data_3L7X # _entry.id 3L7X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3L7X RCSB RCSB056945 WWPDB D_1000056945 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3L7X _pdbx_database_status.recvd_initial_deposition_date 2009-12-29 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Su, X.-D.' 1 'Ye, Z.Y.' 2 'Liu, X.' 3 # _citation.id primary _citation.title 'The Crystal Structure of SMU.412c from Streptococcus mutans UA159' _citation.journal_abbrev 'TO BE PUBLISHED' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Su, X.-D.' 1 primary 'Ye, Z.Y.' 2 primary 'Liu, X.' 3 # _cell.entry_id 3L7X _cell.length_a 53.348 _cell.length_b 53.348 _cell.length_c 141.059 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3L7X _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative Hit-like protein involved in cell-cycle regulation' 19142.537 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 2 ? ? ? ? 4 water nat water 18.015 60 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name smu.412c # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMNDCLFCKIVAGDIPSSKVYEDEDVLAFLDISQATKGHTLVIPKEH VRNALEMTQTQAANLFARIPKIARALQKATKADGLNIINNNEETAGQTVFHAHVHLVPRFADSDEFDIRFVQHEPDFTRL GQLAEDIQKEIEA ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMNDCLFCKIVAGDIPSSKVYEDEDVLAFLDISQATKGHTLVIPKEH VRNALEMTQTQAANLFARIPKIARALQKATKADGLNIINNNEETAGQTVFHAHVHLVPRFADSDEFDIRFVQHEPDFTRL GQLAEDIQKEIEA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ALA n 1 23 SER n 1 24 MET n 1 25 THR n 1 26 GLY n 1 27 GLY n 1 28 GLN n 1 29 GLN n 1 30 MET n 1 31 GLY n 1 32 ARG n 1 33 GLY n 1 34 SER n 1 35 MET n 1 36 ASN n 1 37 ASP n 1 38 CYS n 1 39 LEU n 1 40 PHE n 1 41 CYS n 1 42 LYS n 1 43 ILE n 1 44 VAL n 1 45 ALA n 1 46 GLY n 1 47 ASP n 1 48 ILE n 1 49 PRO n 1 50 SER n 1 51 SER n 1 52 LYS n 1 53 VAL n 1 54 TYR n 1 55 GLU n 1 56 ASP n 1 57 GLU n 1 58 ASP n 1 59 VAL n 1 60 LEU n 1 61 ALA n 1 62 PHE n 1 63 LEU n 1 64 ASP n 1 65 ILE n 1 66 SER n 1 67 GLN n 1 68 ALA n 1 69 THR n 1 70 LYS n 1 71 GLY n 1 72 HIS n 1 73 THR n 1 74 LEU n 1 75 VAL n 1 76 ILE n 1 77 PRO n 1 78 LYS n 1 79 GLU n 1 80 HIS n 1 81 VAL n 1 82 ARG n 1 83 ASN n 1 84 ALA n 1 85 LEU n 1 86 GLU n 1 87 MET n 1 88 THR n 1 89 GLN n 1 90 THR n 1 91 GLN n 1 92 ALA n 1 93 ALA n 1 94 ASN n 1 95 LEU n 1 96 PHE n 1 97 ALA n 1 98 ARG n 1 99 ILE n 1 100 PRO n 1 101 LYS n 1 102 ILE n 1 103 ALA n 1 104 ARG n 1 105 ALA n 1 106 LEU n 1 107 GLN n 1 108 LYS n 1 109 ALA n 1 110 THR n 1 111 LYS n 1 112 ALA n 1 113 ASP n 1 114 GLY n 1 115 LEU n 1 116 ASN n 1 117 ILE n 1 118 ILE n 1 119 ASN n 1 120 ASN n 1 121 ASN n 1 122 GLU n 1 123 GLU n 1 124 THR n 1 125 ALA n 1 126 GLY n 1 127 GLN n 1 128 THR n 1 129 VAL n 1 130 PHE n 1 131 HIS n 1 132 ALA n 1 133 HIS n 1 134 VAL n 1 135 HIS n 1 136 LEU n 1 137 VAL n 1 138 PRO n 1 139 ARG n 1 140 PHE n 1 141 ALA n 1 142 ASP n 1 143 SER n 1 144 ASP n 1 145 GLU n 1 146 PHE n 1 147 ASP n 1 148 ILE n 1 149 ARG n 1 150 PHE n 1 151 VAL n 1 152 GLN n 1 153 HIS n 1 154 GLU n 1 155 PRO n 1 156 ASP n 1 157 PHE n 1 158 THR n 1 159 ARG n 1 160 LEU n 1 161 GLY n 1 162 GLN n 1 163 LEU n 1 164 ALA n 1 165 GLU n 1 166 ASP n 1 167 ILE n 1 168 GLN n 1 169 LYS n 1 170 GLU n 1 171 ILE n 1 172 GLU n 1 173 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene smu.412c _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain UA159 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus mutans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 210007 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8DVQ8_STRMU _struct_ref.pdbx_db_accession Q8DVQ8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNDCLFCKIVAGDIPSSKVYEDEDVLAFLDISQATKGHTLVIPKEHVRNALEMTQTQAANLFARIPKIARALQKATKADG LNIINNNEETAGQTVFHAHVHLVPRFADSDEFDIRFVQHEPDFTRLGQLAEDIQKEIEA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3L7X _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 35 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 173 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8DVQ8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 139 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 139 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3L7X MET A 1 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -33 1 1 3L7X GLY A 2 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -32 2 1 3L7X SER A 3 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -31 3 1 3L7X SER A 4 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -30 4 1 3L7X HIS A 5 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -29 5 1 3L7X HIS A 6 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -28 6 1 3L7X HIS A 7 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -27 7 1 3L7X HIS A 8 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -26 8 1 3L7X HIS A 9 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -25 9 1 3L7X HIS A 10 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -24 10 1 3L7X SER A 11 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -23 11 1 3L7X SER A 12 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -22 12 1 3L7X GLY A 13 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -21 13 1 3L7X LEU A 14 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -20 14 1 3L7X VAL A 15 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -19 15 1 3L7X PRO A 16 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -18 16 1 3L7X ARG A 17 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -17 17 1 3L7X GLY A 18 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -16 18 1 3L7X SER A 19 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -15 19 1 3L7X HIS A 20 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -14 20 1 3L7X MET A 21 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -13 21 1 3L7X ALA A 22 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -12 22 1 3L7X SER A 23 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -11 23 1 3L7X MET A 24 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -10 24 1 3L7X THR A 25 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -9 25 1 3L7X GLY A 26 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -8 26 1 3L7X GLY A 27 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -7 27 1 3L7X GLN A 28 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -6 28 1 3L7X GLN A 29 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -5 29 1 3L7X MET A 30 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -4 30 1 3L7X GLY A 31 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -3 31 1 3L7X ARG A 32 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -2 32 1 3L7X GLY A 33 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' -1 33 1 3L7X SER A 34 ? UNP Q8DVQ8 ? ? 'EXPRESSION TAG' 0 34 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 3L7X _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.62 _exptl_crystal.density_percent_sol 53.08 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '2.8M Sodium acetate trihydrate pH7.0, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 289K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4r' _diffrn_detector.pdbx_collection_date 2008-11-06 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-6A' _diffrn_source.pdbx_synchrotron_site 'Photon Factory' _diffrn_source.pdbx_synchrotron_beamline BL-6A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.00 # _reflns.entry_id 3L7X _reflns.observed_criterion_sigma_I 1 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50 _reflns.d_resolution_high 1.699 _reflns.number_obs 23340 _reflns.number_all 23363 _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 21.620 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.699 _reflns_shell.d_res_low 1.76 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3L7X _refine.ls_number_reflns_obs 23313 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 35.274 _refine.ls_d_res_high 1.699 _refine.ls_percent_reflns_obs 99.93 _refine.ls_R_factor_obs 0.1901 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1879 _refine.ls_R_factor_R_free 0.2129 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 8.58 _refine.ls_number_reflns_R_free 2000 _refine.ls_number_reflns_R_work 21313 _refine.B_iso_mean 28.933 _refine.aniso_B[1][1] 4.901 _refine.aniso_B[2][2] 4.901 _refine.aniso_B[3][3] -9.801 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][3] 0.000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.391 _refine.solvent_model_param_bsol 72.804 _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1Y23' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.22 _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.853 _refine.B_iso_max 95.83 _refine.B_iso_min 12.75 _refine.pdbx_overall_phase_error 20.600 _refine.occupancy_max 1.00 _refine.occupancy_min 0.50 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1188 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 60 _refine_hist.number_atoms_total 1251 _refine_hist.d_res_high 1.699 _refine_hist.d_res_low 35.274 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.021 ? ? 1207 'X-RAY DIFFRACTION' ? f_angle_d 1.875 ? ? 1631 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 18.476 ? ? 434 'X-RAY DIFFRACTION' ? f_chiral_restr 0.154 ? ? 188 'X-RAY DIFFRACTION' ? f_plane_restr 0.010 ? ? 216 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id . 1.6992 1.7417 1480 0.2221 100.00 0.2816 . . 139 . . . . 'X-RAY DIFFRACTION' . 1.7417 1.7888 1501 0.1943 100.00 0.2421 . . 141 . . . . 'X-RAY DIFFRACTION' . 1.7888 1.8414 1490 0.1867 100.00 0.2329 . . 139 . . . . 'X-RAY DIFFRACTION' . 1.8414 1.9008 1478 0.1879 100.00 0.2257 . . 139 . . . . 'X-RAY DIFFRACTION' . 1.9008 1.9688 1489 0.1774 100.00 0.2090 . . 140 . . . . 'X-RAY DIFFRACTION' . 1.9688 2.0476 1501 0.1780 100.00 0.2125 . . 141 . . . . 'X-RAY DIFFRACTION' . 2.0476 2.1408 1508 0.1688 100.00 0.2143 . . 141 . . . . 'X-RAY DIFFRACTION' . 2.1408 2.2536 1513 0.1726 100.00 0.1992 . . 142 . . . . 'X-RAY DIFFRACTION' . 2.2536 2.3948 1510 0.1804 100.00 0.2208 . . 142 . . . . 'X-RAY DIFFRACTION' . 2.3948 2.5796 1503 0.1766 100.00 0.1917 . . 141 . . . . 'X-RAY DIFFRACTION' . 2.5796 2.8391 1541 0.1952 100.00 0.2449 . . 144 . . . . 'X-RAY DIFFRACTION' . 2.8391 3.2497 1538 0.2019 100.00 0.2274 . . 145 . . . . 'X-RAY DIFFRACTION' . 3.2497 4.0933 1585 0.1693 100.00 0.1860 . . 149 . . . . 'X-RAY DIFFRACTION' . 4.0933 35.2818 1676 0.1884 99.00 0.1978 . . 157 . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 3L7X _struct.title 'The Crystal Structure of SMU.412c from Streptococcus mutans UA159' _struct.pdbx_descriptor 'Putative Hit-like protein involved in cell-cycle regulation' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3L7X _struct_keywords.pdbx_keywords 'CELL CYCLE' _struct_keywords.text 'Hit-like protein, cell-cycle regulation, CELL CYCLE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 38 ? ALA A 45 ? CYS A 4 ALA A 11 1 ? 8 HELX_P HELX_P2 2 ASN A 83 ? MET A 87 ? ASN A 49 MET A 53 5 ? 5 HELX_P HELX_P3 3 THR A 88 ? ARG A 98 ? THR A 54 ARG A 64 1 ? 11 HELX_P HELX_P4 4 ARG A 98 ? LYS A 111 ? ARG A 64 LYS A 77 1 ? 14 HELX_P HELX_P5 5 GLU A 122 ? GLY A 126 ? GLU A 88 GLY A 92 5 ? 5 HELX_P HELX_P6 6 ASP A 156 ? GLU A 172 ? ASP A 122 GLU A 138 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A HIS 131 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 97 A ZN 140 1_555 ? ? ? ? ? ? ? 2.111 ? metalc2 metalc ? ? A HIS 80 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 46 A ZN 140 1_555 ? ? ? ? ? ? ? 2.140 ? metalc3 metalc ? ? A CYS 38 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 4 A ZN 140 1_555 ? ? ? ? ? ? ? 2.281 ? metalc4 metalc ? ? A CYS 41 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 7 A ZN 140 1_555 ? ? ? ? ? ? ? 2.305 ? metalc5 metalc ? ? A GLU 86 O ? ? ? 1_555 D NA . NA ? ? A GLU 52 A NA 142 1_555 ? ? ? ? ? ? ? 2.335 ? metalc6 metalc ? ? D NA . NA ? ? ? 1_555 E HOH . O ? ? A NA 142 A HOH 160 1_555 ? ? ? ? ? ? ? 2.427 ? metalc7 metalc ? ? A THR 25 OG1 ? ? ? 1_555 D NA . NA ? ? A THR -9 A NA 142 1_555 ? ? ? ? ? ? ? 2.468 ? metalc8 metalc ? ? A SER 23 OG ? ? ? 1_555 D NA . NA ? ? A SER -11 A NA 142 1_555 ? ? ? ? ? ? ? 2.472 ? metalc9 metalc ? ? A GLY 26 O ? ? ? 1_555 D NA . NA ? ? A GLY -8 A NA 142 1_555 ? ? ? ? ? ? ? 2.561 ? metalc10 metalc ? ? C NA . NA ? ? ? 1_555 E HOH . O ? ? A NA 141 A HOH 153 1_555 ? ? ? ? ? ? ? 2.596 ? metalc11 metalc ? ? D NA . NA ? ? ? 1_555 E HOH . O ? ? A NA 142 A HOH 180 1_555 ? ? ? ? ? ? ? 2.605 ? metalc12 metalc ? ? C NA . NA ? ? ? 1_555 E HOH . O ? ? A NA 141 A HOH 147 1_555 ? ? ? ? ? ? ? 2.869 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 52 ? GLU A 55 ? LYS A 18 GLU A 21 A 2 VAL A 59 ? LEU A 63 ? VAL A 25 LEU A 29 A 3 THR A 73 ? PRO A 77 ? THR A 39 PRO A 43 A 4 VAL A 134 ? ARG A 139 ? VAL A 100 ARG A 105 A 5 GLY A 114 ? ASN A 119 ? GLY A 80 ASN A 85 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 54 ? N TYR A 20 O ALA A 61 ? O ALA A 27 A 2 3 N LEU A 60 ? N LEU A 26 O ILE A 76 ? O ILE A 42 A 3 4 N THR A 73 ? N THR A 39 O LEU A 136 ? O LEU A 102 A 4 5 O HIS A 135 ? O HIS A 101 N ILE A 118 ? N ILE A 84 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 140' AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 141' AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 142' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 38 ? CYS A 4 . ? 1_555 ? 2 AC1 4 CYS A 41 ? CYS A 7 . ? 1_555 ? 3 AC1 4 HIS A 80 ? HIS A 46 . ? 1_555 ? 4 AC1 4 HIS A 131 ? HIS A 97 . ? 1_555 ? 5 AC2 5 ASN A 120 ? ASN A 86 . ? 1_555 ? 6 AC2 5 HIS A 133 ? HIS A 99 . ? 1_555 ? 7 AC2 5 HIS A 135 ? HIS A 101 . ? 1_555 ? 8 AC2 5 HOH E . ? HOH A 147 . ? 1_555 ? 9 AC2 5 HOH E . ? HOH A 153 . ? 1_555 ? 10 AC3 6 THR A 25 ? THR A -9 . ? 1_555 ? 11 AC3 6 GLY A 26 ? GLY A -8 . ? 1_555 ? 12 AC3 6 SER A 23 ? SER A -11 . ? 1_555 ? 13 AC3 6 GLU A 86 ? GLU A 52 . ? 1_555 ? 14 AC3 6 HOH E . ? HOH A 160 . ? 1_555 ? 15 AC3 6 HOH E . ? HOH A 180 . ? 1_555 ? # _database_PDB_matrix.entry_id 3L7X _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3L7X _atom_sites.fract_transf_matrix[1][1] 0.018745 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018745 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007089 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N NA O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -33 ? ? ? A . n A 1 2 GLY 2 -32 ? ? ? A . n A 1 3 SER 3 -31 ? ? ? A . n A 1 4 SER 4 -30 ? ? ? A . n A 1 5 HIS 5 -29 ? ? ? A . n A 1 6 HIS 6 -28 ? ? ? A . n A 1 7 HIS 7 -27 ? ? ? A . n A 1 8 HIS 8 -26 ? ? ? A . n A 1 9 HIS 9 -25 ? ? ? A . n A 1 10 HIS 10 -24 ? ? ? A . n A 1 11 SER 11 -23 ? ? ? A . n A 1 12 SER 12 -22 ? ? ? A . n A 1 13 GLY 13 -21 ? ? ? A . n A 1 14 LEU 14 -20 -20 LEU LEU A . n A 1 15 VAL 15 -19 -19 VAL VAL A . n A 1 16 PRO 16 -18 -18 PRO PRO A . n A 1 17 ARG 17 -17 -17 ARG ARG A . n A 1 18 GLY 18 -16 -16 GLY GLY A . n A 1 19 SER 19 -15 -15 SER SER A . n A 1 20 HIS 20 -14 -14 HIS HIS A . n A 1 21 MET 21 -13 -13 MET MET A . n A 1 22 ALA 22 -12 -12 ALA ALA A . n A 1 23 SER 23 -11 -11 SER SER A . n A 1 24 MET 24 -10 -10 MET MET A . n A 1 25 THR 25 -9 -9 THR THR A . n A 1 26 GLY 26 -8 -8 GLY GLY A . n A 1 27 GLY 27 -7 -7 GLY GLY A . n A 1 28 GLN 28 -6 -6 GLN GLN A . n A 1 29 GLN 29 -5 -5 GLN GLN A . n A 1 30 MET 30 -4 -4 MET MET A . n A 1 31 GLY 31 -3 -3 GLY GLY A . n A 1 32 ARG 32 -2 ? ? ? A . n A 1 33 GLY 33 -1 -1 GLY GLY A . n A 1 34 SER 34 0 0 SER SER A . n A 1 35 MET 35 1 1 MET MET A . n A 1 36 ASN 36 2 2 ASN ASN A . n A 1 37 ASP 37 3 3 ASP ASP A . n A 1 38 CYS 38 4 4 CYS CYS A . n A 1 39 LEU 39 5 5 LEU LEU A . n A 1 40 PHE 40 6 6 PHE PHE A . n A 1 41 CYS 41 7 7 CYS CYS A . n A 1 42 LYS 42 8 8 LYS LYS A . n A 1 43 ILE 43 9 9 ILE ILE A . n A 1 44 VAL 44 10 10 VAL VAL A . n A 1 45 ALA 45 11 11 ALA ALA A . n A 1 46 GLY 46 12 12 GLY GLY A . n A 1 47 ASP 47 13 13 ASP ASP A . n A 1 48 ILE 48 14 14 ILE ILE A . n A 1 49 PRO 49 15 15 PRO PRO A . n A 1 50 SER 50 16 16 SER SER A . n A 1 51 SER 51 17 17 SER SER A . n A 1 52 LYS 52 18 18 LYS LYS A . n A 1 53 VAL 53 19 19 VAL VAL A . n A 1 54 TYR 54 20 20 TYR TYR A . n A 1 55 GLU 55 21 21 GLU GLU A . n A 1 56 ASP 56 22 22 ASP ASP A . n A 1 57 GLU 57 23 23 GLU GLU A . n A 1 58 ASP 58 24 24 ASP ASP A . n A 1 59 VAL 59 25 25 VAL VAL A . n A 1 60 LEU 60 26 26 LEU LEU A . n A 1 61 ALA 61 27 27 ALA ALA A . n A 1 62 PHE 62 28 28 PHE PHE A . n A 1 63 LEU 63 29 29 LEU LEU A . n A 1 64 ASP 64 30 30 ASP ASP A . n A 1 65 ILE 65 31 31 ILE ILE A . n A 1 66 SER 66 32 32 SER SER A . n A 1 67 GLN 67 33 33 GLN GLN A . n A 1 68 ALA 68 34 34 ALA ALA A . n A 1 69 THR 69 35 35 THR THR A . n A 1 70 LYS 70 36 36 LYS LYS A . n A 1 71 GLY 71 37 37 GLY GLY A . n A 1 72 HIS 72 38 38 HIS HIS A . n A 1 73 THR 73 39 39 THR THR A . n A 1 74 LEU 74 40 40 LEU LEU A . n A 1 75 VAL 75 41 41 VAL VAL A . n A 1 76 ILE 76 42 42 ILE ILE A . n A 1 77 PRO 77 43 43 PRO PRO A . n A 1 78 LYS 78 44 44 LYS LYS A . n A 1 79 GLU 79 45 45 GLU GLU A . n A 1 80 HIS 80 46 46 HIS HIS A . n A 1 81 VAL 81 47 47 VAL VAL A . n A 1 82 ARG 82 48 48 ARG ARG A . n A 1 83 ASN 83 49 49 ASN ASN A . n A 1 84 ALA 84 50 50 ALA ALA A . n A 1 85 LEU 85 51 51 LEU LEU A . n A 1 86 GLU 86 52 52 GLU GLU A . n A 1 87 MET 87 53 53 MET MET A . n A 1 88 THR 88 54 54 THR THR A . n A 1 89 GLN 89 55 55 GLN GLN A . n A 1 90 THR 90 56 56 THR THR A . n A 1 91 GLN 91 57 57 GLN GLN A . n A 1 92 ALA 92 58 58 ALA ALA A . n A 1 93 ALA 93 59 59 ALA ALA A . n A 1 94 ASN 94 60 60 ASN ASN A . n A 1 95 LEU 95 61 61 LEU LEU A . n A 1 96 PHE 96 62 62 PHE PHE A . n A 1 97 ALA 97 63 63 ALA ALA A . n A 1 98 ARG 98 64 64 ARG ARG A . n A 1 99 ILE 99 65 65 ILE ILE A . n A 1 100 PRO 100 66 66 PRO PRO A . n A 1 101 LYS 101 67 67 LYS LYS A . n A 1 102 ILE 102 68 68 ILE ILE A . n A 1 103 ALA 103 69 69 ALA ALA A . n A 1 104 ARG 104 70 70 ARG ARG A . n A 1 105 ALA 105 71 71 ALA ALA A . n A 1 106 LEU 106 72 72 LEU LEU A . n A 1 107 GLN 107 73 73 GLN GLN A . n A 1 108 LYS 108 74 74 LYS LYS A . n A 1 109 ALA 109 75 75 ALA ALA A . n A 1 110 THR 110 76 76 THR THR A . n A 1 111 LYS 111 77 77 LYS LYS A . n A 1 112 ALA 112 78 78 ALA ALA A . n A 1 113 ASP 113 79 79 ASP ASP A . n A 1 114 GLY 114 80 80 GLY GLY A . n A 1 115 LEU 115 81 81 LEU LEU A . n A 1 116 ASN 116 82 82 ASN ASN A . n A 1 117 ILE 117 83 83 ILE ILE A . n A 1 118 ILE 118 84 84 ILE ILE A . n A 1 119 ASN 119 85 85 ASN ASN A . n A 1 120 ASN 120 86 86 ASN ASN A . n A 1 121 ASN 121 87 87 ASN ASN A . n A 1 122 GLU 122 88 88 GLU GLU A . n A 1 123 GLU 123 89 89 GLU GLU A . n A 1 124 THR 124 90 90 THR THR A . n A 1 125 ALA 125 91 91 ALA ALA A . n A 1 126 GLY 126 92 92 GLY GLY A . n A 1 127 GLN 127 93 93 GLN GLN A . n A 1 128 THR 128 94 94 THR THR A . n A 1 129 VAL 129 95 95 VAL VAL A . n A 1 130 PHE 130 96 96 PHE PHE A . n A 1 131 HIS 131 97 97 HIS HIS A . n A 1 132 ALA 132 98 98 ALA ALA A . n A 1 133 HIS 133 99 99 HIS HIS A . n A 1 134 VAL 134 100 100 VAL VAL A . n A 1 135 HIS 135 101 101 HIS HIS A . n A 1 136 LEU 136 102 102 LEU LEU A . n A 1 137 VAL 137 103 103 VAL VAL A . n A 1 138 PRO 138 104 104 PRO PRO A . n A 1 139 ARG 139 105 105 ARG ARG A . n A 1 140 PHE 140 106 106 PHE PHE A . n A 1 141 ALA 141 107 107 ALA ALA A . n A 1 142 ASP 142 108 ? ? ? A . n A 1 143 SER 143 109 109 SER SER A . n A 1 144 ASP 144 110 110 ASP ASP A . n A 1 145 GLU 145 111 111 GLU GLU A . n A 1 146 PHE 146 112 112 PHE PHE A . n A 1 147 ASP 147 113 113 ASP ASP A . n A 1 148 ILE 148 114 114 ILE ILE A . n A 1 149 ARG 149 115 115 ARG ARG A . n A 1 150 PHE 150 116 116 PHE PHE A . n A 1 151 VAL 151 117 117 VAL VAL A . n A 1 152 GLN 152 118 118 GLN GLN A . n A 1 153 HIS 153 119 119 HIS HIS A . n A 1 154 GLU 154 120 120 GLU GLU A . n A 1 155 PRO 155 121 121 PRO PRO A . n A 1 156 ASP 156 122 122 ASP ASP A . n A 1 157 PHE 157 123 123 PHE PHE A . n A 1 158 THR 158 124 124 THR THR A . n A 1 159 ARG 159 125 125 ARG ARG A . n A 1 160 LEU 160 126 126 LEU LEU A . n A 1 161 GLY 161 127 127 GLY GLY A . n A 1 162 GLN 162 128 128 GLN GLN A . n A 1 163 LEU 163 129 129 LEU LEU A . n A 1 164 ALA 164 130 130 ALA ALA A . n A 1 165 GLU 165 131 131 GLU GLU A . n A 1 166 ASP 166 132 132 ASP ASP A . n A 1 167 ILE 167 133 133 ILE ILE A . n A 1 168 GLN 168 134 134 GLN GLN A . n A 1 169 LYS 169 135 135 LYS LYS A . n A 1 170 GLU 170 136 136 GLU GLU A . n A 1 171 ILE 171 137 137 ILE ILE A . n A 1 172 GLU 172 138 138 GLU GLU A . n A 1 173 ALA 173 139 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5900 ? 1 MORE -48 ? 1 'SSA (A^2)' 14890 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 131 ? A HIS 97 ? 1_555 ZN ? B ZN . ? A ZN 140 ? 1_555 ND1 ? A HIS 80 ? A HIS 46 ? 1_555 96.9 ? 2 ND1 ? A HIS 131 ? A HIS 97 ? 1_555 ZN ? B ZN . ? A ZN 140 ? 1_555 SG ? A CYS 38 ? A CYS 4 ? 1_555 107.5 ? 3 ND1 ? A HIS 80 ? A HIS 46 ? 1_555 ZN ? B ZN . ? A ZN 140 ? 1_555 SG ? A CYS 38 ? A CYS 4 ? 1_555 111.2 ? 4 ND1 ? A HIS 131 ? A HIS 97 ? 1_555 ZN ? B ZN . ? A ZN 140 ? 1_555 SG ? A CYS 41 ? A CYS 7 ? 1_555 113.9 ? 5 ND1 ? A HIS 80 ? A HIS 46 ? 1_555 ZN ? B ZN . ? A ZN 140 ? 1_555 SG ? A CYS 41 ? A CYS 7 ? 1_555 108.0 ? 6 SG ? A CYS 38 ? A CYS 4 ? 1_555 ZN ? B ZN . ? A ZN 140 ? 1_555 SG ? A CYS 41 ? A CYS 7 ? 1_555 117.4 ? 7 O ? A GLU 86 ? A GLU 52 ? 1_555 NA ? D NA . ? A NA 142 ? 1_555 O ? E HOH . ? A HOH 160 ? 1_555 85.0 ? 8 O ? A GLU 86 ? A GLU 52 ? 1_555 NA ? D NA . ? A NA 142 ? 1_555 OG1 ? A THR 25 ? A THR -9 ? 1_555 83.1 ? 9 O ? E HOH . ? A HOH 160 ? 1_555 NA ? D NA . ? A NA 142 ? 1_555 OG1 ? A THR 25 ? A THR -9 ? 1_555 94.7 ? 10 O ? A GLU 86 ? A GLU 52 ? 1_555 NA ? D NA . ? A NA 142 ? 1_555 OG ? A SER 23 ? A SER -11 ? 1_555 163.7 ? 11 O ? E HOH . ? A HOH 160 ? 1_555 NA ? D NA . ? A NA 142 ? 1_555 OG ? A SER 23 ? A SER -11 ? 1_555 93.5 ? 12 OG1 ? A THR 25 ? A THR -9 ? 1_555 NA ? D NA . ? A NA 142 ? 1_555 OG ? A SER 23 ? A SER -11 ? 1_555 80.8 ? 13 O ? A GLU 86 ? A GLU 52 ? 1_555 NA ? D NA . ? A NA 142 ? 1_555 O ? A GLY 26 ? A GLY -8 ? 1_555 102.0 ? 14 O ? E HOH . ? A HOH 160 ? 1_555 NA ? D NA . ? A NA 142 ? 1_555 O ? A GLY 26 ? A GLY -8 ? 1_555 151.3 ? 15 OG1 ? A THR 25 ? A THR -9 ? 1_555 NA ? D NA . ? A NA 142 ? 1_555 O ? A GLY 26 ? A GLY -8 ? 1_555 113.6 ? 16 OG ? A SER 23 ? A SER -11 ? 1_555 NA ? D NA . ? A NA 142 ? 1_555 O ? A GLY 26 ? A GLY -8 ? 1_555 87.1 ? 17 O ? A GLU 86 ? A GLU 52 ? 1_555 NA ? D NA . ? A NA 142 ? 1_555 O ? E HOH . ? A HOH 180 ? 1_555 94.0 ? 18 O ? E HOH . ? A HOH 160 ? 1_555 NA ? D NA . ? A NA 142 ? 1_555 O ? E HOH . ? A HOH 180 ? 1_555 67.4 ? 19 OG1 ? A THR 25 ? A THR -9 ? 1_555 NA ? D NA . ? A NA 142 ? 1_555 O ? E HOH . ? A HOH 180 ? 1_555 162.1 ? 20 OG ? A SER 23 ? A SER -11 ? 1_555 NA ? D NA . ? A NA 142 ? 1_555 O ? E HOH . ? A HOH 180 ? 1_555 100.4 ? 21 O ? A GLY 26 ? A GLY -8 ? 1_555 NA ? D NA . ? A NA 142 ? 1_555 O ? E HOH . ? A HOH 180 ? 1_555 84.3 ? 22 O ? E HOH . ? A HOH 153 ? 1_555 NA ? C NA . ? A NA 141 ? 1_555 O ? E HOH . ? A HOH 147 ? 1_555 152.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-12-08 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -9.6919 _pdbx_refine_tls.origin_y -10.3415 _pdbx_refine_tls.origin_z -6.3348 _pdbx_refine_tls.T[1][1] 0.0868 _pdbx_refine_tls.T[2][2] 0.1330 _pdbx_refine_tls.T[3][3] 0.1324 _pdbx_refine_tls.T[1][2] -0.0103 _pdbx_refine_tls.T[1][3] -0.0011 _pdbx_refine_tls.T[2][3] -0.0052 _pdbx_refine_tls.L[1][1] 0.4763 _pdbx_refine_tls.L[2][2] 0.5916 _pdbx_refine_tls.L[3][3] 2.5144 _pdbx_refine_tls.L[1][2] -0.0980 _pdbx_refine_tls.L[1][3] -0.2148 _pdbx_refine_tls.L[2][3] 0.2291 _pdbx_refine_tls.S[1][1] 0.0003 _pdbx_refine_tls.S[2][2] -0.0025 _pdbx_refine_tls.S[3][3] 0.0037 _pdbx_refine_tls.S[1][2] 0.0917 _pdbx_refine_tls.S[1][3] 0.0230 _pdbx_refine_tls.S[2][3] -0.0197 _pdbx_refine_tls.S[2][1] -0.0740 _pdbx_refine_tls.S[3][1] -0.1550 _pdbx_refine_tls.S[3][2] 0.1644 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A -20 A 138 all ? ? ? ? ? 'X-RAY DIFFRACTION' 2 1 A 1 A 140 all ? ? ? ? ? 'X-RAY DIFFRACTION' 3 1 A 1 A 142 all ? ? ? ? ? 'X-RAY DIFFRACTION' 4 1 A 1 A 206 all ? ? ? ? ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MOLREP phasing . ? 1 PHENIX refinement '(phenix.refine)' ? 2 HKL-2000 'data reduction' . ? 3 HKL-2000 'data scaling' . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 88 ? ? 74.76 165.00 2 1 PHE A 96 ? ? -93.23 46.13 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU -20 ? CG ? A LEU 14 CG 2 1 Y 1 A LEU -20 ? CD1 ? A LEU 14 CD1 3 1 Y 1 A LEU -20 ? CD2 ? A LEU 14 CD2 4 1 Y 1 A MET -10 ? CG ? A MET 24 CG 5 1 Y 1 A MET -10 ? SD ? A MET 24 SD 6 1 Y 1 A MET -10 ? CE ? A MET 24 CE 7 1 Y 1 A GLU 23 ? CG ? A GLU 57 CG 8 1 Y 1 A GLU 23 ? CD ? A GLU 57 CD 9 1 Y 1 A GLU 23 ? OE1 ? A GLU 57 OE1 10 1 Y 1 A GLU 23 ? OE2 ? A GLU 57 OE2 11 1 Y 1 A SER 109 ? OG ? A SER 143 OG 12 1 Y 1 A ARG 115 ? NE ? A ARG 149 NE 13 1 Y 1 A ARG 115 ? CZ ? A ARG 149 CZ 14 1 Y 1 A ARG 115 ? NH1 ? A ARG 149 NH1 15 1 Y 1 A ARG 115 ? NH2 ? A ARG 149 NH2 16 1 Y 1 A ARG 125 ? NE ? A ARG 159 NE 17 1 Y 1 A ARG 125 ? CZ ? A ARG 159 CZ 18 1 Y 1 A ARG 125 ? NH1 ? A ARG 159 NH1 19 1 Y 1 A ARG 125 ? NH2 ? A ARG 159 NH2 20 1 Y 1 A GLU 131 ? CG ? A GLU 165 CG 21 1 Y 1 A GLU 131 ? CD ? A GLU 165 CD 22 1 Y 1 A GLU 131 ? OE1 ? A GLU 165 OE1 23 1 Y 1 A GLU 131 ? OE2 ? A GLU 165 OE2 24 1 Y 1 A LYS 135 ? CE ? A LYS 169 CE 25 1 Y 1 A LYS 135 ? NZ ? A LYS 169 NZ 26 1 Y 1 A GLU 138 ? CG ? A GLU 172 CG 27 1 Y 1 A GLU 138 ? CD ? A GLU 172 CD 28 1 Y 1 A GLU 138 ? OE1 ? A GLU 172 OE1 29 1 Y 1 A GLU 138 ? OE2 ? A GLU 172 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -33 ? A MET 1 2 1 Y 1 A GLY -32 ? A GLY 2 3 1 Y 1 A SER -31 ? A SER 3 4 1 Y 1 A SER -30 ? A SER 4 5 1 Y 1 A HIS -29 ? A HIS 5 6 1 Y 1 A HIS -28 ? A HIS 6 7 1 Y 1 A HIS -27 ? A HIS 7 8 1 Y 1 A HIS -26 ? A HIS 8 9 1 Y 1 A HIS -25 ? A HIS 9 10 1 Y 1 A HIS -24 ? A HIS 10 11 1 Y 1 A SER -23 ? A SER 11 12 1 Y 1 A SER -22 ? A SER 12 13 1 Y 1 A GLY -21 ? A GLY 13 14 1 Y 1 A ARG -2 ? A ARG 32 15 1 Y 1 A ASP 108 ? A ASP 142 16 1 Y 1 A ALA 139 ? A ALA 173 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'SODIUM ION' NA 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 140 140 ZN ZN A . C 3 NA 1 141 141 NA NA A . D 3 NA 1 142 142 NA NA A . E 4 HOH 1 143 143 HOH HOH A . E 4 HOH 2 144 144 HOH HOH A . E 4 HOH 3 145 145 HOH HOH A . E 4 HOH 4 146 146 HOH HOH A . E 4 HOH 5 147 147 HOH HOH A . E 4 HOH 6 148 148 HOH HOH A . E 4 HOH 7 149 149 HOH HOH A . E 4 HOH 8 150 150 HOH HOH A . E 4 HOH 9 151 151 HOH HOH A . E 4 HOH 10 152 152 HOH HOH A . E 4 HOH 11 153 153 HOH HOH A . E 4 HOH 12 154 154 HOH HOH A . E 4 HOH 13 155 155 HOH HOH A . E 4 HOH 14 156 156 HOH HOH A . E 4 HOH 15 157 157 HOH HOH A . E 4 HOH 16 158 158 HOH HOH A . E 4 HOH 17 159 159 HOH HOH A . E 4 HOH 18 160 160 HOH HOH A . E 4 HOH 19 161 161 HOH HOH A . E 4 HOH 20 162 162 HOH HOH A . E 4 HOH 21 163 163 HOH HOH A . E 4 HOH 22 164 164 HOH HOH A . E 4 HOH 23 165 165 HOH HOH A . E 4 HOH 24 166 166 HOH HOH A . E 4 HOH 25 167 167 HOH HOH A . E 4 HOH 26 168 168 HOH HOH A . E 4 HOH 27 169 169 HOH HOH A . E 4 HOH 28 172 172 HOH HOH A . E 4 HOH 29 173 173 HOH HOH A . E 4 HOH 30 174 174 HOH HOH A . E 4 HOH 31 175 175 HOH HOH A . E 4 HOH 32 176 176 HOH HOH A . E 4 HOH 33 177 177 HOH HOH A . E 4 HOH 34 179 179 HOH HOH A . E 4 HOH 35 180 180 HOH HOH A . E 4 HOH 36 181 181 HOH HOH A . E 4 HOH 37 182 182 HOH HOH A . E 4 HOH 38 183 183 HOH HOH A . E 4 HOH 39 184 184 HOH HOH A . E 4 HOH 40 185 185 HOH HOH A . E 4 HOH 41 187 187 HOH HOH A . E 4 HOH 42 188 188 HOH HOH A . E 4 HOH 43 189 189 HOH HOH A . E 4 HOH 44 190 190 HOH HOH A . E 4 HOH 45 191 191 HOH HOH A . E 4 HOH 46 192 192 HOH HOH A . E 4 HOH 47 193 193 HOH HOH A . E 4 HOH 48 194 194 HOH HOH A . E 4 HOH 49 195 195 HOH HOH A . E 4 HOH 50 196 196 HOH HOH A . E 4 HOH 51 197 197 HOH HOH A . E 4 HOH 52 198 198 HOH HOH A . E 4 HOH 53 199 199 HOH HOH A . E 4 HOH 54 200 200 HOH HOH A . E 4 HOH 55 201 201 HOH HOH A . E 4 HOH 56 202 202 HOH HOH A . E 4 HOH 57 203 203 HOH HOH A . E 4 HOH 58 204 204 HOH HOH A . E 4 HOH 59 205 205 HOH HOH A . E 4 HOH 60 206 206 HOH HOH A . #