data_3KSP # _entry.id 3KSP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.365 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3KSP pdb_00003ksp 10.2210/pdb3ksp/pdb RCSB RCSB056399 ? ? WWPDB D_1000056399 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id 390842 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.SG_entry Y _pdbx_database_status.entry_id 3KSP _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-11-23 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Joint Center for Structural Genomics (JCSG)' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title ;Crystal structure of Calcium/calmodulin-dependent kinase II association domain (YP_001814158.1) from EXIGUOBACTERIUM SP. 255-15 at 2.59 A resolution ; _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # _citation_author.citation_id primary _citation_author.name 'Joint Center for Structural Genomics (JCSG)' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # _cell.entry_id 3KSP _cell.length_a 76.226 _cell.length_b 76.226 _cell.length_c 144.157 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.pdbx_unique_axis ? _cell.Z_PDB 12 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3KSP _symmetry.Int_Tables_number 179 _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Calcium/calmodulin-dependent kinase II association domain' 15403.238 1 ? ? ? ? 2 non-polymer syn '2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID' 207.290 1 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 4 water nat water 18.015 8 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;G(MSE)EPSAKHLQLQTLLSERHAYL(MSE)EGNREA(MSE)HQLLSSDFSFIDGQGRQFDAETYLDHYVDPDQIQWSNQ ISES(MSE)VVEVFETTALVQEIVEDHFSYGRS(MSE)YIGRFRSVSLYHWANEGWKWHFHQLTPLDPS ; _entity_poly.pdbx_seq_one_letter_code_can ;GMEPSAKHLQLQTLLSERHAYLMEGNREAMHQLLSSDFSFIDGQGRQFDAETYLDHYVDPDQIQWSNQISESMVVEVFET TALVQEIVEDHFSYGRSMYIGRFRSVSLYHWANEGWKWHFHQLTPLDPS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier 390842 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MSE n 1 3 GLU n 1 4 PRO n 1 5 SER n 1 6 ALA n 1 7 LYS n 1 8 HIS n 1 9 LEU n 1 10 GLN n 1 11 LEU n 1 12 GLN n 1 13 THR n 1 14 LEU n 1 15 LEU n 1 16 SER n 1 17 GLU n 1 18 ARG n 1 19 HIS n 1 20 ALA n 1 21 TYR n 1 22 LEU n 1 23 MSE n 1 24 GLU n 1 25 GLY n 1 26 ASN n 1 27 ARG n 1 28 GLU n 1 29 ALA n 1 30 MSE n 1 31 HIS n 1 32 GLN n 1 33 LEU n 1 34 LEU n 1 35 SER n 1 36 SER n 1 37 ASP n 1 38 PHE n 1 39 SER n 1 40 PHE n 1 41 ILE n 1 42 ASP n 1 43 GLY n 1 44 GLN n 1 45 GLY n 1 46 ARG n 1 47 GLN n 1 48 PHE n 1 49 ASP n 1 50 ALA n 1 51 GLU n 1 52 THR n 1 53 TYR n 1 54 LEU n 1 55 ASP n 1 56 HIS n 1 57 TYR n 1 58 VAL n 1 59 ASP n 1 60 PRO n 1 61 ASP n 1 62 GLN n 1 63 ILE n 1 64 GLN n 1 65 TRP n 1 66 SER n 1 67 ASN n 1 68 GLN n 1 69 ILE n 1 70 SER n 1 71 GLU n 1 72 SER n 1 73 MSE n 1 74 VAL n 1 75 VAL n 1 76 GLU n 1 77 VAL n 1 78 PHE n 1 79 GLU n 1 80 THR n 1 81 THR n 1 82 ALA n 1 83 LEU n 1 84 VAL n 1 85 GLN n 1 86 GLU n 1 87 ILE n 1 88 VAL n 1 89 GLU n 1 90 ASP n 1 91 HIS n 1 92 PHE n 1 93 SER n 1 94 TYR n 1 95 GLY n 1 96 ARG n 1 97 SER n 1 98 MSE n 1 99 TYR n 1 100 ILE n 1 101 GLY n 1 102 ARG n 1 103 PHE n 1 104 ARG n 1 105 SER n 1 106 VAL n 1 107 SER n 1 108 LEU n 1 109 TYR n 1 110 HIS n 1 111 TRP n 1 112 ALA n 1 113 ASN n 1 114 GLU n 1 115 GLY n 1 116 TRP n 1 117 LYS n 1 118 TRP n 1 119 HIS n 1 120 PHE n 1 121 HIS n 1 122 GLN n 1 123 LEU n 1 124 THR n 1 125 PRO n 1 126 LEU n 1 127 ASP n 1 128 PRO n 1 129 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Exig_1688 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSM 17290 / JCM 13490 / 255-15' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Exiguobacterium sibiricum 255-15' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 262543 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia Coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain HK100 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name SpeedET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B1YH80_EXIS2 _struct_ref.pdbx_db_accession B1YH80 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEPSAKHLQLQTLLSERHAYLMEGNREAMHQLLSSDFSFIDGQGRQFDAETYLDHYVDPDQIQWSNQISESMVVEVFETT ALVQEIVEDHFSYGRSMYIGRFRSVSLYHWANEGWKWHFHQLTPLDPS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3KSP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 129 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B1YH80 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 128 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 128 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 3KSP _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code B1YH80 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 NHE non-polymer . '2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID' 'N-CYCLOHEXYLTAURINE; CHES' 'C8 H17 N O3 S' 207.290 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.method 'X-RAY DIFFRACTION' _exptl.entry_id 3KSP # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 3.92 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 68.66 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 9.5 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.pdbx_details ;1.0000M sodium citrate, 0.1M CHES pH 9.5, 0.001 M Adenosine-5'-triphosphate (ATP), NANODROP, VAPOR DIFFUSION, SITTING DROP, temperature 277K ; _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 325 mm CCD' _diffrn_detector.details 'Flat mirror (vertical focusing)' _diffrn_detector.pdbx_collection_date 2009-07-08 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Single crystal Si(111) bent monochromator (horizontal focusing)' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.91162 1.0 2 0.97929 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.pdbx_synchrotron_beamline BL11-1 _diffrn_source.type 'SSRL BEAMLINE BL11-1' _diffrn_source.pdbx_wavelength_list 0.91162,0.97929 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.entry_id 3KSP _reflns.d_resolution_high 2.59 _reflns.d_resolution_low 28.831 _reflns.number_obs 8247 _reflns.pdbx_Rmerge_I_obs 0.049 _reflns.pdbx_netI_over_sigmaI 17.170 _reflns.percent_possible_obs 99.400 _reflns.B_iso_Wilson_estimate 76.251 _reflns.observed_criterion_sigma_I -3.00 _reflns.observed_criterion_sigma_F ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.60 2.69 5352 ? 1397 0.658 2.2 ? ? ? ? ? 99.90 1 1 2.69 2.80 5752 ? 1493 0.415 3.3 ? ? ? ? ? 99.60 2 1 2.80 2.93 5770 ? 1494 0.303 4.5 ? ? ? ? ? 99.70 3 1 2.93 3.08 5457 ? 1409 0.216 6.2 ? ? ? ? ? 99.40 4 1 3.08 3.27 5563 ? 1440 0.119 10.6 ? ? ? ? ? 99.80 5 1 3.27 3.52 5557 ? 1439 0.071 16.9 ? ? ? ? ? 99.60 6 1 3.52 3.88 5716 ? 1495 0.045 23.7 ? ? ? ? ? 99.40 7 1 3.88 4.43 5452 ? 1429 0.034 30.9 ? ? ? ? ? 99.00 8 1 4.43 5.57 5553 ? 1460 0.030 35.9 ? ? ? ? ? 99.30 9 1 5.57 28.831 5640 ? 1488 0.027 36.7 ? ? ? ? ? 98.20 10 1 # _refine.entry_id 3KSP _refine.ls_d_res_high 2.590 _refine.ls_d_res_low 28.831 _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.490 _refine.ls_number_reflns_obs 8207 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ;1. HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. 2. ATOM RECORDS CONTAIN RESIDUAL B FACTORS ONLY. 3. A MET-INHIBITION PROTOCOL WAS USED FOR SELENOMETHIONINE INCORPORATION DURING PROTEIN EXPRESSION. THE OCCUPANCY OF THE SE ATOMS IN THE MSE RESIDUES WAS REDUCED TO 0.75 FOR THE REDUCED SCATTERING POWER DUE TO PARTIAL S-MET INCORPORATION. 4. ETHYLENE GLYCOL (EDO) AND CHES (NHE) MOLECULES FROM THE CRYSTALLIZATION/CRYOPROTECTION SOLUTION ARE MODELED. ; _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.202 _refine.ls_R_factor_R_work 0.201 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.237 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 4.600 _refine.ls_number_reflns_R_free 379 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 44.582 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] -2.810 _refine.aniso_B[2][2] -2.810 _refine.aniso_B[3][3] 4.210 _refine.aniso_B[1][2] -1.400 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.955 _refine.correlation_coeff_Fo_to_Fc_free 0.945 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R 0.303 _refine.pdbx_overall_ESU_R_Free 0.235 _refine.overall_SU_ML 0.194 _refine.overall_SU_B 19.846 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.pdbx_solvent_vdw_probe_radii 1.400 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 83.75 _refine.B_iso_min 21.07 _refine.occupancy_max 1.00 _refine.occupancy_min 0.22 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_starting_model ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1061 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 17 _refine_hist.number_atoms_solvent 8 _refine_hist.number_atoms_total 1086 _refine_hist.d_res_high 2.590 _refine_hist.d_res_low 28.831 # loop_ _refine_ls_restr.type _refine_ls_restr.pdbx_refine_id _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 'X-RAY DIFFRACTION' 1138 0.014 0.021 ? ? r_bond_other_d 'X-RAY DIFFRACTION' 763 0.001 0.020 ? ? r_angle_refined_deg 'X-RAY DIFFRACTION' 1547 1.483 1.925 ? ? r_angle_other_deg 'X-RAY DIFFRACTION' 1849 0.870 3.000 ? ? r_dihedral_angle_1_deg 'X-RAY DIFFRACTION' 136 6.878 5.000 ? ? r_dihedral_angle_2_deg 'X-RAY DIFFRACTION' 64 39.040 24.219 ? ? r_dihedral_angle_3_deg 'X-RAY DIFFRACTION' 183 17.101 15.000 ? ? r_dihedral_angle_4_deg 'X-RAY DIFFRACTION' 6 12.794 15.000 ? ? r_chiral_restr 'X-RAY DIFFRACTION' 157 0.086 0.200 ? ? r_gen_planes_refined 'X-RAY DIFFRACTION' 1282 0.005 0.020 ? ? r_gen_planes_other 'X-RAY DIFFRACTION' 248 0.001 0.020 ? ? r_mcbond_it 'X-RAY DIFFRACTION' 656 0.506 1.500 ? ? r_mcbond_other 'X-RAY DIFFRACTION' 265 0.088 1.500 ? ? r_mcangle_it 'X-RAY DIFFRACTION' 1058 0.976 2.000 ? ? r_scbond_it 'X-RAY DIFFRACTION' 482 1.684 3.000 ? ? r_scangle_it 'X-RAY DIFFRACTION' 485 2.546 4.500 ? ? # _refine_ls_shell.d_res_high 2.590 _refine_ls_shell.d_res_low 2.657 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 100.000 _refine_ls_shell.number_reflns_R_work 547 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.310 _refine_ls_shell.R_factor_R_free 0.263 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 30 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 577 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3KSP _struct.title ;Crystal structure of a putative ca/calmodulin-dependent kinase ii association domain (exig_1688) from exiguobacterium sibiricum 255-15 at 2.59 A resolution ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.text ;Cystatin-like fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, unknown function ; _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.entry_id 3KSP # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details 'CRYSTAL PACKING ANALYSIS SUGGESTS THE ASSIGNMENT OF A DIMER AS THE SIGNIFICANT OLIGOMERIZATION STATE.' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 5 ? GLY A 25 ? SER A 4 GLY A 24 1 ? 21 HELX_P HELX_P2 2 ASN A 26 ? LEU A 33 ? ASN A 25 LEU A 32 1 ? 8 HELX_P HELX_P3 3 ASP A 49 ? VAL A 58 ? ASP A 48 VAL A 57 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLY 1 C ? ? ? 1_555 A MSE 2 N ? ? A GLY 0 A MSE 1 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale2 covale both ? A MSE 2 C ? ? ? 1_555 A GLU 3 N ? ? A MSE 1 A GLU 2 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale3 covale both ? A LEU 22 C ? ? ? 1_555 A MSE 23 N ? ? A LEU 21 A MSE 22 1_555 ? ? ? ? ? ? ? 1.341 ? ? covale4 covale both ? A MSE 23 C ? ? ? 1_555 A GLU 24 N ? ? A MSE 22 A GLU 23 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale5 covale both ? A ALA 29 C ? ? ? 1_555 A MSE 30 N ? ? A ALA 28 A MSE 29 1_555 ? ? ? ? ? ? ? 1.339 ? ? covale6 covale both ? A MSE 30 C ? ? ? 1_555 A HIS 31 N ? ? A MSE 29 A HIS 30 1_555 ? ? ? ? ? ? ? 1.341 ? ? covale7 covale both ? A SER 72 C ? ? ? 1_555 A MSE 73 N ? ? A SER 71 A MSE 72 1_555 ? ? ? ? ? ? ? 1.339 ? ? covale8 covale both ? A MSE 73 C ? ? ? 1_555 A VAL 74 N ? ? A MSE 72 A VAL 73 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale9 covale both ? A SER 97 C ? ? ? 1_555 A MSE 98 N ? ? A SER 96 A MSE 97 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale10 covale both ? A MSE 98 C ? ? ? 1_555 A TYR 99 N ? ? A MSE 97 A TYR 98 1_555 ? ? ? ? ? ? ? 1.336 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 47 ? PHE A 48 ? GLN A 46 PHE A 47 A 2 LEU A 34 ? ILE A 41 ? LEU A 33 ILE A 40 A 3 GLY A 115 ? LEU A 126 ? GLY A 114 LEU A 125 A 4 SER A 97 ? ALA A 112 ? SER A 96 ALA A 111 A 5 THR A 81 ? TYR A 94 ? THR A 80 TYR A 93 A 6 ILE A 63 ? VAL A 77 ? ILE A 62 VAL A 76 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 48 ? O PHE A 47 N PHE A 40 ? N PHE A 39 A 2 3 N SER A 35 ? N SER A 34 O TRP A 118 ? O TRP A 117 A 3 4 O HIS A 119 ? O HIS A 118 N LEU A 108 ? N LEU A 107 A 4 5 O SER A 105 ? O SER A 104 N GLU A 86 ? N GLU A 85 A 5 6 O GLN A 85 ? O GLN A 84 N VAL A 74 ? N VAL A 73 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A NHE 129 ? 8 'BINDING SITE FOR RESIDUE NHE A 129' AC2 Software A EDO 130 ? 3 'BINDING SITE FOR RESIDUE EDO A 130' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 GLY A 1 ? GLY A 0 . ? 8_666 ? 2 AC1 8 MSE A 2 ? MSE A 1 . ? 8_666 ? 3 AC1 8 ASP A 42 ? ASP A 41 . ? 1_555 ? 4 AC1 8 GLY A 43 ? GLY A 42 . ? 1_555 ? 5 AC1 8 GLN A 44 ? GLN A 43 . ? 1_555 ? 6 AC1 8 TYR A 57 ? TYR A 56 . ? 1_555 ? 7 AC1 8 TYR A 94 ? TYR A 93 . ? 1_555 ? 8 AC1 8 PHE A 103 ? PHE A 102 . ? 1_555 ? 9 AC2 3 TYR A 53 ? TYR A 52 . ? 1_555 ? 10 AC2 3 GLN A 68 ? GLN A 67 . ? 1_555 ? 11 AC2 3 ASP A 90 ? ASP A 89 . ? 1_555 ? # _atom_sites.entry_id 3KSP _atom_sites.fract_transf_matrix[1][1] 0.013119 _atom_sites.fract_transf_matrix[1][2] 0.007574 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015148 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006937 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 0 GLY GLY A . n A 1 2 MSE 2 1 1 MSE MSE A . n A 1 3 GLU 3 2 2 GLU GLU A . n A 1 4 PRO 4 3 3 PRO PRO A . n A 1 5 SER 5 4 4 SER SER A . n A 1 6 ALA 6 5 5 ALA ALA A . n A 1 7 LYS 7 6 6 LYS LYS A . n A 1 8 HIS 8 7 7 HIS HIS A . n A 1 9 LEU 9 8 8 LEU LEU A . n A 1 10 GLN 10 9 9 GLN GLN A . n A 1 11 LEU 11 10 10 LEU LEU A . n A 1 12 GLN 12 11 11 GLN GLN A . n A 1 13 THR 13 12 12 THR THR A . n A 1 14 LEU 14 13 13 LEU LEU A . n A 1 15 LEU 15 14 14 LEU LEU A . n A 1 16 SER 16 15 15 SER SER A . n A 1 17 GLU 17 16 16 GLU GLU A . n A 1 18 ARG 18 17 17 ARG ARG A . n A 1 19 HIS 19 18 18 HIS HIS A . n A 1 20 ALA 20 19 19 ALA ALA A . n A 1 21 TYR 21 20 20 TYR TYR A . n A 1 22 LEU 22 21 21 LEU LEU A . n A 1 23 MSE 23 22 22 MSE MSE A . n A 1 24 GLU 24 23 23 GLU GLU A . n A 1 25 GLY 25 24 24 GLY GLY A . n A 1 26 ASN 26 25 25 ASN ASN A . n A 1 27 ARG 27 26 26 ARG ARG A . n A 1 28 GLU 28 27 27 GLU GLU A . n A 1 29 ALA 29 28 28 ALA ALA A . n A 1 30 MSE 30 29 29 MSE MSE A . n A 1 31 HIS 31 30 30 HIS HIS A . n A 1 32 GLN 32 31 31 GLN GLN A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 LEU 34 33 33 LEU LEU A . n A 1 35 SER 35 34 34 SER SER A . n A 1 36 SER 36 35 35 SER SER A . n A 1 37 ASP 37 36 36 ASP ASP A . n A 1 38 PHE 38 37 37 PHE PHE A . n A 1 39 SER 39 38 38 SER SER A . n A 1 40 PHE 40 39 39 PHE PHE A . n A 1 41 ILE 41 40 40 ILE ILE A . n A 1 42 ASP 42 41 41 ASP ASP A . n A 1 43 GLY 43 42 42 GLY GLY A . n A 1 44 GLN 44 43 43 GLN GLN A . n A 1 45 GLY 45 44 44 GLY GLY A . n A 1 46 ARG 46 45 45 ARG ARG A . n A 1 47 GLN 47 46 46 GLN GLN A . n A 1 48 PHE 48 47 47 PHE PHE A . n A 1 49 ASP 49 48 48 ASP ASP A . n A 1 50 ALA 50 49 49 ALA ALA A . n A 1 51 GLU 51 50 50 GLU GLU A . n A 1 52 THR 52 51 51 THR THR A . n A 1 53 TYR 53 52 52 TYR TYR A . n A 1 54 LEU 54 53 53 LEU LEU A . n A 1 55 ASP 55 54 54 ASP ASP A . n A 1 56 HIS 56 55 55 HIS HIS A . n A 1 57 TYR 57 56 56 TYR TYR A . n A 1 58 VAL 58 57 57 VAL VAL A . n A 1 59 ASP 59 58 58 ASP ASP A . n A 1 60 PRO 60 59 59 PRO PRO A . n A 1 61 ASP 61 60 60 ASP ASP A . n A 1 62 GLN 62 61 61 GLN GLN A . n A 1 63 ILE 63 62 62 ILE ILE A . n A 1 64 GLN 64 63 63 GLN GLN A . n A 1 65 TRP 65 64 64 TRP TRP A . n A 1 66 SER 66 65 65 SER SER A . n A 1 67 ASN 67 66 66 ASN ASN A . n A 1 68 GLN 68 67 67 GLN GLN A . n A 1 69 ILE 69 68 68 ILE ILE A . n A 1 70 SER 70 69 69 SER SER A . n A 1 71 GLU 71 70 70 GLU GLU A . n A 1 72 SER 72 71 71 SER SER A . n A 1 73 MSE 73 72 72 MSE MSE A . n A 1 74 VAL 74 73 73 VAL VAL A . n A 1 75 VAL 75 74 74 VAL VAL A . n A 1 76 GLU 76 75 75 GLU GLU A . n A 1 77 VAL 77 76 76 VAL VAL A . n A 1 78 PHE 78 77 77 PHE PHE A . n A 1 79 GLU 79 78 78 GLU GLU A . n A 1 80 THR 80 79 79 THR THR A . n A 1 81 THR 81 80 80 THR THR A . n A 1 82 ALA 82 81 81 ALA ALA A . n A 1 83 LEU 83 82 82 LEU LEU A . n A 1 84 VAL 84 83 83 VAL VAL A . n A 1 85 GLN 85 84 84 GLN GLN A . n A 1 86 GLU 86 85 85 GLU GLU A . n A 1 87 ILE 87 86 86 ILE ILE A . n A 1 88 VAL 88 87 87 VAL VAL A . n A 1 89 GLU 89 88 88 GLU GLU A . n A 1 90 ASP 90 89 89 ASP ASP A . n A 1 91 HIS 91 90 90 HIS HIS A . n A 1 92 PHE 92 91 91 PHE PHE A . n A 1 93 SER 93 92 92 SER SER A . n A 1 94 TYR 94 93 93 TYR TYR A . n A 1 95 GLY 95 94 94 GLY GLY A . n A 1 96 ARG 96 95 95 ARG ARG A . n A 1 97 SER 97 96 96 SER SER A . n A 1 98 MSE 98 97 97 MSE MSE A . n A 1 99 TYR 99 98 98 TYR TYR A . n A 1 100 ILE 100 99 99 ILE ILE A . n A 1 101 GLY 101 100 100 GLY GLY A . n A 1 102 ARG 102 101 101 ARG ARG A . n A 1 103 PHE 103 102 102 PHE PHE A . n A 1 104 ARG 104 103 103 ARG ARG A . n A 1 105 SER 105 104 104 SER SER A . n A 1 106 VAL 106 105 105 VAL VAL A . n A 1 107 SER 107 106 106 SER SER A . n A 1 108 LEU 108 107 107 LEU LEU A . n A 1 109 TYR 109 108 108 TYR TYR A . n A 1 110 HIS 110 109 109 HIS HIS A . n A 1 111 TRP 111 110 110 TRP TRP A . n A 1 112 ALA 112 111 111 ALA ALA A . n A 1 113 ASN 113 112 112 ASN ASN A . n A 1 114 GLU 114 113 113 GLU GLU A . n A 1 115 GLY 115 114 114 GLY GLY A . n A 1 116 TRP 116 115 115 TRP TRP A . n A 1 117 LYS 117 116 116 LYS LYS A . n A 1 118 TRP 118 117 117 TRP TRP A . n A 1 119 HIS 119 118 118 HIS HIS A . n A 1 120 PHE 120 119 119 PHE PHE A . n A 1 121 HIS 121 120 120 HIS HIS A . n A 1 122 GLN 122 121 121 GLN GLN A . n A 1 123 LEU 123 122 122 LEU LEU A . n A 1 124 THR 124 123 123 THR THR A . n A 1 125 PRO 125 124 124 PRO PRO A . n A 1 126 LEU 126 125 125 LEU LEU A . n A 1 127 ASP 127 126 126 ASP ASP A . n A 1 128 PRO 128 127 127 PRO PRO A . n A 1 129 SER 129 128 128 SER SER A . n # _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Joint Center for Structural Genomics' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center JCSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NHE 1 129 1 NHE NHE A . C 3 EDO 1 130 2 EDO EDO A . D 4 HOH 1 131 3 HOH HOH A . D 4 HOH 2 132 4 HOH HOH A . D 4 HOH 3 133 5 HOH HOH A . D 4 HOH 4 134 6 HOH HOH A . D 4 HOH 5 135 7 HOH HOH A . D 4 HOH 6 136 8 HOH HOH A . D 4 HOH 7 137 9 HOH HOH A . D 4 HOH 8 138 10 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 2 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 23 A MSE 22 ? MET SELENOMETHIONINE 3 A MSE 30 A MSE 29 ? MET SELENOMETHIONINE 4 A MSE 73 A MSE 72 ? MET SELENOMETHIONINE 5 A MSE 98 A MSE 97 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2650 ? 1 MORE 0 ? 1 'SSA (A^2)' 13630 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_565 x,x-y+1,-z+5/6 0.5000000000 0.8660254038 0.0000000000 -38.1130000000 0.8660254038 -0.5000000000 0.0000000000 66.0136524289 0.0000000000 0.0000000000 -1.0000000000 120.1308333333 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-12-29 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-11-01 4 'Structure model' 1 3 2019-07-17 5 'Structure model' 1 4 2023-02-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' software 3 4 'Structure model' struct_conn 4 5 'Structure model' database_2 5 5 'Structure model' struct_conn 6 5 'Structure model' struct_ref_seq_dif 7 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.classification' 2 3 'Structure model' '_software.name' 3 4 'Structure model' '_software.classification' 4 4 'Structure model' '_software.contact_author' 5 4 'Structure model' '_software.contact_author_email' 6 4 'Structure model' '_software.language' 7 4 'Structure model' '_software.location' 8 4 'Structure model' '_software.name' 9 4 'Structure model' '_software.type' 10 4 'Structure model' '_software.version' 11 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 12 5 'Structure model' '_database_2.pdbx_DOI' 13 5 'Structure model' '_database_2.pdbx_database_accession' 14 5 'Structure model' '_struct_conn.pdbx_dist_value' 15 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 16 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 17 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 18 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 19 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 20 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 21 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 22 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 23 5 'Structure model' '_struct_ref_seq_dif.details' 24 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 25 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 26 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 2.1980 _pdbx_refine_tls.origin_y 32.0540 _pdbx_refine_tls.origin_z 63.9780 _pdbx_refine_tls.T[1][1] 0.2909 _pdbx_refine_tls.T[2][2] 0.3623 _pdbx_refine_tls.T[3][3] 0.4290 _pdbx_refine_tls.T[1][2] 0.0887 _pdbx_refine_tls.T[1][3] 0.0837 _pdbx_refine_tls.T[2][3] 0.1740 _pdbx_refine_tls.L[1][1] 6.5398 _pdbx_refine_tls.L[2][2] 3.2542 _pdbx_refine_tls.L[3][3] 2.9774 _pdbx_refine_tls.L[1][2] 0.6614 _pdbx_refine_tls.L[1][3] 0.0759 _pdbx_refine_tls.L[2][3] -1.4297 _pdbx_refine_tls.S[1][1] -0.2038 _pdbx_refine_tls.S[2][2] -0.2202 _pdbx_refine_tls.S[3][3] 0.4241 _pdbx_refine_tls.S[1][2] -0.2094 _pdbx_refine_tls.S[1][3] -1.0536 _pdbx_refine_tls.S[2][3] -0.4432 _pdbx_refine_tls.S[2][1] -0.2472 _pdbx_refine_tls.S[3][1] 0.3040 _pdbx_refine_tls.S[3][2] 0.4732 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 0 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 128 _pdbx_refine_tls_group.selection_details ? _pdbx_refine_tls_group.beg_label_asym_id . _pdbx_refine_tls_group.beg_label_seq_id . _pdbx_refine_tls_group.end_label_asym_id . _pdbx_refine_tls_group.end_label_seq_id . _pdbx_refine_tls_group.selection ? # _phasing.method MAD # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal REFMAC 5.5.0053 ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 1 PHENIX . ? package 'P.D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 2 SOLVE . ? program 'Tom Terwilliger' terwilliger@LANL.gov phasing http://www.solve.lanl.gov/ ? ? 3 MolProbity 3beta29 ? package 'D.C. & J.S. Richardson lab' molprobity@kinemage.biochem.duke.edu 'model building' http://kinemage.biochem.duke.edu/molprobity/ ? ? 4 XSCALE . ? package 'Wolfgang Kabsch' ? 'data scaling' http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ? ? 5 PDB_EXTRACT 3.006 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 6 XDS . ? ? ? ? 'data reduction' ? ? ? 7 # _pdbx_entry_details.entry_id 3KSP _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THIS CONSTRUCT WAS EXPRESSED WITH A PURIFICATION TAG MGSDKIHHHHHHENLYFQG. THE TAG WAS REMOVED WITH TEV PROTEASE LEAVING ONLY A GLYCINE (0) FOLLOWED BY THE TARGET SEQUENCE. ; _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 71 ? ? -173.93 144.85 2 1 PHE A 77 ? ? -105.80 -156.40 3 1 ARG A 95 ? ? 79.71 -9.01 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 27 ? CG ? A GLU 28 CG 2 1 Y 1 A GLU 27 ? CD ? A GLU 28 CD 3 1 Y 1 A GLU 27 ? OE1 ? A GLU 28 OE1 4 1 Y 1 A GLU 27 ? OE2 ? A GLU 28 OE2 5 1 Y 1 A ARG 95 ? CG ? A ARG 96 CG 6 1 Y 1 A ARG 95 ? CD ? A ARG 96 CD 7 1 Y 1 A ARG 95 ? NE ? A ARG 96 NE 8 1 Y 1 A ARG 95 ? CZ ? A ARG 96 CZ 9 1 Y 1 A ARG 95 ? NH1 ? A ARG 96 NH1 10 1 Y 1 A ARG 95 ? NH2 ? A ARG 96 NH2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID' NHE 3 1,2-ETHANEDIOL EDO 4 water HOH #