data_3KZD # _entry.id 3KZD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3KZD pdb_00003kzd 10.2210/pdb3kzd/pdb RCSB RCSB056637 ? ? WWPDB D_1000056637 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3KZE _pdbx_database_related.details 'Crystal Structure of T-cell Lymphoma Invasion and Metastasis-1 PDZ in Complex With SSRKEYYA Peptide' _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 3KZD _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-12-08 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Shepherd, T.R.' 1 'Fuentes, E.J.' 2 # _citation.id primary _citation.title 'The Tiam1 PDZ domain couples to Syndecan1 and promotes cell-matrix adhesion.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 398 _citation.page_first 730 _citation.page_last 746 _citation.year 2010 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20361982 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2010.03.047 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shepherd, T.R.' 1 ? primary 'Klaus, S.M.' 2 ? primary 'Liu, X.' 3 ? primary 'Ramaswamy, S.' 4 ? primary 'DeMali, K.A.' 5 ? primary 'Fuentes, E.J.' 6 ? # _cell.length_a 44.782 _cell.length_b 44.782 _cell.length_c 70.799 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 3KZD _cell.pdbx_unique_axis ? _cell.Z_PDB 6 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.entry_id 3KZD _symmetry.Int_Tables_number 154 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'T-lymphoma invasion and metastasis-inducing protein 1' 10154.440 1 ? Q844H 'PDZ Domain' ? 2 water nat water 18.015 75 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name TIAM-1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMGKVTHSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLS QPSLGLLVRTYPEL ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMGKVTHSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLS QPSLGLLVRTYPEL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 LYS n 1 6 VAL n 1 7 THR n 1 8 HIS n 1 9 SER n 1 10 ILE n 1 11 HIS n 1 12 ILE n 1 13 GLU n 1 14 LYS n 1 15 SER n 1 16 ASP n 1 17 THR n 1 18 ALA n 1 19 ALA n 1 20 ASP n 1 21 THR n 1 22 TYR n 1 23 GLY n 1 24 PHE n 1 25 SER n 1 26 LEU n 1 27 SER n 1 28 SER n 1 29 VAL n 1 30 GLU n 1 31 GLU n 1 32 ASP n 1 33 GLY n 1 34 ILE n 1 35 ARG n 1 36 ARG n 1 37 LEU n 1 38 TYR n 1 39 VAL n 1 40 ASN n 1 41 SER n 1 42 VAL n 1 43 LYS n 1 44 GLU n 1 45 THR n 1 46 GLY n 1 47 LEU n 1 48 ALA n 1 49 SER n 1 50 LYS n 1 51 LYS n 1 52 GLY n 1 53 LEU n 1 54 LYS n 1 55 ALA n 1 56 GLY n 1 57 ASP n 1 58 GLU n 1 59 ILE n 1 60 LEU n 1 61 GLU n 1 62 ILE n 1 63 ASN n 1 64 ASN n 1 65 ARG n 1 66 ALA n 1 67 ALA n 1 68 ASP n 1 69 ALA n 1 70 LEU n 1 71 ASN n 1 72 SER n 1 73 SER n 1 74 MET n 1 75 LEU n 1 76 LYS n 1 77 ASP n 1 78 PHE n 1 79 LEU n 1 80 SER n 1 81 GLN n 1 82 PRO n 1 83 SER n 1 84 LEU n 1 85 GLY n 1 86 LEU n 1 87 LEU n 1 88 VAL n 1 89 ARG n 1 90 THR n 1 91 TYR n 1 92 PRO n 1 93 GLU n 1 94 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TIAM1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21a-6His-rTEV _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TIAM1_HUMAN _struct_ref.pdbx_db_accession Q13009 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSL GLLVRTYPEL ; _struct_ref.pdbx_align_begin 841 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3KZD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 94 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13009 _struct_ref_seq.db_align_beg 841 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 930 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 841 _struct_ref_seq.pdbx_auth_seq_align_end 930 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3KZD GLY A 1 ? UNP Q13009 ? ? 'expression tag' 837 1 1 3KZD ALA A 2 ? UNP Q13009 ? ? 'expression tag' 838 2 1 3KZD MET A 3 ? UNP Q13009 ? ? 'expression tag' 839 3 1 3KZD GLY A 4 ? UNP Q13009 ? ? 'expression tag' 840 4 1 3KZD HIS A 8 ? UNP Q13009 GLN 844 'engineered mutation' 844 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 3KZD _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.02 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 39.05 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.temp 288 _exptl_crystal_grow.pdbx_details '20% (w/v) PEG 3350, 0.2 M NaSCN, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 288K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.pdbx_collection_date 2007-06-16 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Double crystal cryo-cooled Si(111)' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.03320 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 23-ID-D' _diffrn_source.pdbx_wavelength_list 1.03320 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 23-ID-D # _reflns.entry_id 3KZD _reflns.d_resolution_high 1.300 _reflns.d_resolution_low 34.025 _reflns.number_obs 20526 _reflns.pdbx_scaling_rejects 1592 _reflns.pdbx_Rmerge_I_obs 0.050 _reflns.pdbx_netI_over_sigmaI 18.500 _reflns.pdbx_chi_squared 0.980 _reflns.pdbx_redundancy 10.250 _reflns.percent_possible_obs 98.500 _reflns.observed_criterion_sigma_F 3 _reflns.observed_criterion_sigma_I 3 _reflns.number_all 20526 _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate 15.079 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.30 _reflns_shell.d_res_low 1.35 _reflns_shell.number_measured_obs ? _reflns_shell.number_measured_all 19857 _reflns_shell.number_unique_obs ? _reflns_shell.Rmerge_I_obs 0.336 _reflns_shell.meanI_over_sigI_obs 5.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared 1.330 _reflns_shell.pdbx_redundancy 10.00 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1978 _reflns_shell.percent_possible_all 96.50 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3KZD _refine.ls_d_res_high 1.3 _refine.ls_d_res_low 34.010 _refine.pdbx_ls_sigma_F 0.97 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 98.290 _refine.ls_number_reflns_obs 20510 _refine.ls_number_reflns_all 20526 _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details RANDOM _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.199 _refine.ls_R_factor_R_work 0.196 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.224 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 9.800 _refine.ls_number_reflns_R_free 2009 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 16.266 _refine.solvent_model_param_bsol 49.747 _refine.solvent_model_param_ksol 0.447 _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 0.969 _refine.aniso_B[2][2] 0.969 _refine.aniso_B[3][3] -2.845 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.210 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.110 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.900 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 36.16 _refine.B_iso_min 9.08 _refine.occupancy_max 1.00 _refine.occupancy_min 0.29 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 642 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 75 _refine_hist.number_atoms_total 717 _refine_hist.d_res_high 1.3 _refine_hist.d_res_low 34.010 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 696 0.005 ? ? 'X-RAY DIFFRACTION' ? f_angle_d 952 0.995 ? ? 'X-RAY DIFFRACTION' ? f_chiral_restr 114 0.065 ? ? 'X-RAY DIFFRACTION' ? f_plane_restr 122 0.004 ? ? 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 266 14.597 ? ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id 1.3 1.331 14 96.000 1273 . 0.171 0.222 . 134 . 1407 1407 . 'X-RAY DIFFRACTION' 1.331 1.367 14 97.000 1292 . 0.163 0.218 . 141 . 1433 1433 . 'X-RAY DIFFRACTION' 1.367 1.407 14 98.000 1288 . 0.156 0.219 . 142 . 1430 1430 . 'X-RAY DIFFRACTION' 1.407 1.453 14 98.000 1272 . 0.157 0.201 . 135 . 1407 1407 . 'X-RAY DIFFRACTION' 1.453 1.505 14 98.000 1321 . 0.152 0.190 . 145 . 1466 1466 . 'X-RAY DIFFRACTION' 1.505 1.565 14 99.000 1304 . 0.155 0.204 . 143 . 1447 1447 . 'X-RAY DIFFRACTION' 1.565 1.636 14 98.000 1294 . 0.156 0.198 . 135 . 1429 1429 . 'X-RAY DIFFRACTION' 1.636 1.722 14 99.000 1345 . 0.173 0.208 . 151 . 1496 1496 . 'X-RAY DIFFRACTION' 1.722 1.831 14 99.000 1299 . 0.172 0.224 . 139 . 1438 1438 . 'X-RAY DIFFRACTION' 1.831 1.972 14 99.000 1343 . 0.170 0.229 . 146 . 1489 1489 . 'X-RAY DIFFRACTION' 1.972 2.170 14 100.000 1338 . 0.171 0.169 . 146 . 1484 1484 . 'X-RAY DIFFRACTION' 2.170 2.484 14 100.000 1360 . 0.188 0.228 . 151 . 1511 1511 . 'X-RAY DIFFRACTION' 2.484 3.129 14 99.000 1363 . 0.207 0.258 . 149 . 1512 1512 . 'X-RAY DIFFRACTION' 3.129 34.025 14 97.000 1409 . 0.203 0.200 . 152 . 1561 1566 . 'X-RAY DIFFRACTION' # _struct.entry_id 3KZD _struct.title 'Crystal Structure of Free T-cell Lymphoma Invasion and Metastasis-1 PDZ Domain' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3KZD _struct_keywords.text ;PDZ, CELL JUNCTION, CELL ADHESION, SIGNALING PROTEIN, TIAM1, Guanine nucleotide exchange factor, Guanine-nucleotide releasing factor, Lipoprotein, Myristate, Phosphoprotein, Polymorphism ; _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 46 ? LYS A 51 ? GLY A 882 LYS A 887 1 ? 6 HELX_P HELX_P2 2 ASP A 68 ? LEU A 70 ? ASP A 904 LEU A 906 5 ? 3 HELX_P HELX_P3 3 ASN A 71 ? GLN A 81 ? ASN A 907 GLN A 917 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 6 ? GLU A 13 ? VAL A 842 GLU A 849 A 2 SER A 83 ? THR A 90 ? SER A 919 THR A 926 A 3 GLU A 58 ? ILE A 62 ? GLU A 894 ILE A 898 A 4 ARG A 36 ? VAL A 42 ? ARG A 872 VAL A 878 A 5 PHE A 24 ? VAL A 29 ? PHE A 860 VAL A 865 B 1 VAL A 6 ? GLU A 13 ? VAL A 842 GLU A 849 B 2 SER A 83 ? THR A 90 ? SER A 919 THR A 926 B 3 GLU A 58 ? ILE A 62 ? GLU A 894 ILE A 898 B 4 ARG A 65 ? ALA A 66 ? ARG A 901 ALA A 902 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N HIS A 8 ? N HIS A 844 O VAL A 88 ? O VAL A 924 A 2 3 O ARG A 89 ? O ARG A 925 N GLU A 58 ? N GLU A 894 A 3 4 O ILE A 59 ? O ILE A 895 N LEU A 37 ? N LEU A 873 A 4 5 O ARG A 36 ? O ARG A 872 N VAL A 29 ? N VAL A 865 B 1 2 N HIS A 8 ? N HIS A 844 O VAL A 88 ? O VAL A 924 B 2 3 O ARG A 89 ? O ARG A 925 N GLU A 58 ? N GLU A 894 B 3 4 N ILE A 62 ? N ILE A 898 O ARG A 65 ? O ARG A 901 # _atom_sites.entry_id 3KZD _atom_sites.fract_transf_matrix[1][1] 0.022330 _atom_sites.fract_transf_matrix[1][2] 0.012892 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.025785 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014125 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 837 ? ? ? A . n A 1 2 ALA 2 838 ? ? ? A . n A 1 3 MET 3 839 ? ? ? A . n A 1 4 GLY 4 840 840 GLY GLY A . n A 1 5 LYS 5 841 841 LYS LYS A . n A 1 6 VAL 6 842 842 VAL VAL A . n A 1 7 THR 7 843 843 THR THR A . n A 1 8 HIS 8 844 844 HIS HIS A . n A 1 9 SER 9 845 845 SER SER A . n A 1 10 ILE 10 846 846 ILE ILE A . n A 1 11 HIS 11 847 847 HIS HIS A . n A 1 12 ILE 12 848 848 ILE ILE A . n A 1 13 GLU 13 849 849 GLU GLU A . n A 1 14 LYS 14 850 850 LYS LYS A . n A 1 15 SER 15 851 ? ? ? A . n A 1 16 ASP 16 852 ? ? ? A . n A 1 17 THR 17 853 ? ? ? A . n A 1 18 ALA 18 854 ? ? ? A . n A 1 19 ALA 19 855 ? ? ? A . n A 1 20 ASP 20 856 ? ? ? A . n A 1 21 THR 21 857 857 THR THR A . n A 1 22 TYR 22 858 858 TYR TYR A . n A 1 23 GLY 23 859 859 GLY GLY A . n A 1 24 PHE 24 860 860 PHE PHE A . n A 1 25 SER 25 861 861 SER SER A . n A 1 26 LEU 26 862 862 LEU LEU A . n A 1 27 SER 27 863 863 SER SER A . n A 1 28 SER 28 864 864 SER SER A . n A 1 29 VAL 29 865 865 VAL VAL A . n A 1 30 GLU 30 866 866 GLU GLU A . n A 1 31 GLU 31 867 867 GLU GLU A . n A 1 32 ASP 32 868 868 ASP ASP A . n A 1 33 GLY 33 869 869 GLY GLY A . n A 1 34 ILE 34 870 870 ILE ILE A . n A 1 35 ARG 35 871 871 ARG ARG A . n A 1 36 ARG 36 872 872 ARG ARG A . n A 1 37 LEU 37 873 873 LEU LEU A . n A 1 38 TYR 38 874 874 TYR TYR A . n A 1 39 VAL 39 875 875 VAL VAL A . n A 1 40 ASN 40 876 876 ASN ASN A . n A 1 41 SER 41 877 877 SER SER A . n A 1 42 VAL 42 878 878 VAL VAL A . n A 1 43 LYS 43 879 879 LYS LYS A . n A 1 44 GLU 44 880 880 GLU GLU A . n A 1 45 THR 45 881 881 THR THR A . n A 1 46 GLY 46 882 882 GLY GLY A . n A 1 47 LEU 47 883 883 LEU LEU A . n A 1 48 ALA 48 884 884 ALA ALA A . n A 1 49 SER 49 885 885 SER SER A . n A 1 50 LYS 50 886 886 LYS LYS A . n A 1 51 LYS 51 887 887 LYS LYS A . n A 1 52 GLY 52 888 888 GLY GLY A . n A 1 53 LEU 53 889 889 LEU LEU A . n A 1 54 LYS 54 890 890 LYS LYS A . n A 1 55 ALA 55 891 891 ALA ALA A . n A 1 56 GLY 56 892 892 GLY GLY A . n A 1 57 ASP 57 893 893 ASP ASP A . n A 1 58 GLU 58 894 894 GLU GLU A . n A 1 59 ILE 59 895 895 ILE ILE A . n A 1 60 LEU 60 896 896 LEU LEU A . n A 1 61 GLU 61 897 897 GLU GLU A . n A 1 62 ILE 62 898 898 ILE ILE A . n A 1 63 ASN 63 899 899 ASN ASN A . n A 1 64 ASN 64 900 900 ASN ASN A . n A 1 65 ARG 65 901 901 ARG ARG A . n A 1 66 ALA 66 902 902 ALA ALA A . n A 1 67 ALA 67 903 903 ALA ALA A . n A 1 68 ASP 68 904 904 ASP ASP A . n A 1 69 ALA 69 905 905 ALA ALA A . n A 1 70 LEU 70 906 906 LEU LEU A . n A 1 71 ASN 71 907 907 ASN ASN A . n A 1 72 SER 72 908 908 SER SER A . n A 1 73 SER 73 909 909 SER SER A . n A 1 74 MET 74 910 910 MET MET A . n A 1 75 LEU 75 911 911 LEU LEU A . n A 1 76 LYS 76 912 912 LYS LYS A . n A 1 77 ASP 77 913 913 ASP ASP A . n A 1 78 PHE 78 914 914 PHE PHE A . n A 1 79 LEU 79 915 915 LEU LEU A . n A 1 80 SER 80 916 916 SER SER A . n A 1 81 GLN 81 917 917 GLN GLN A . n A 1 82 PRO 82 918 918 PRO PRO A . n A 1 83 SER 83 919 919 SER SER A . n A 1 84 LEU 84 920 920 LEU LEU A . n A 1 85 GLY 85 921 921 GLY GLY A . n A 1 86 LEU 86 922 922 LEU LEU A . n A 1 87 LEU 87 923 923 LEU LEU A . n A 1 88 VAL 88 924 924 VAL VAL A . n A 1 89 ARG 89 925 925 ARG ARG A . n A 1 90 THR 90 926 926 THR THR A . n A 1 91 TYR 91 927 927 TYR TYR A . n A 1 92 PRO 92 928 928 PRO PRO A . n A 1 93 GLU 93 929 929 GLU GLU A . n A 1 94 LEU 94 930 930 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 940 940 HOH HOH A . B 2 HOH 2 941 941 HOH HOH A . B 2 HOH 3 942 942 HOH HOH A . B 2 HOH 4 943 943 HOH HOH A . B 2 HOH 5 944 944 HOH HOH A . B 2 HOH 6 945 945 HOH HOH A . B 2 HOH 7 946 946 HOH HOH A . B 2 HOH 8 947 947 HOH HOH A . B 2 HOH 9 948 948 HOH HOH A . B 2 HOH 10 949 949 HOH HOH A . B 2 HOH 11 950 950 HOH HOH A . B 2 HOH 12 951 951 HOH HOH A . B 2 HOH 13 952 952 HOH HOH A . B 2 HOH 14 953 953 HOH HOH A . B 2 HOH 15 954 954 HOH HOH A . B 2 HOH 16 955 955 HOH HOH A . B 2 HOH 17 956 956 HOH HOH A . B 2 HOH 18 957 957 HOH HOH A . B 2 HOH 19 958 958 HOH HOH A . B 2 HOH 20 959 959 HOH HOH A . B 2 HOH 21 960 960 HOH HOH A . B 2 HOH 22 961 961 HOH HOH A . B 2 HOH 23 962 962 HOH HOH A . B 2 HOH 24 963 963 HOH HOH A . B 2 HOH 25 964 964 HOH HOH A . B 2 HOH 26 965 965 HOH HOH A . B 2 HOH 27 966 966 HOH HOH A . B 2 HOH 28 967 967 HOH HOH A . B 2 HOH 29 968 968 HOH HOH A . B 2 HOH 30 969 969 HOH HOH A . B 2 HOH 31 970 970 HOH HOH A . B 2 HOH 32 971 971 HOH HOH A . B 2 HOH 33 972 972 HOH HOH A . B 2 HOH 34 973 973 HOH HOH A . B 2 HOH 35 974 974 HOH HOH A . B 2 HOH 36 975 975 HOH HOH A . B 2 HOH 37 976 976 HOH HOH A . B 2 HOH 38 977 977 HOH HOH A . B 2 HOH 39 978 978 HOH HOH A . B 2 HOH 40 979 979 HOH HOH A . B 2 HOH 41 980 980 HOH HOH A . B 2 HOH 42 981 981 HOH HOH A . B 2 HOH 43 982 982 HOH HOH A . B 2 HOH 44 983 983 HOH HOH A . B 2 HOH 45 984 984 HOH HOH A . B 2 HOH 46 985 985 HOH HOH A . B 2 HOH 47 986 986 HOH HOH A . B 2 HOH 48 987 987 HOH HOH A . B 2 HOH 49 988 988 HOH HOH A . B 2 HOH 50 989 989 HOH HOH A . B 2 HOH 51 990 990 HOH HOH A . B 2 HOH 52 991 991 HOH HOH A . B 2 HOH 53 992 992 HOH HOH A . B 2 HOH 54 993 993 HOH HOH A . B 2 HOH 55 994 994 HOH HOH A . B 2 HOH 56 995 995 HOH HOH A . B 2 HOH 57 996 996 HOH HOH A . B 2 HOH 58 997 997 HOH HOH A . B 2 HOH 59 998 998 HOH HOH A . B 2 HOH 60 999 999 HOH HOH A . B 2 HOH 61 1000 1000 HOH HOH A . B 2 HOH 62 1001 1001 HOH HOH A . B 2 HOH 63 1002 1002 HOH HOH A . B 2 HOH 64 1003 1003 HOH HOH A . B 2 HOH 65 1004 1004 HOH HOH A . B 2 HOH 66 1005 1005 HOH HOH A . B 2 HOH 67 1006 1006 HOH HOH A . B 2 HOH 68 1007 1007 HOH HOH A . B 2 HOH 69 1008 1008 HOH HOH A . B 2 HOH 70 1009 1009 HOH HOH A . B 2 HOH 71 1010 1010 HOH HOH A . B 2 HOH 72 1011 1011 HOH HOH A . B 2 HOH 73 1012 1012 HOH HOH A . B 2 HOH 74 1013 1013 HOH HOH A . B 2 HOH 75 1014 1014 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-04-21 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-11-01 4 'Structure model' 1 3 2021-10-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' database_2 3 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_phasing_MR.entry_id 3KZD _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details 'Phaser MODE: MR_AUTO' _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 2.500 _pdbx_phasing_MR.d_res_low_rotation 34.010 _pdbx_phasing_MR.d_res_high_translation 2.500 _pdbx_phasing_MR.d_res_low_translation 34.010 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 d*TREK 9.9L 'Mar 5 2008' package 'Jim W. Pflugrath' Jim.Pflugrath@Rigaku.com 'data scaling' http://www.rigaku.com/software/dtrek.html ? ? 2 PHASER 1.3.3 'Tue Nov 14 15:28:12 2006' program 'Randy J. Read' cimr-phaser@lists.cam.ac.uk phasing http://www-structmed.cimr.cam.ac.uk/phaser/ ? ? 3 PHENIX 1.5_2 ? package 'Paul D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 4 PDB_EXTRACT 3.005 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 5 HKL-2000 . ? ? ? ? 'data collection' ? ? ? 6 d*TREK . ? ? ? ? 'data reduction' ? ? ? 7 MOLREP . ? ? ? ? phasing ? ? ? 8 ARP . ? ? ? ? 'model building' ? ? ? 9 WARP . ? ? ? ? 'model building' ? ? ? # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 866 ? CG ? A GLU 30 CG 2 1 Y 1 A GLU 866 ? CD ? A GLU 30 CD 3 1 Y 1 A GLU 866 ? OE1 ? A GLU 30 OE1 4 1 Y 1 A GLU 866 ? OE2 ? A GLU 30 OE2 5 1 Y 1 A GLU 867 ? CG ? A GLU 31 CG 6 1 Y 1 A GLU 867 ? CD ? A GLU 31 CD 7 1 Y 1 A GLU 867 ? OE1 ? A GLU 31 OE1 8 1 Y 1 A GLU 867 ? OE2 ? A GLU 31 OE2 9 1 Y 1 A LYS 879 ? CD ? A LYS 43 CD 10 1 Y 1 A LYS 879 ? CE ? A LYS 43 CE 11 1 Y 1 A LYS 879 ? NZ ? A LYS 43 NZ 12 1 Y 1 A GLU 880 ? CD ? A GLU 44 CD 13 1 Y 1 A GLU 880 ? OE1 ? A GLU 44 OE1 14 1 Y 1 A GLU 880 ? OE2 ? A GLU 44 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 837 ? A GLY 1 2 1 Y 1 A ALA 838 ? A ALA 2 3 1 Y 1 A MET 839 ? A MET 3 4 1 Y 1 A SER 851 ? A SER 15 5 1 Y 1 A ASP 852 ? A ASP 16 6 1 Y 1 A THR 853 ? A THR 17 7 1 Y 1 A ALA 854 ? A ALA 18 8 1 Y 1 A ALA 855 ? A ALA 19 9 1 Y 1 A ASP 856 ? A ASP 20 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #