 4 HOH 78 266 266 HOH HOH A . D 4 HOH 79 267 267 HOH HOH A . D 4 HOH 80 268 268 HOH HOH A . D 4 HOH 81 269 269 HOH HOH A . D 4 HOH 82 270 270 HOH HOH A . D 4 HOH 83 271 271 HOH HOH A . D 4 HOH 84 272 272 HOH HOH A . D 4 HOH 85 273 273 HOH HOH A . D 4 HOH 86 274 274 HOH HOH A . D 4 HOH 87 275 275 HOH HOH A . D 4 HOH 88 276 276 HOH HOH A . D 4 HOH 89 277 277 HOH HOH A . D 4 HOH 90 278 278 HOH HOH A . D 4 HOH 91 279 279 HOH HOH A . D 4 HOH 92 280 280 HOH HOH A . D 4 HOH 93 281 281 HOH HOH A . D 4 HOH 94 282 282 HOH HOH A . D 4 HOH 95 283 283 HOH HOH A . D 4 HOH 96 284 284 HOH HOH A . D 4 HOH 97 285 285 HOH HOH A . D 4 HOH 98 286 286 HOH HOH A . D 4 HOH 99 287 287 HOH HOH A . D 4 HOH 100 288 288 HOH HOH A . D 4 HOH 101 289 289 HOH HOH A . D 4 HOH 102 290 290 HOH HOH A . D 4 HOH 103 291 291 HOH HOH A . D 4 HOH 104 292 292 HOH HOH A . D 4 HOH 105 293 293 HOH HOH A . D 4 HOH 106 294 294 HOH HOH A . D 4 HOH 107 295 295 HOH HOH A . D 4 HOH 108 296 296 HOH HOH A . D 4 HOH 109 297 297 HOH HOH A . D 4 HOH 110 298 298 HOH HOH A . D 4 HOH 111 299 299 HOH HOH A . D 4 HOH 112 300 300 HOH HOH A . D 4 HOH 113 301 301 HOH HOH A . D 4 HOH 114 302 302 HOH HOH A . D 4 HOH 115 303 303 HOH HOH A . D 4 HOH 116 304 304 HOH HOH A . D 4 HOH 117 305 305 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-10-13 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2018-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Non-polymer description' 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Structure summary' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 3 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category audit_author # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 3 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_audit_author.name' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MOLREP phasing . ? 1 REFMAC refinement 5.2.0019 ? 2 HKL-2000 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 198 ? ? O A HOH 295 ? ? 1.70 2 1 OH A TYR 162 ? ? O A HOH 240 ? ? 2.18 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLU _pdbx_validate_symm_contact.auth_seq_id_1 104 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 191 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_545 _pdbx_validate_symm_contact.dist 1.73 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG A MET 37 ? ? SD A MET 37 ? ? CE A MET 37 ? ? 109.96 100.20 9.76 1.60 N 2 1 CA A LEU 49 ? ? CB A LEU 49 ? ? CG A LEU 49 ? ? 136.20 115.30 20.90 2.30 N 3 1 NE A ARG 54 ? ? CZ A ARG 54 ? ? NH1 A ARG 54 ? ? 123.78 120.30 3.48 0.50 N 4 1 NE A ARG 65 ? ? CZ A ARG 65 ? ? NH1 A ARG 65 ? ? 117.23 120.30 -3.07 0.50 N 5 1 N A GLY 117 ? ? CA A GLY 117 ? ? C A GLY 117 ? ? 93.09 113.10 -20.01 2.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 2 ? ? -127.03 -58.64 2 1 MET A 14 ? ? 95.18 17.51 3 1 ALA A 106 ? ? -65.66 97.15 4 1 SER A 107 ? ? 133.33 -14.53 5 1 ASP A 110 ? ? -115.56 -99.03 6 1 GLN A 140 ? ? 174.44 142.61 7 1 ASP A 145 ? ? -58.56 -76.03 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 GLY _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 116 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 GLY _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 117 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 91.51 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id GLY _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 116 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle 12.03 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id C2B _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id NDP _pdbx_validate_chiral.auth_seq_id 187 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details 'WRONG HAND' _pdbx_validate_chiral.omega . # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '5-[(1E)-2-(2-methoxyphenyl)prop-1-en-1-yl]furo[2,3-d]pyrimidine-2,4-diamine' D09 3 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' NDP 4 water HOH #