data_3K6R # _entry.id 3K6R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3K6R RCSB RCSB055616 WWPDB D_1000055616 # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2009-10-20 _pdbx_database_PDB_obs_spr.pdb_id 3K6R _pdbx_database_PDB_obs_spr.replace_pdb_id 2FRN _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id APC5737 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3K6R _pdbx_database_status.recvd_initial_deposition_date 2009-10-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chang, C.' 1 'Skarina, T.' 2 'Savchenko, A.' 3 'Edwards, A.' 4 'Joachimiak, A.' 5 'Midwest Center for Structural Genomics (MCSG)' 6 # _citation.id primary _citation.title 'Crystal Structure of Protein Ph0793 from Pyrococcus Horikoshii' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Chang, C.' 1 primary 'Skarina, T.' 2 primary 'Savchenko, A.' 3 primary 'Edwards, A.' 4 primary 'Joachimiak, A.' 5 # _cell.entry_id 3K6R _cell.length_a 51.308 _cell.length_b 54.231 _cell.length_c 58.613 _cell.angle_alpha 90.00 _cell.angle_beta 100.02 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3K6R _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'putative transferase PH0793' 32583.000 1 ? ? ? ? 2 water nat water 18.015 93 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)RTQGIKPRIREILSKELPEELVKLLPKRWVRIGDVLLLPLRPELEPYKHRIAEVYAEVLGVKTVLRKGHIHGETR KPDYELLYGSDTVTVHVENGIKYKLDVAKI(MSE)FSPANVKERVR(MSE)AKVAKPDELVVD(MSE)FAGIGHLSLPIA VYGKAKVIAIEKDPYTFKFLVENIHLNKVEDR(MSE)SAYN(MSE)DNRDFPGENIADRIL(MSE)GYVVRTHEFIPKAL SIAKDGAIIHYHNTVPEKL(MSE)PREPFETFKRITKEYGYDVEKLNELKIKRYAPGVWHVVLDLRVFKS ; _entity_poly.pdbx_seq_one_letter_code_can ;MRTQGIKPRIREILSKELPEELVKLLPKRWVRIGDVLLLPLRPELEPYKHRIAEVYAEVLGVKTVLRKGHIHGETRKPDY ELLYGSDTVTVHVENGIKYKLDVAKIMFSPANVKERVRMAKVAKPDELVVDMFAGIGHLSLPIAVYGKAKVIAIEKDPYT FKFLVENIHLNKVEDRMSAYNMDNRDFPGENIADRILMGYVVRTHEFIPKALSIAKDGAIIHYHNTVPEKLMPREPFETF KRITKEYGYDVEKLNELKIKRYAPGVWHVVLDLRVFKS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier APC5737 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ARG n 1 3 THR n 1 4 GLN n 1 5 GLY n 1 6 ILE n 1 7 LYS n 1 8 PRO n 1 9 ARG n 1 10 ILE n 1 11 ARG n 1 12 GLU n 1 13 ILE n 1 14 LEU n 1 15 SER n 1 16 LYS n 1 17 GLU n 1 18 LEU n 1 19 PRO n 1 20 GLU n 1 21 GLU n 1 22 LEU n 1 23 VAL n 1 24 LYS n 1 25 LEU n 1 26 LEU n 1 27 PRO n 1 28 LYS n 1 29 ARG n 1 30 TRP n 1 31 VAL n 1 32 ARG n 1 33 ILE n 1 34 GLY n 1 35 ASP n 1 36 VAL n 1 37 LEU n 1 38 LEU n 1 39 LEU n 1 40 PRO n 1 41 LEU n 1 42 ARG n 1 43 PRO n 1 44 GLU n 1 45 LEU n 1 46 GLU n 1 47 PRO n 1 48 TYR n 1 49 LYS n 1 50 HIS n 1 51 ARG n 1 52 ILE n 1 53 ALA n 1 54 GLU n 1 55 VAL n 1 56 TYR n 1 57 ALA n 1 58 GLU n 1 59 VAL n 1 60 LEU n 1 61 GLY n 1 62 VAL n 1 63 LYS n 1 64 THR n 1 65 VAL n 1 66 LEU n 1 67 ARG n 1 68 LYS n 1 69 GLY n 1 70 HIS n 1 71 ILE n 1 72 HIS n 1 73 GLY n 1 74 GLU n 1 75 THR n 1 76 ARG n 1 77 LYS n 1 78 PRO n 1 79 ASP n 1 80 TYR n 1 81 GLU n 1 82 LEU n 1 83 LEU n 1 84 TYR n 1 85 GLY n 1 86 SER n 1 87 ASP n 1 88 THR n 1 89 VAL n 1 90 THR n 1 91 VAL n 1 92 HIS n 1 93 VAL n 1 94 GLU n 1 95 ASN n 1 96 GLY n 1 97 ILE n 1 98 LYS n 1 99 TYR n 1 100 LYS n 1 101 LEU n 1 102 ASP n 1 103 VAL n 1 104 ALA n 1 105 LYS n 1 106 ILE n 1 107 MSE n 1 108 PHE n 1 109 SER n 1 110 PRO n 1 111 ALA n 1 112 ASN n 1 113 VAL n 1 114 LYS n 1 115 GLU n 1 116 ARG n 1 117 VAL n 1 118 ARG n 1 119 MSE n 1 120 ALA n 1 121 LYS n 1 122 VAL n 1 123 ALA n 1 124 LYS n 1 125 PRO n 1 126 ASP n 1 127 GLU n 1 128 LEU n 1 129 VAL n 1 130 VAL n 1 131 ASP n 1 132 MSE n 1 133 PHE n 1 134 ALA n 1 135 GLY n 1 136 ILE n 1 137 GLY n 1 138 HIS n 1 139 LEU n 1 140 SER n 1 141 LEU n 1 142 PRO n 1 143 ILE n 1 144 ALA n 1 145 VAL n 1 146 TYR n 1 147 GLY n 1 148 LYS n 1 149 ALA n 1 150 LYS n 1 151 VAL n 1 152 ILE n 1 153 ALA n 1 154 ILE n 1 155 GLU n 1 156 LYS n 1 157 ASP n 1 158 PRO n 1 159 TYR n 1 160 THR n 1 161 PHE n 1 162 LYS n 1 163 PHE n 1 164 LEU n 1 165 VAL n 1 166 GLU n 1 167 ASN n 1 168 ILE n 1 169 HIS n 1 170 LEU n 1 171 ASN n 1 172 LYS n 1 173 VAL n 1 174 GLU n 1 175 ASP n 1 176 ARG n 1 177 MSE n 1 178 SER n 1 179 ALA n 1 180 TYR n 1 181 ASN n 1 182 MSE n 1 183 ASP n 1 184 ASN n 1 185 ARG n 1 186 ASP n 1 187 PHE n 1 188 PRO n 1 189 GLY n 1 190 GLU n 1 191 ASN n 1 192 ILE n 1 193 ALA n 1 194 ASP n 1 195 ARG n 1 196 ILE n 1 197 LEU n 1 198 MSE n 1 199 GLY n 1 200 TYR n 1 201 VAL n 1 202 VAL n 1 203 ARG n 1 204 THR n 1 205 HIS n 1 206 GLU n 1 207 PHE n 1 208 ILE n 1 209 PRO n 1 210 LYS n 1 211 ALA n 1 212 LEU n 1 213 SER n 1 214 ILE n 1 215 ALA n 1 216 LYS n 1 217 ASP n 1 218 GLY n 1 219 ALA n 1 220 ILE n 1 221 ILE n 1 222 HIS n 1 223 TYR n 1 224 HIS n 1 225 ASN n 1 226 THR n 1 227 VAL n 1 228 PRO n 1 229 GLU n 1 230 LYS n 1 231 LEU n 1 232 MSE n 1 233 PRO n 1 234 ARG n 1 235 GLU n 1 236 PRO n 1 237 PHE n 1 238 GLU n 1 239 THR n 1 240 PHE n 1 241 LYS n 1 242 ARG n 1 243 ILE n 1 244 THR n 1 245 LYS n 1 246 GLU n 1 247 TYR n 1 248 GLY n 1 249 TYR n 1 250 ASP n 1 251 VAL n 1 252 GLU n 1 253 LYS n 1 254 LEU n 1 255 ASN n 1 256 GLU n 1 257 LEU n 1 258 LYS n 1 259 ILE n 1 260 LYS n 1 261 ARG n 1 262 TYR n 1 263 ALA n 1 264 PRO n 1 265 GLY n 1 266 VAL n 1 267 TRP n 1 268 HIS n 1 269 VAL n 1 270 VAL n 1 271 LEU n 1 272 ASP n 1 273 LEU n 1 274 ARG n 1 275 VAL n 1 276 PHE n 1 277 LYS n 1 278 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PH0793 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain OT3 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus horikoshii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 53953 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) DERIVATIVES' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O58523_PYRHO _struct_ref.pdbx_db_accession O58523 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRTQGIKPRIREILSKELPEELVKLLPKRWVRIGDVLLLPLRPELEPYKHRIAEVYAEVLGVKTVLRKGHIHGETRKPDY ELLYGSDTVTVHVENGIKYKLDVAKIMFSPANVKERVRMAKVAKPDELVVDMFAGIGHLSLPIAVYGKAKVIAIEKDPYT FKFLVENIHLNKVEDRMSAYNMDNRDFPGENIADRILMGYVVRTHEFIPKALSIAKDGAIIHYHNTVPEKLMPREPFETF KRITKEYGYDVEKLNELKIKRYAPGVWHVVLDLRVFKS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3K6R _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 278 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O58523 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 278 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 278 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3K6R _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.46 _exptl_crystal.density_percent_sol 50.06 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pdbx_details '20% PEG 10K, 0.1M MES PH 6, VAPOR DIFFUSION, SITTING DROP, temperature 290K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2005-10-17 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'DOUBLE CRYSTAL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97940 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_wavelength 0.97940 _diffrn_source.pdbx_wavelength_list 0.97940 # _reflns.entry_id 3K6R _reflns.observed_criterion_sigma_I -3.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.000 _reflns.d_resolution_high 2.100 _reflns.number_obs 18186 _reflns.number_all 18688 _reflns.percent_possible_obs 97.3 _reflns.pdbx_Rmerge_I_obs 0.07200 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 40.9000 _reflns.B_iso_Wilson_estimate 35.1 _reflns.pdbx_redundancy 3.600 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.18 _reflns_shell.percent_possible_all 88.0 _reflns_shell.Rmerge_I_obs 0.19200 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 6.560 _reflns_shell.pdbx_redundancy 3.40 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1624 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3K6R _refine.ls_number_reflns_obs 18174 _refine.ls_number_reflns_all 18174 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50.000 _refine.ls_d_res_high 2.10 _refine.ls_percent_reflns_obs 96.88 _refine.ls_R_factor_obs 0.21339 _refine.ls_R_factor_all 0.21339 _refine.ls_R_factor_R_work 0.21099 _refine.ls_R_factor_R_free 0.25583 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 932 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.944 _refine.correlation_coeff_Fo_to_Fc_free 0.914 _refine.B_iso_mean 31.828 _refine.aniso_B[1][1] 3.18 _refine.aniso_B[2][2] -1.71 _refine.aniso_B[3][3] -1.04 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 1.23 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.233 _refine.pdbx_overall_ESU_R_Free 0.198 _refine.overall_SU_ML 0.144 _refine.overall_SU_B 11.682 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2116 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 93 _refine_hist.number_atoms_total 2209 _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 50.000 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.015 0.022 ? 2162 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.407 1.985 ? 2921 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.004 5.000 ? 259 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 29.759 23.077 ? 91 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 15.128 15.000 ? 403 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 13.666 15.000 ? 16 'X-RAY DIFFRACTION' ? r_chiral_restr 0.097 0.200 ? 332 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.021 ? 1579 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.728 1.500 ? 1310 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.277 2.000 ? 2131 'X-RAY DIFFRACTION' ? r_scbond_it 2.046 3.000 ? 852 'X-RAY DIFFRACTION' ? r_scangle_it 3.207 4.500 ? 790 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.097 _refine_ls_shell.d_res_low 2.152 _refine_ls_shell.number_reflns_R_work 1078 _refine_ls_shell.R_factor_R_work 0.229 _refine_ls_shell.percent_reflns_obs 81.99 _refine_ls_shell.R_factor_R_free 0.277 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 51 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3K6R _struct.title 'CRYSTAL STRUCTURE OF putative transferase PH0793 FROM PYROCOCCUS HORIKOSHII' _struct.pdbx_descriptor 'putative transferase PH0793' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3K6R _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;STRUCTURAL GENOMICS, PYROCOCCUS HORIKOSHII, transferase, PSI, PROTEIN STRUCTURE INITIATIVE, MIDWEST CENTER FOR STRUCTURAL GENOMICS, MCSG, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 6 ? SER A 15 ? ILE A 6 SER A 15 1 ? 10 HELX_P HELX_P2 2 PRO A 19 ? LEU A 26 ? PRO A 19 LEU A 26 5 ? 8 HELX_P HELX_P3 3 LEU A 45 ? PRO A 47 ? LEU A 45 PRO A 47 5 ? 3 HELX_P HELX_P4 4 TYR A 48 ? GLY A 61 ? TYR A 48 GLY A 61 1 ? 14 HELX_P HELX_P5 5 SER A 109 ? ALA A 111 ? SER A 109 ALA A 111 5 ? 3 HELX_P HELX_P6 6 ASN A 112 ? ALA A 123 ? ASN A 112 ALA A 123 1 ? 12 HELX_P HELX_P7 7 LEU A 139 ? TYR A 146 ? LEU A 139 TYR A 146 1 ? 8 HELX_P HELX_P8 8 ASP A 157 ? ASN A 171 ? ASP A 157 ASN A 171 1 ? 15 HELX_P HELX_P9 9 ARG A 203 ? GLU A 206 ? ARG A 203 GLU A 206 5 ? 4 HELX_P HELX_P10 10 PHE A 207 ? ILE A 214 ? PHE A 207 ILE A 214 1 ? 8 HELX_P HELX_P11 11 LYS A 230 ? MSE A 232 ? LYS A 230 MSE A 232 5 ? 3 HELX_P HELX_P12 12 PRO A 236 ? TYR A 247 ? PRO A 236 TYR A 247 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ILE 106 C ? ? ? 1_555 A MSE 107 N ? ? A ILE 106 A MSE 107 1_555 ? ? ? ? ? ? ? 1.325 ? covale2 covale ? ? A MSE 107 C ? ? ? 1_555 A PHE 108 N ? ? A MSE 107 A PHE 108 1_555 ? ? ? ? ? ? ? 1.332 ? covale3 covale ? ? A ARG 118 C ? ? ? 1_555 A MSE 119 N ? ? A ARG 118 A MSE 119 1_555 ? ? ? ? ? ? ? 1.327 ? covale4 covale ? ? A MSE 119 C ? ? ? 1_555 A ALA 120 N ? ? A MSE 119 A ALA 120 1_555 ? ? ? ? ? ? ? 1.333 ? covale5 covale ? ? A ASP 131 C ? ? ? 1_555 A MSE 132 N ? ? A ASP 131 A MSE 132 1_555 ? ? ? ? ? ? ? 1.337 ? covale6 covale ? ? A MSE 132 C ? ? ? 1_555 A PHE 133 N ? ? A MSE 132 A PHE 133 1_555 ? ? ? ? ? ? ? 1.323 ? covale7 covale ? ? A ARG 176 C ? ? ? 1_555 A MSE 177 N ? ? A ARG 176 A MSE 177 1_555 ? ? ? ? ? ? ? 1.333 ? covale8 covale ? ? A MSE 177 C ? ? ? 1_555 A SER 178 N ? ? A MSE 177 A SER 178 1_555 ? ? ? ? ? ? ? 1.337 ? covale9 covale ? ? A ASN 181 C ? ? ? 1_555 A MSE 182 N ? ? A ASN 181 A MSE 182 1_555 ? ? ? ? ? ? ? 1.329 ? covale10 covale ? ? A MSE 182 C ? ? ? 1_555 A ASP 183 N ? ? A MSE 182 A ASP 183 1_555 ? ? ? ? ? ? ? 1.328 ? covale11 covale ? ? A LEU 197 C ? ? ? 1_555 A MSE 198 N ? ? A LEU 197 A MSE 198 1_555 ? ? ? ? ? ? ? 1.332 ? covale12 covale ? ? A MSE 198 C ? ? ? 1_555 A GLY 199 N ? ? A MSE 198 A GLY 199 1_555 ? ? ? ? ? ? ? 1.327 ? covale13 covale ? ? A LEU 231 C ? ? ? 1_555 A MSE 232 N ? ? A LEU 231 A MSE 232 1_555 ? ? ? ? ? ? ? 1.331 ? covale14 covale ? ? A MSE 232 C ? ? ? 1_555 A PRO 233 N ? ? A MSE 232 A PRO 233 1_555 ? ? ? ? ? ? ? 1.346 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 MSE 232 A . ? MSE 232 A PRO 233 A ? PRO 233 A 1 2.75 2 GLU 235 A . ? GLU 235 A PRO 236 A ? PRO 236 A 1 4.88 3 ALA 263 A . ? ALA 263 A PRO 264 A ? PRO 264 A 1 -2.04 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? C ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? parallel C 2 3 ? parallel C 3 4 ? parallel C 4 5 ? parallel C 5 6 ? anti-parallel C 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 31 ? ILE A 33 ? VAL A 31 ILE A 33 A 2 VAL A 36 ? LEU A 39 ? VAL A 36 LEU A 39 A 3 THR A 64 ? ARG A 67 ? THR A 64 ARG A 67 A 4 GLU A 81 ? TYR A 84 ? GLU A 81 TYR A 84 B 1 VAL A 89 ? GLU A 94 ? VAL A 89 GLU A 94 B 2 ILE A 97 ? ASP A 102 ? ILE A 97 ASP A 102 C 1 MSE A 177 ? TYR A 180 ? MSE A 177 TYR A 180 C 2 LYS A 150 ? ILE A 154 ? LYS A 150 ILE A 154 C 3 LEU A 128 ? ASP A 131 ? LEU A 128 ASP A 131 C 4 ALA A 193 ? MSE A 198 ? ALA A 193 MSE A 198 C 5 ALA A 215 ? PRO A 228 ? ALA A 215 PRO A 228 C 6 VAL A 266 ? PHE A 276 ? VAL A 266 PHE A 276 C 7 ASP A 250 ? TYR A 262 ? ASP A 250 TYR A 262 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 31 ? N VAL A 31 O LEU A 38 ? O LEU A 38 A 2 3 N LEU A 39 ? N LEU A 39 O LEU A 66 ? O LEU A 66 A 3 4 N VAL A 65 ? N VAL A 65 O LEU A 83 ? O LEU A 83 B 1 2 N HIS A 92 ? N HIS A 92 O TYR A 99 ? O TYR A 99 C 1 2 O SER A 178 ? O SER A 178 N ALA A 153 ? N ALA A 153 C 2 3 O ILE A 152 ? O ILE A 152 N ASP A 131 ? N ASP A 131 C 3 4 N VAL A 130 ? N VAL A 130 O LEU A 197 ? O LEU A 197 C 4 5 N ILE A 196 ? N ILE A 196 O HIS A 222 ? O HIS A 222 C 5 6 N VAL A 227 ? N VAL A 227 O TRP A 267 ? O TRP A 267 C 6 7 O ARG A 274 ? O ARG A 274 N GLU A 252 ? N GLU A 252 # _database_PDB_matrix.entry_id 3K6R _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3K6R _atom_sites.fract_transf_matrix[1][1] 0.019490 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.003445 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018440 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017325 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 ARG 2 2 ? ? ? A . n A 1 3 THR 3 3 ? ? ? A . n A 1 4 GLN 4 4 ? ? ? A . n A 1 5 GLY 5 5 ? ? ? A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 LYS 28 28 28 LYS ALA A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ARG 42 42 ? ? ? A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 GLU 44 44 44 GLU ALA A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 LYS 68 68 68 LYS ALA A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 HIS 70 70 ? ? ? A . n A 1 71 ILE 71 71 ? ? ? A . n A 1 72 HIS 72 72 ? ? ? A . n A 1 73 GLY 73 73 ? ? ? A . n A 1 74 GLU 74 74 ? ? ? A . n A 1 75 THR 75 75 ? ? ? A . n A 1 76 ARG 76 76 ? ? ? A . n A 1 77 LYS 77 77 ? ? ? A . n A 1 78 PRO 78 78 ? ? ? A . n A 1 79 ASP 79 79 ? ? ? A . n A 1 80 TYR 80 80 80 TYR ALA A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 MSE 107 107 107 MSE MSE A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 MSE 119 119 119 MSE MSE A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 MSE 132 132 132 MSE MSE A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 HIS 138 138 138 HIS HIS A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 PRO 142 142 142 PRO PRO A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 PRO 158 158 158 PRO PRO A . n A 1 159 TYR 159 159 159 TYR TYR A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 PHE 163 163 163 PHE PHE A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 ASN 167 167 167 ASN ASN A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 HIS 169 169 169 HIS HIS A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 ARG 176 176 176 ARG ARG A . n A 1 177 MSE 177 177 177 MSE MSE A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 TYR 180 180 180 TYR TYR A . n A 1 181 ASN 181 181 181 ASN ASN A . n A 1 182 MSE 182 182 182 MSE MSE A . n A 1 183 ASP 183 183 183 ASP ASP A . n A 1 184 ASN 184 184 184 ASN ASN A . n A 1 185 ARG 185 185 185 ARG ARG A . n A 1 186 ASP 186 186 186 ASP ASP A . n A 1 187 PHE 187 187 187 PHE PHE A . n A 1 188 PRO 188 188 188 PRO PRO A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 ASN 191 191 191 ASN ASN A . n A 1 192 ILE 192 192 192 ILE ILE A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 ASP 194 194 194 ASP ASP A . n A 1 195 ARG 195 195 195 ARG ARG A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 LEU 197 197 197 LEU LEU A . n A 1 198 MSE 198 198 198 MSE MSE A . n A 1 199 GLY 199 199 199 GLY GLY A . n A 1 200 TYR 200 200 200 TYR TYR A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 ARG 203 203 203 ARG ARG A . n A 1 204 THR 204 204 204 THR THR A . n A 1 205 HIS 205 205 205 HIS HIS A . n A 1 206 GLU 206 206 206 GLU GLU A . n A 1 207 PHE 207 207 207 PHE PHE A . n A 1 208 ILE 208 208 208 ILE ILE A . n A 1 209 PRO 209 209 209 PRO PRO A . n A 1 210 LYS 210 210 210 LYS LYS A . n A 1 211 ALA 211 211 211 ALA ALA A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 SER 213 213 213 SER SER A . n A 1 214 ILE 214 214 214 ILE ILE A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 LYS 216 216 216 LYS LYS A . n A 1 217 ASP 217 217 217 ASP ASP A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 ALA 219 219 219 ALA ALA A . n A 1 220 ILE 220 220 220 ILE ILE A . n A 1 221 ILE 221 221 221 ILE ILE A . n A 1 222 HIS 222 222 222 HIS HIS A . n A 1 223 TYR 223 223 223 TYR TYR A . n A 1 224 HIS 224 224 224 HIS HIS A . n A 1 225 ASN 225 225 225 ASN ASN A . n A 1 226 THR 226 226 226 THR THR A . n A 1 227 VAL 227 227 227 VAL VAL A . n A 1 228 PRO 228 228 228 PRO PRO A . n A 1 229 GLU 229 229 229 GLU GLU A . n A 1 230 LYS 230 230 230 LYS LYS A . n A 1 231 LEU 231 231 231 LEU LEU A . n A 1 232 MSE 232 232 232 MSE MSE A . n A 1 233 PRO 233 233 233 PRO PRO A . n A 1 234 ARG 234 234 234 ARG ARG A . n A 1 235 GLU 235 235 235 GLU GLU A . n A 1 236 PRO 236 236 236 PRO PRO A . n A 1 237 PHE 237 237 237 PHE PHE A . n A 1 238 GLU 238 238 238 GLU GLU A . n A 1 239 THR 239 239 239 THR THR A . n A 1 240 PHE 240 240 240 PHE PHE A . n A 1 241 LYS 241 241 241 LYS LYS A . n A 1 242 ARG 242 242 242 ARG ARG A . n A 1 243 ILE 243 243 243 ILE ILE A . n A 1 244 THR 244 244 244 THR THR A . n A 1 245 LYS 245 245 245 LYS LYS A . n A 1 246 GLU 246 246 246 GLU GLU A . n A 1 247 TYR 247 247 247 TYR TYR A . n A 1 248 GLY 248 248 248 GLY GLY A . n A 1 249 TYR 249 249 249 TYR TYR A . n A 1 250 ASP 250 250 250 ASP ASP A . n A 1 251 VAL 251 251 251 VAL VAL A . n A 1 252 GLU 252 252 252 GLU GLU A . n A 1 253 LYS 253 253 253 LYS LYS A . n A 1 254 LEU 254 254 254 LEU LEU A . n A 1 255 ASN 255 255 255 ASN ASN A . n A 1 256 GLU 256 256 256 GLU GLU A . n A 1 257 LEU 257 257 257 LEU LEU A . n A 1 258 LYS 258 258 258 LYS LYS A . n A 1 259 ILE 259 259 259 ILE ILE A . n A 1 260 LYS 260 260 260 LYS LYS A . n A 1 261 ARG 261 261 261 ARG ARG A . n A 1 262 TYR 262 262 262 TYR TYR A . n A 1 263 ALA 263 263 263 ALA ALA A . n A 1 264 PRO 264 264 264 PRO PRO A . n A 1 265 GLY 265 265 265 GLY GLY A . n A 1 266 VAL 266 266 266 VAL VAL A . n A 1 267 TRP 267 267 267 TRP TRP A . n A 1 268 HIS 268 268 268 HIS HIS A . n A 1 269 VAL 269 269 269 VAL VAL A . n A 1 270 VAL 270 270 270 VAL VAL A . n A 1 271 LEU 271 271 271 LEU LEU A . n A 1 272 ASP 272 272 272 ASP ASP A . n A 1 273 LEU 273 273 273 LEU LEU A . n A 1 274 ARG 274 274 274 ARG ARG A . n A 1 275 VAL 275 275 275 VAL VAL A . n A 1 276 PHE 276 276 276 PHE PHE A . n A 1 277 LYS 277 277 277 LYS LYS A . n A 1 278 SER 278 278 278 SER SER A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 107 A MSE 107 ? MET SELENOMETHIONINE 2 A MSE 119 A MSE 119 ? MET SELENOMETHIONINE 3 A MSE 132 A MSE 132 ? MET SELENOMETHIONINE 4 A MSE 177 A MSE 177 ? MET SELENOMETHIONINE 5 A MSE 182 A MSE 182 ? MET SELENOMETHIONINE 6 A MSE 198 A MSE 198 ? MET SELENOMETHIONINE 7 A MSE 232 A MSE 232 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-10-20 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Version format compliance' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 20.3084 6.2093 -2.5071 0.0422 0.0472 0.0812 0.0043 0.0297 0.0262 2.8629 4.0972 2.0359 0.9133 -0.2598 1.0289 0.0068 -0.0024 -0.0276 -0.1489 0.0428 -0.4568 -0.0198 0.1763 -0.0497 'X-RAY DIFFRACTION' 2 ? refined 3.0826 3.4453 2.8430 0.0334 0.0562 0.0617 -0.0116 -0.0243 -0.0104 1.2639 3.1975 2.8636 0.3293 -0.9304 0.6588 0.0844 0.0789 -0.0256 0.0266 -0.1479 0.1883 0.0395 -0.2122 0.0635 'X-RAY DIFFRACTION' 3 ? refined 6.4694 14.0508 27.2207 0.3832 0.1728 0.0283 -0.1927 0.0315 0.0180 1.6385 0.3285 8.4662 0.1698 1.9701 1.5154 -0.1587 0.0046 0.0801 -0.0076 0.0209 0.0245 -0.5620 0.4778 0.1379 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 191 ? ? A 278 ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 111 ? ? A 190 ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 19 ? ? A 110 ? ? ? ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SBC-Collect 'data collection' . ? 1 HKL-3000 phasing . ? 2 SHELXE 'model building' . ? 3 SOLVE phasing . ? 4 RESOLVE 'model building' . ? 5 ARP/wARP 'model building' . ? 6 REFMAC refinement 5.5.0102 ? 7 HKL-2000 'data reduction' . ? 8 HKL-2000 'data scaling' . ? 9 RESOLVE phasing . ? 10 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 ND2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 225 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 314 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.09 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 17 ? ? -144.69 -25.82 2 1 MSE A 198 ? ? -116.50 67.02 3 1 LYS A 277 ? ? -68.21 -173.50 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 28 ? CG ? A LYS 28 CG 2 1 Y 1 A LYS 28 ? CD ? A LYS 28 CD 3 1 Y 1 A LYS 28 ? CE ? A LYS 28 CE 4 1 Y 1 A LYS 28 ? NZ ? A LYS 28 NZ 5 1 Y 1 A GLU 44 ? CG ? A GLU 44 CG 6 1 Y 1 A GLU 44 ? CD ? A GLU 44 CD 7 1 Y 1 A GLU 44 ? OE1 ? A GLU 44 OE1 8 1 Y 1 A GLU 44 ? OE2 ? A GLU 44 OE2 9 1 Y 1 A LYS 68 ? CG ? A LYS 68 CG 10 1 Y 1 A LYS 68 ? CD ? A LYS 68 CD 11 1 Y 1 A LYS 68 ? CE ? A LYS 68 CE 12 1 Y 1 A LYS 68 ? NZ ? A LYS 68 NZ 13 1 Y 1 A TYR 80 ? CG ? A TYR 80 CG 14 1 Y 1 A TYR 80 ? CD1 ? A TYR 80 CD1 15 1 Y 1 A TYR 80 ? CD2 ? A TYR 80 CD2 16 1 Y 1 A TYR 80 ? CE1 ? A TYR 80 CE1 17 1 Y 1 A TYR 80 ? CE2 ? A TYR 80 CE2 18 1 Y 1 A TYR 80 ? CZ ? A TYR 80 CZ 19 1 Y 1 A TYR 80 ? OH ? A TYR 80 OH # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A ARG 2 ? A ARG 2 3 1 Y 1 A THR 3 ? A THR 3 4 1 Y 1 A GLN 4 ? A GLN 4 5 1 Y 1 A GLY 5 ? A GLY 5 6 1 Y 1 A ARG 42 ? A ARG 42 7 1 Y 1 A HIS 70 ? A HIS 70 8 1 Y 1 A ILE 71 ? A ILE 71 9 1 Y 1 A HIS 72 ? A HIS 72 10 1 Y 1 A GLY 73 ? A GLY 73 11 1 Y 1 A GLU 74 ? A GLU 74 12 1 Y 1 A THR 75 ? A THR 75 13 1 Y 1 A ARG 76 ? A ARG 76 14 1 Y 1 A LYS 77 ? A LYS 77 15 1 Y 1 A PRO 78 ? A PRO 78 16 1 Y 1 A ASP 79 ? A ASP 79 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 280 280 HOH HOH A . B 2 HOH 2 281 281 HOH HOH A . B 2 HOH 3 282 282 HOH HOH A . B 2 HOH 4 283 283 HOH HOH A . B 2 HOH 5 284 284 HOH HOH A . B 2 HOH 6 285 285 HOH HOH A . B 2 HOH 7 286 286 HOH HOH A . B 2 HOH 8 287 287 HOH HOH A . B 2 HOH 9 288 288 HOH HOH A . B 2 HOH 10 289 289 HOH HOH A . B 2 HOH 11 290 290 HOH HOH A . B 2 HOH 12 291 291 HOH HOH A . B 2 HOH 13 292 292 HOH HOH A . B 2 HOH 14 293 293 HOH HOH A . B 2 HOH 15 294 294 HOH HOH A . B 2 HOH 16 295 295 HOH HOH A . B 2 HOH 17 296 296 HOH HOH A . B 2 HOH 18 297 297 HOH HOH A . B 2 HOH 19 298 298 HOH HOH A . B 2 HOH 20 299 299 HOH HOH A . B 2 HOH 21 300 300 HOH HOH A . B 2 HOH 22 301 301 HOH HOH A . B 2 HOH 23 302 302 HOH HOH A . B 2 HOH 24 303 303 HOH HOH A . B 2 HOH 25 304 304 HOH HOH A . B 2 HOH 26 305 305 HOH HOH A . B 2 HOH 27 306 306 HOH HOH A . B 2 HOH 28 307 307 HOH HOH A . B 2 HOH 29 308 308 HOH HOH A . B 2 HOH 30 309 309 HOH HOH A . B 2 HOH 31 310 310 HOH HOH A . B 2 HOH 32 311 311 HOH HOH A . B 2 HOH 33 312 312 HOH HOH A . B 2 HOH 34 313 313 HOH HOH A . B 2 HOH 35 314 314 HOH HOH A . B 2 HOH 36 315 315 HOH HOH A . B 2 HOH 37 316 316 HOH HOH A . B 2 HOH 38 317 317 HOH HOH A . B 2 HOH 39 318 318 HOH HOH A . B 2 HOH 40 319 319 HOH HOH A . B 2 HOH 41 320 320 HOH HOH A . B 2 HOH 42 321 321 HOH HOH A . B 2 HOH 43 322 322 HOH HOH A . B 2 HOH 44 323 323 HOH HOH A . B 2 HOH 45 324 324 HOH HOH A . B 2 HOH 46 325 325 HOH HOH A . B 2 HOH 47 326 326 HOH HOH A . B 2 HOH 48 327 327 HOH HOH A . B 2 HOH 49 328 328 HOH HOH A . B 2 HOH 50 329 329 HOH HOH A . B 2 HOH 51 330 330 HOH HOH A . B 2 HOH 52 331 331 HOH HOH A . B 2 HOH 53 332 332 HOH HOH A . B 2 HOH 54 333 333 HOH HOH A . B 2 HOH 55 334 334 HOH HOH A . B 2 HOH 56 335 335 HOH HOH A . B 2 HOH 57 336 336 HOH HOH A . B 2 HOH 58 337 337 HOH HOH A . B 2 HOH 59 338 338 HOH HOH A . B 2 HOH 60 339 339 HOH HOH A . B 2 HOH 61 340 340 HOH HOH A . B 2 HOH 62 341 341 HOH HOH A . B 2 HOH 63 344 344 HOH HOH A . B 2 HOH 64 345 345 HOH HOH A . B 2 HOH 65 356 356 HOH HOH A . B 2 HOH 66 357 357 HOH HOH A . B 2 HOH 67 358 358 HOH HOH A . B 2 HOH 68 359 359 HOH HOH A . B 2 HOH 69 360 360 HOH HOH A . B 2 HOH 70 367 367 HOH HOH A . B 2 HOH 71 368 368 HOH HOH A . B 2 HOH 72 369 369 HOH HOH A . B 2 HOH 73 372 372 HOH HOH A . B 2 HOH 74 373 373 HOH HOH A . B 2 HOH 75 376 376 HOH HOH A . B 2 HOH 76 377 377 HOH HOH A . B 2 HOH 77 378 378 HOH HOH A . B 2 HOH 78 379 379 HOH HOH A . B 2 HOH 79 380 380 HOH HOH A . B 2 HOH 80 381 381 HOH HOH A . B 2 HOH 81 382 382 HOH HOH A . B 2 HOH 82 383 383 HOH HOH A . B 2 HOH 83 384 384 HOH HOH A . B 2 HOH 84 385 385 HOH HOH A . B 2 HOH 85 386 386 HOH HOH A . B 2 HOH 86 387 387 HOH HOH A . B 2 HOH 87 388 388 HOH HOH A . B 2 HOH 88 389 389 HOH HOH A . B 2 HOH 89 390 390 HOH HOH A . B 2 HOH 90 391 391 HOH HOH A . B 2 HOH 91 392 392 HOH HOH A . B 2 HOH 92 393 393 HOH HOH A . B 2 HOH 93 394 394 HOH HOH A . #