data_3KOL # _entry.id 3KOL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.338 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3KOL RCSB RCSB056251 WWPDB D_1000056251 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id NYSGXRC-11005o _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3KOL _pdbx_database_status.recvd_initial_deposition_date 2009-11-13 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Eswaramoorthy, S.' 1 ? 'Swaminathan, S.' 2 ? 'Burley, S.K.' 3 0000-0002-2487-9713 'New York SGX Research Center for Structural Genomics (NYSGXRC)' 4 ? # _citation.id primary _citation.title 'Crystal structure of a glyoxalase/dioxygenase from Nostoc punctiforme' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Eswaramoorthy, S.' 1 ? primary 'Burley, S.K.' 2 0000-0002-2487-9713 primary 'Swaminathan, S.' 3 ? # _cell.entry_id 3KOL _cell.length_a 50.382 _cell.length_b 50.382 _cell.length_c 138.026 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3KOL _symmetry.space_group_name_H-M 'P 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 91 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Glyoxalase/bleomycin resistance protein/dioxygenase' 17163.879 1 ? ? ? ? 2 non-polymer syn 'COBALT (II) ION' 58.933 2 ? ? ? ? 3 water nat water 18.015 100 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Oxidoreductase # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SLSSTQSVNSVLAPGNLRKVHHIALNVQD(MSE)QASRYFYGTILGLHELTDDEVPATLTELVASGKVANFITPDGTILD LFGEPELSPPDPNPEKTFTRAYHLAFDIDPQLFDRAVTVIGENKIAIAHGPVTRPTGRGVYFYDPDGF(MSE)IEIRCDP EAEG ; _entity_poly.pdbx_seq_one_letter_code_can ;SLSSTQSVNSVLAPGNLRKVHHIALNVQDMQASRYFYGTILGLHELTDDEVPATLTELVASGKVANFITPDGTILDLFGE PELSPPDPNPEKTFTRAYHLAFDIDPQLFDRAVTVIGENKIAIAHGPVTRPTGRGVYFYDPDGFMIEIRCDPEAEG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGXRC-11005o # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LEU n 1 3 SER n 1 4 SER n 1 5 THR n 1 6 GLN n 1 7 SER n 1 8 VAL n 1 9 ASN n 1 10 SER n 1 11 VAL n 1 12 LEU n 1 13 ALA n 1 14 PRO n 1 15 GLY n 1 16 ASN n 1 17 LEU n 1 18 ARG n 1 19 LYS n 1 20 VAL n 1 21 HIS n 1 22 HIS n 1 23 ILE n 1 24 ALA n 1 25 LEU n 1 26 ASN n 1 27 VAL n 1 28 GLN n 1 29 ASP n 1 30 MSE n 1 31 GLN n 1 32 ALA n 1 33 SER n 1 34 ARG n 1 35 TYR n 1 36 PHE n 1 37 TYR n 1 38 GLY n 1 39 THR n 1 40 ILE n 1 41 LEU n 1 42 GLY n 1 43 LEU n 1 44 HIS n 1 45 GLU n 1 46 LEU n 1 47 THR n 1 48 ASP n 1 49 ASP n 1 50 GLU n 1 51 VAL n 1 52 PRO n 1 53 ALA n 1 54 THR n 1 55 LEU n 1 56 THR n 1 57 GLU n 1 58 LEU n 1 59 VAL n 1 60 ALA n 1 61 SER n 1 62 GLY n 1 63 LYS n 1 64 VAL n 1 65 ALA n 1 66 ASN n 1 67 PHE n 1 68 ILE n 1 69 THR n 1 70 PRO n 1 71 ASP n 1 72 GLY n 1 73 THR n 1 74 ILE n 1 75 LEU n 1 76 ASP n 1 77 LEU n 1 78 PHE n 1 79 GLY n 1 80 GLU n 1 81 PRO n 1 82 GLU n 1 83 LEU n 1 84 SER n 1 85 PRO n 1 86 PRO n 1 87 ASP n 1 88 PRO n 1 89 ASN n 1 90 PRO n 1 91 GLU n 1 92 LYS n 1 93 THR n 1 94 PHE n 1 95 THR n 1 96 ARG n 1 97 ALA n 1 98 TYR n 1 99 HIS n 1 100 LEU n 1 101 ALA n 1 102 PHE n 1 103 ASP n 1 104 ILE n 1 105 ASP n 1 106 PRO n 1 107 GLN n 1 108 LEU n 1 109 PHE n 1 110 ASP n 1 111 ARG n 1 112 ALA n 1 113 VAL n 1 114 THR n 1 115 VAL n 1 116 ILE n 1 117 GLY n 1 118 GLU n 1 119 ASN n 1 120 LYS n 1 121 ILE n 1 122 ALA n 1 123 ILE n 1 124 ALA n 1 125 HIS n 1 126 GLY n 1 127 PRO n 1 128 VAL n 1 129 THR n 1 130 ARG n 1 131 PRO n 1 132 THR n 1 133 GLY n 1 134 ARG n 1 135 GLY n 1 136 VAL n 1 137 TYR n 1 138 PHE n 1 139 TYR n 1 140 ASP n 1 141 PRO n 1 142 ASP n 1 143 GLY n 1 144 PHE n 1 145 MSE n 1 146 ILE n 1 147 GLU n 1 148 ILE n 1 149 ARG n 1 150 CYS n 1 151 ASP n 1 152 PRO n 1 153 GLU n 1 154 ALA n 1 155 GLU n 1 156 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Npun_R6391 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 29133 / PCC 73102' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Nostoc punctiforme PCC 73102' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 63737 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B2IY64_NOSP7 _struct_ref.pdbx_db_accession B2IY64 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LSSTQSVNSVLAPGNLRKVHHIALNVQDMQASRYFYGTILGLHELTDDEVPATLTELVASGKVANFITPDGTILDLFGEP ELSPPDPNPEKTFTRAYHLAFDIDPQLFDRAVTVIGENKIAIAHGPVTRPTGRGVYFYDPDGFMIEIRCDPEA ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3KOL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 154 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B2IY64 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 154 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 154 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3KOL SER A 1 ? UNP B2IY64 ? ? 'expression tag' 1 1 1 3KOL GLU A 155 ? UNP B2IY64 ? ? 'expression tag' 155 2 1 3KOL GLY A 156 ? UNP B2IY64 ? ? 'expression tag' 156 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CO non-polymer . 'COBALT (II) ION' ? 'Co 2' 58.933 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3KOL _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.55 _exptl_crystal.density_percent_sol 51.79 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details 'Ammonium Sulfate; MES pH 6.5; Cobalt (II) Chloride hexahydrate, VAPOR DIFFUSION, SITTING DROP, temperature 290K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2009-11-11 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9793 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X29A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X29A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9793 # _reflns.entry_id 3KOL _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 1.9 _reflns.number_obs 14757 _reflns.number_all 14757 _reflns.percent_possible_obs 99.6 _reflns.pdbx_Rmerge_I_obs 0.095 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 13.8 _reflns.B_iso_Wilson_estimate 17.35 _reflns.pdbx_redundancy 54.8 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.9 _reflns_shell.d_res_low 1.93 _reflns_shell.percent_possible_all 99.3 _reflns_shell.Rmerge_I_obs 0.357 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 55.5 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 723 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3KOL _refine.ls_number_reflns_obs 14540 _refine.ls_number_reflns_all 14540 _refine.pdbx_ls_sigma_I 0.0 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50.0 _refine.ls_d_res_high 1.9 _refine.ls_percent_reflns_obs 98.3 _refine.ls_R_factor_obs 0.213 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.213 _refine.ls_R_factor_R_free 0.234 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 1163 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 21.7 _refine.aniso_B[1][1] 2.03 _refine.aniso_B[2][2] 2.03 _refine.aniso_B[3][3] -4.06 _refine.aniso_B[1][2] 0.0 _refine.aniso_B[1][3] 0.0 _refine.aniso_B[2][3] 0.0 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3KOL _refine_analyze.Luzzati_coordinate_error_obs 0.22 _refine_analyze.Luzzati_sigma_a_obs 0.08 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.25 _refine_analyze.Luzzati_sigma_a_free 0.13 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1136 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 100 _refine_hist.number_atoms_total 1238 _refine_hist.d_res_high 1.9 _refine_hist.d_res_low 50.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.005 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.4 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_deg 24.2 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_deg 0.74 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.d_res_high 1.9 _refine_ls_shell.d_res_low 2.02 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.R_factor_R_work 0.207 _refine_ls_shell.percent_reflns_obs 95.0 _refine_ls_shell.R_factor_R_free 0.264 _refine_ls_shell.R_factor_R_free_error 0.021 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 162 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 2137 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3KOL _struct.title 'Crystal structure of a glyoxalase/dioxygenase from Nostoc punctiforme' _struct.pdbx_descriptor 'Glyoxalase/bleomycin resistance protein/dioxygenase' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3KOL _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;metal ion binding, bleomycin resistance, NYSGXRC, PSI2, Dioxygenase, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 29 ? GLY A 38 ? ASP A 29 GLY A 38 1 ? 10 HELX_P HELX_P2 2 LEU A 55 ? SER A 61 ? LEU A 55 SER A 61 1 ? 7 HELX_P HELX_P3 3 ASP A 105 ? GLN A 107 ? ASP A 105 GLN A 107 5 ? 3 HELX_P HELX_P4 4 LEU A 108 ? ASN A 119 ? LEU A 108 ASN A 119 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A MSE 30 C ? ? ? 1_555 A GLN 31 N ? ? A MSE 30 A GLN 31 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? A MSE 145 C ? ? ? 1_555 A ILE 146 N ? ? A MSE 145 A ILE 146 1_555 ? ? ? ? ? ? ? 1.330 ? ? metalc1 metalc ? ? A HIS 44 NE2 ? ? ? 1_555 B CO . CO ? ? A HIS 44 A CO 301 1_555 ? ? ? ? ? ? ? 2.075 ? ? metalc2 metalc ? ? A HIS 99 NE2 ? ? ? 1_555 C CO . CO ? ? A HIS 99 A CO 302 1_555 ? ? ? ? ? ? ? 2.107 ? ? metalc3 metalc ? ? A GLU 147 OE1 ? ? ? 1_555 C CO . CO ? ? A GLU 147 A CO 302 1_555 ? ? ? ? ? ? ? 2.127 ? ? metalc4 metalc ? ? D HOH . O ? ? ? 1_555 C CO . CO ? ? A HOH 181 A CO 302 1_555 ? ? ? ? ? ? ? 2.209 ? ? metalc5 metalc ? ? D HOH . O ? ? ? 1_555 B CO . CO ? ? A HOH 183 A CO 301 1_555 ? ? ? ? ? ? ? 2.096 ? ? metalc6 metalc ? ? D HOH . O ? ? ? 1_555 B CO . CO ? ? A HOH 237 A CO 301 1_555 ? ? ? ? ? ? ? 2.022 ? ? metalc7 metalc ? ? D HOH . O ? ? ? 1_555 C CO . CO ? ? A HOH 238 A CO 302 1_555 ? ? ? ? ? ? ? 2.035 ? ? metalc8 metalc ? ? D HOH . O ? ? ? 1_555 C CO . CO ? ? A HOH 239 A CO 302 1_555 ? ? ? ? ? ? ? 2.221 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 126 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 126 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 127 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 127 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.03 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 22 ? VAL A 27 ? HIS A 22 VAL A 27 A 2 ILE A 74 ? GLY A 79 ? ILE A 74 GLY A 79 A 3 VAL A 64 ? ILE A 68 ? VAL A 64 ILE A 68 A 4 HIS A 44 ? GLU A 45 ? HIS A 44 GLU A 45 B 1 HIS A 99 ? ASP A 103 ? HIS A 99 ASP A 103 B 2 MSE A 145 ? CYS A 150 ? MSE A 145 CYS A 150 B 3 ARG A 134 ? TYR A 139 ? ARG A 134 TYR A 139 B 4 ILE A 123 ? THR A 129 ? ILE A 123 THR A 129 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 25 ? N LEU A 25 O PHE A 78 ? O PHE A 78 A 2 3 O LEU A 75 ? O LEU A 75 N PHE A 67 ? N PHE A 67 A 3 4 O ILE A 68 ? O ILE A 68 N HIS A 44 ? N HIS A 44 B 1 2 N PHE A 102 ? N PHE A 102 O GLU A 147 ? O GLU A 147 B 2 3 O ILE A 146 ? O ILE A 146 N PHE A 138 ? N PHE A 138 B 3 4 O TYR A 137 ? O TYR A 137 N HIS A 125 ? N HIS A 125 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CO 301 ? 6 'BINDING SITE FOR RESIDUE CO A 301' AC2 Software A CO 302 ? 6 'BINDING SITE FOR RESIDUE CO A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HIS A 44 ? HIS A 44 . ? 1_555 ? 2 AC1 6 HIS A 44 ? HIS A 44 . ? 8_665 ? 3 AC1 6 HOH D . ? HOH A 183 . ? 1_555 ? 4 AC1 6 HOH D . ? HOH A 183 . ? 8_665 ? 5 AC1 6 HOH D . ? HOH A 237 . ? 8_665 ? 6 AC1 6 HOH D . ? HOH A 237 . ? 1_555 ? 7 AC2 6 HIS A 22 ? HIS A 22 . ? 5_655 ? 8 AC2 6 HIS A 99 ? HIS A 99 . ? 1_555 ? 9 AC2 6 GLU A 147 ? GLU A 147 . ? 1_555 ? 10 AC2 6 HOH D . ? HOH A 181 . ? 1_555 ? 11 AC2 6 HOH D . ? HOH A 238 . ? 1_555 ? 12 AC2 6 HOH D . ? HOH A 239 . ? 1_555 ? # _database_PDB_matrix.entry_id 3KOL _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3KOL _atom_sites.fract_transf_matrix[1][1] 0.019848 _atom_sites.fract_transf_matrix[1][2] -0.000000 _atom_sites.fract_transf_matrix[1][3] -0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019848 _atom_sites.fract_transf_matrix[2][3] -0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007245 _atom_sites.fract_transf_vector[1] -0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] -0.00000 # loop_ _atom_type.symbol C CO N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 LEU 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 THR 5 5 ? ? ? A . n A 1 6 GLN 6 6 ? ? ? A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 MSE 30 30 30 MSE MSE A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 PRO 131 131 ? ? ? A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 MSE 145 145 145 MSE MSE A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 CYS 150 150 150 CYS CYS A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 PRO 152 152 152 PRO PRO A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 ALA 154 154 ? ? ? A . n A 1 155 GLU 155 155 ? ? ? A . n A 1 156 GLY 156 156 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'New York SGX Research Center for Structural Genomics' _pdbx_SG_project.initial_of_center NYSGXRC # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CO 1 301 301 CO CO2 A . C 2 CO 1 302 302 CO CO2 A . D 3 HOH 1 157 1 HOH TIP A . D 3 HOH 2 158 2 HOH TIP A . D 3 HOH 3 159 3 HOH TIP A . D 3 HOH 4 160 4 HOH TIP A . D 3 HOH 5 161 5 HOH TIP A . D 3 HOH 6 162 6 HOH TIP A . D 3 HOH 7 163 7 HOH TIP A . D 3 HOH 8 164 8 HOH TIP A . D 3 HOH 9 165 9 HOH TIP A . D 3 HOH 10 166 10 HOH TIP A . D 3 HOH 11 167 11 HOH TIP A . D 3 HOH 12 168 12 HOH TIP A . D 3 HOH 13 169 13 HOH TIP A . D 3 HOH 14 170 14 HOH TIP A . D 3 HOH 15 171 15 HOH TIP A . D 3 HOH 16 172 16 HOH TIP A . D 3 HOH 17 173 17 HOH TIP A . D 3 HOH 18 174 18 HOH TIP A . D 3 HOH 19 175 19 HOH TIP A . D 3 HOH 20 176 20 HOH TIP A . D 3 HOH 21 177 21 HOH TIP A . D 3 HOH 22 178 22 HOH TIP A . D 3 HOH 23 179 23 HOH TIP A . D 3 HOH 24 180 24 HOH TIP A . D 3 HOH 25 181 25 HOH TIP A . D 3 HOH 26 182 26 HOH TIP A . D 3 HOH 27 183 27 HOH TIP A . D 3 HOH 28 184 28 HOH TIP A . D 3 HOH 29 185 29 HOH TIP A . D 3 HOH 30 186 30 HOH TIP A . D 3 HOH 31 187 31 HOH TIP A . D 3 HOH 32 188 32 HOH TIP A . D 3 HOH 33 189 33 HOH TIP A . D 3 HOH 34 190 34 HOH TIP A . D 3 HOH 35 191 35 HOH TIP A . D 3 HOH 36 192 36 HOH TIP A . D 3 HOH 37 193 37 HOH TIP A . D 3 HOH 38 194 38 HOH TIP A . D 3 HOH 39 195 39 HOH TIP A . D 3 HOH 40 196 40 HOH TIP A . D 3 HOH 41 197 41 HOH TIP A . D 3 HOH 42 198 42 HOH TIP A . D 3 HOH 43 199 43 HOH TIP A . D 3 HOH 44 200 44 HOH TIP A . D 3 HOH 45 201 45 HOH TIP A . D 3 HOH 46 202 46 HOH TIP A . D 3 HOH 47 203 47 HOH TIP A . D 3 HOH 48 204 48 HOH TIP A . D 3 HOH 49 205 49 HOH TIP A . D 3 HOH 50 206 50 HOH TIP A . D 3 HOH 51 207 51 HOH TIP A . D 3 HOH 52 208 52 HOH TIP A . D 3 HOH 53 209 53 HOH TIP A . D 3 HOH 54 210 54 HOH TIP A . D 3 HOH 55 211 55 HOH TIP A . D 3 HOH 56 212 56 HOH TIP A . D 3 HOH 57 213 57 HOH TIP A . D 3 HOH 58 214 58 HOH TIP A . D 3 HOH 59 215 59 HOH TIP A . D 3 HOH 60 216 60 HOH TIP A . D 3 HOH 61 217 61 HOH TIP A . D 3 HOH 62 218 62 HOH TIP A . D 3 HOH 63 219 63 HOH TIP A . D 3 HOH 64 220 64 HOH TIP A . D 3 HOH 65 221 65 HOH TIP A . D 3 HOH 66 222 66 HOH TIP A . D 3 HOH 67 223 67 HOH TIP A . D 3 HOH 68 224 68 HOH TIP A . D 3 HOH 69 225 69 HOH TIP A . D 3 HOH 70 226 70 HOH TIP A . D 3 HOH 71 227 71 HOH TIP A . D 3 HOH 72 228 72 HOH TIP A . D 3 HOH 73 229 73 HOH TIP A . D 3 HOH 74 230 74 HOH TIP A . D 3 HOH 75 231 75 HOH TIP A . D 3 HOH 76 232 76 HOH TIP A . D 3 HOH 77 233 77 HOH TIP A . D 3 HOH 78 234 78 HOH TIP A . D 3 HOH 79 235 79 HOH TIP A . D 3 HOH 80 236 80 HOH TIP A . D 3 HOH 81 237 81 HOH TIP A . D 3 HOH 82 238 82 HOH TIP A . D 3 HOH 83 239 83 HOH TIP A . D 3 HOH 84 240 84 HOH TIP A . D 3 HOH 85 241 85 HOH TIP A . D 3 HOH 86 242 86 HOH TIP A . D 3 HOH 87 243 87 HOH TIP A . D 3 HOH 88 244 88 HOH TIP A . D 3 HOH 89 245 89 HOH TIP A . D 3 HOH 90 246 90 HOH TIP A . D 3 HOH 91 247 91 HOH TIP A . D 3 HOH 92 248 92 HOH TIP A . D 3 HOH 93 249 93 HOH TIP A . D 3 HOH 94 250 94 HOH TIP A . D 3 HOH 95 251 95 HOH TIP A . D 3 HOH 96 252 96 HOH TIP A . D 3 HOH 97 253 97 HOH TIP A . D 3 HOH 98 254 98 HOH TIP A . D 3 HOH 99 255 99 HOH TIP A . D 3 HOH 100 256 100 HOH TIP A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 30 A MSE 30 ? MET SELENOMETHIONINE 2 A MSE 145 A MSE 145 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6800 ? 1 MORE -53 ? 1 'SSA (A^2)' 13510 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 50.3820000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A CO 301 ? B CO . 2 1 A HOH 246 ? D HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 44 ? A HIS 44 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 O ? D HOH . ? A HOH 183 ? 1_555 174.5 ? 2 NE2 ? A HIS 44 ? A HIS 44 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 O ? D HOH . ? A HOH 237 ? 1_555 94.3 ? 3 O ? D HOH . ? A HOH 183 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 O ? D HOH . ? A HOH 237 ? 1_555 86.3 ? 4 NE2 ? A HIS 99 ? A HIS 99 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OE1 ? A GLU 147 ? A GLU 147 ? 1_555 88.5 ? 5 NE2 ? A HIS 99 ? A HIS 99 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 O ? D HOH . ? A HOH 181 ? 1_555 96.7 ? 6 OE1 ? A GLU 147 ? A GLU 147 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 O ? D HOH . ? A HOH 181 ? 1_555 168.8 ? 7 NE2 ? A HIS 99 ? A HIS 99 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 O ? D HOH . ? A HOH 238 ? 1_555 91.2 ? 8 OE1 ? A GLU 147 ? A GLU 147 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 O ? D HOH . ? A HOH 238 ? 1_555 93.2 ? 9 O ? D HOH . ? A HOH 181 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 O ? D HOH . ? A HOH 238 ? 1_555 76.9 ? 10 NE2 ? A HIS 99 ? A HIS 99 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 O ? D HOH . ? A HOH 239 ? 1_555 168.0 ? 11 OE1 ? A GLU 147 ? A GLU 147 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 O ? D HOH . ? A HOH 239 ? 1_555 89.1 ? 12 O ? D HOH . ? A HOH 181 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 O ? D HOH . ? A HOH 239 ? 1_555 83.8 ? 13 O ? D HOH . ? A HOH 238 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 O ? D HOH . ? A HOH 239 ? 1_555 77.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-11-24 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-02-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' audit_author 2 3 'Structure model' citation_author 3 3 'Structure model' pdbx_struct_conn_angle 4 3 'Structure model' struct_conn 5 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_audit_author.identifier_ORCID' 2 3 'Structure model' '_citation_author.identifier_ORCID' 3 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 4 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 5 3 'Structure model' '_pdbx_struct_conn_angle.value' 6 3 'Structure model' '_struct_conn.pdbx_dist_value' 7 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 8 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 9 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 10 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 11 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 12 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 13 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 14 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 15 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 16 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 17 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 18 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 19 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 20 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CBASS 'data collection' . ? 1 SHELX 'model building' . ? 2 SHARP phasing . ? 3 CNS refinement 1.1 ? 4 HKL-2000 'data reduction' . ? 5 HKL-2000 'data scaling' . ? 6 SHELX phasing . ? 7 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 96 ? ? 83.41 -150.31 2 1 TYR A 98 ? ? -105.07 -62.75 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A LEU 2 ? A LEU 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A THR 5 ? A THR 5 6 1 Y 1 A GLN 6 ? A GLN 6 7 1 Y 1 A PRO 131 ? A PRO 131 8 1 Y 1 A ALA 154 ? A ALA 154 9 1 Y 1 A GLU 155 ? A GLU 155 10 1 Y 1 A GLY 156 ? A GLY 156 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COBALT (II) ION' CO 3 water HOH #