data_3LLJ # _entry.id 3LLJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3LLJ RCSB RCSB057425 WWPDB D_1000057425 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2011-03-09 _pdbx_database_PDB_obs_spr.pdb_id 3QGZ _pdbx_database_PDB_obs_spr.replace_pdb_id 3LLJ _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3RHN 'The same protein complexed with GMP' unspecified PDB 4RHN 'The same protein complexed with AMP' unspecified PDB 5RHN 'The same protein complexed with 8-Br-AMP' unspecified PDB 6RHN 'The same protein in native state' unspecified PDB 1RZY 'The same protein comlexed with 8-ethylsulphamoyladenosine' unspecified # _pdbx_database_status.status_code OBS _pdbx_database_status.entry_id 3LLJ _pdbx_database_status.recvd_initial_deposition_date 2010-01-29 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dolot, R.M.' 1 'Ozga, M.' 2 'Krakowiak, A.K.' 3 'Nawrot, B.' 4 'Stec, W.J.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Re-investigated high resolution crystal structure of histidine triad nucleotide-binding protein 1 (Hint1) from rabbit complexed with adenosine ; 'To be Published' ? ? ? 2010 ? ? ? 0353 ? ? ? 1 ;Crystal structures of HINT demonstrate that histidine triad proteins are GalT-related nucleotide-binding proteins. ; Nat.Struct.Biol. 4 231 238 1997 NSBIEW US 1072-8368 2024 ? 9164465 ? 2 ;Biochemical, crystallographic, and mutagenic characterization of hint, the AMP-lysine hydrolase, with novel substrates and inhibitors ; J.Biol.Chem. 279 18711 18716 2004 JBCHA3 US 0021-9258 0071 ? 14982931 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Dolot, R.M.' 1 primary 'Ozga, M.' 2 primary 'Krakowiak, A.' 3 primary 'Nawrot, B.' 4 primary 'Stec, W.J.' 5 1 'Brenner, C.' 6 1 'Garrison, P.' 7 1 'Gilmour, J.' 8 1 'Peisach, D.' 9 1 'Ringe, D.' 10 1 'Petsko, G.A.' 11 1 'Lowenstein, J.M.' 12 2 'Krakowiak, A.K.' 13 2 'Pace, H.C.' 14 2 'Blackburn, G.M.' 15 2 'Adams, M.' 16 2 'Mekhalfia, A.' 17 2 'Kaczmarek, R.' 18 2 'Baraniak, J.' 19 2 'Stec, W.J.' 20 2 'Brenner, C.' 21 # _cell.entry_id 3LLJ _cell.length_a 39.748 _cell.length_b 39.748 _cell.length_c 141.942 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3LLJ _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Histidine triad nucleotide-binding protein 1' 13713.835 1 3.-.-.- ? ? ? 2 non-polymer syn ADENOSINE 267.241 1 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 4 water nat water 18.015 167 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Adenosine 5'-monophosphoramidase, P13.7 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIV GKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG ; _entity_poly.pdbx_seq_one_letter_code_can ;MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIV GKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ASP n 1 4 GLU n 1 5 ILE n 1 6 ALA n 1 7 LYS n 1 8 ALA n 1 9 GLN n 1 10 VAL n 1 11 ALA n 1 12 ARG n 1 13 PRO n 1 14 GLY n 1 15 GLY n 1 16 ASP n 1 17 THR n 1 18 ILE n 1 19 PHE n 1 20 GLY n 1 21 LYS n 1 22 ILE n 1 23 ILE n 1 24 ARG n 1 25 LYS n 1 26 GLU n 1 27 ILE n 1 28 PRO n 1 29 ALA n 1 30 LYS n 1 31 ILE n 1 32 ILE n 1 33 PHE n 1 34 GLU n 1 35 ASP n 1 36 ASP n 1 37 GLN n 1 38 CYS n 1 39 LEU n 1 40 ALA n 1 41 PHE n 1 42 HIS n 1 43 ASP n 1 44 ILE n 1 45 SER n 1 46 PRO n 1 47 GLN n 1 48 ALA n 1 49 PRO n 1 50 THR n 1 51 HIS n 1 52 PHE n 1 53 LEU n 1 54 VAL n 1 55 ILE n 1 56 PRO n 1 57 LYS n 1 58 LYS n 1 59 HIS n 1 60 ILE n 1 61 SER n 1 62 GLN n 1 63 ILE n 1 64 SER n 1 65 ALA n 1 66 ALA n 1 67 GLU n 1 68 ASP n 1 69 ALA n 1 70 ASP n 1 71 GLU n 1 72 SER n 1 73 LEU n 1 74 LEU n 1 75 GLY n 1 76 HIS n 1 77 LEU n 1 78 MET n 1 79 ILE n 1 80 VAL n 1 81 GLY n 1 82 LYS n 1 83 LYS n 1 84 CYS n 1 85 ALA n 1 86 ALA n 1 87 ASP n 1 88 LEU n 1 89 GLY n 1 90 LEU n 1 91 LYS n 1 92 LYS n 1 93 GLY n 1 94 TYR n 1 95 ARG n 1 96 MET n 1 97 VAL n 1 98 VAL n 1 99 ASN n 1 100 GLU n 1 101 GLY n 1 102 SER n 1 103 ASP n 1 104 GLY n 1 105 GLY n 1 106 GLN n 1 107 SER n 1 108 VAL n 1 109 TYR n 1 110 HIS n 1 111 VAL n 1 112 HIS n 1 113 LEU n 1 114 HIS n 1 115 VAL n 1 116 LEU n 1 117 GLY n 1 118 GLY n 1 119 ARG n 1 120 GLN n 1 121 MET n 1 122 ASN n 1 123 TRP n 1 124 PRO n 1 125 PRO n 1 126 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'European rabbit,Japanese white rabbit,domestic rabbit,rabbits' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HINT, HINT1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Oryctolagus cuniculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9986 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pSGo2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HINT1_RABIT _struct_ref.pdbx_db_accession P80912 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIV GKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3LLJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 126 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P80912 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 126 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 126 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ADN non-polymer . ADENOSINE ? 'C10 H13 N5 O4' 267.241 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3LLJ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.04 _exptl_crystal.density_percent_sol 39.83 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 281 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '25% PEG 8000, 0.1M cacodylate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 281K' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MAR CCD 165 mm' _diffrn_detector.pdbx_collection_date 2009-11-21 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Bent Si (111) crystal, horizontally focusing' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0380 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'MAX II BEAMLINE I911-2' _diffrn_source.pdbx_synchrotron_site 'MAX II' _diffrn_source.pdbx_synchrotron_beamline I911-2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.0380 # _reflns.entry_id 3LLJ _reflns.observed_criterion_sigma_I -3 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 99.0 _reflns.d_resolution_high 1.10 _reflns.number_obs 44471 _reflns.number_all ? _reflns.percent_possible_obs 98.6 _reflns.pdbx_Rmerge_I_obs 0.110 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 23.48 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 16.4 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.10 _reflns_shell.d_res_low 1.12 _reflns_shell.percent_possible_all 96.7 _reflns_shell.Rmerge_I_obs 0.603 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.97 _reflns_shell.pdbx_redundancy 10.8 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 3LLJ _refine.ls_number_reflns_obs 44471 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 38.28 _refine.ls_d_res_high 1.10 _refine.ls_percent_reflns_obs 98.78 _refine.ls_R_factor_obs 0.15940 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.15778 _refine.ls_R_factor_R_free 0.19074 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 2370 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.973 _refine.correlation_coeff_Fo_to_Fc_free 0.960 _refine.B_iso_mean 20.050 _refine.aniso_B[1][1] 0.02 _refine.aniso_B[2][2] 0.02 _refine.aniso_B[3][3] -0.04 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'PDB entry 1RZY' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ANISOTROPIC _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.034 _refine.pdbx_overall_ESU_R_Free 0.036 _refine.overall_SU_ML 0.018 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 0.806 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 884 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 167 _refine_hist.number_atoms_total 1071 _refine_hist.d_res_high 1.10 _refine_hist.d_res_low 38.28 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.026 0.021 ? 1105 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 2.456 2.004 ? 1521 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.331 5.000 ? 147 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 39.019 24.419 ? 43 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 12.985 15.000 ? 186 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 10.674 15.000 ? 4 'X-RAY DIFFRACTION' ? r_chiral_restr 0.403 0.200 ? 160 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.015 0.021 ? 873 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 2.692 1.500 ? 675 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 3.934 2.000 ? 1108 'X-RAY DIFFRACTION' ? r_scbond_it 5.336 3.000 ? 430 'X-RAY DIFFRACTION' ? r_scangle_it 7.204 4.500 ? 413 'X-RAY DIFFRACTION' ? r_rigid_bond_restr 2.946 3.000 ? 1105 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.100 _refine_ls_shell.d_res_low 1.129 _refine_ls_shell.number_reflns_R_work 3138 _refine_ls_shell.R_factor_R_work 0.333 _refine_ls_shell.percent_reflns_obs 97.07 _refine_ls_shell.R_factor_R_free 0.339 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 179 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 3LLJ _struct.title ;Re-investigated high resolution crystal structure of histidine triad nucleotide-binding protein 1 (Hint1) from rabbit complexed with adenosine ; _struct.pdbx_descriptor 'Histidine triad nucleotide-binding protein 1 (E.C.3.-.-.-)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3LLJ _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;HINT PROTEIN, HIT PROTEIN, HYDROLASE, ADENOSINE 5'-MONOPHOSPHORAMIDASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 17 ? ARG A 24 ? THR A 17 ARG A 24 1 ? 8 HELX_P HELX_P2 2 GLN A 62 ? ALA A 66 ? GLN A 62 ALA A 66 5 ? 5 HELX_P HELX_P3 3 GLU A 67 ? ALA A 69 ? GLU A 67 ALA A 69 5 ? 3 HELX_P HELX_P4 4 ASP A 70 ? LEU A 88 ? ASP A 70 LEU A 88 1 ? 19 HELX_P HELX_P5 5 GLU A 100 ? GLY A 105 ? GLU A 100 GLY A 105 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TRP _struct_mon_prot_cis.label_seq_id 123 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TRP _struct_mon_prot_cis.auth_seq_id 123 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 124 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 124 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 7.29 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 31 ? GLU A 34 ? ILE A 31 GLU A 34 A 2 CYS A 38 ? HIS A 42 ? CYS A 38 HIS A 42 A 3 THR A 50 ? PRO A 56 ? THR A 50 PRO A 56 A 4 LEU A 113 ? GLY A 117 ? LEU A 113 GLY A 117 A 5 TYR A 94 ? VAL A 97 ? TYR A 94 VAL A 97 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 32 ? N ILE A 32 O ALA A 40 ? O ALA A 40 A 2 3 N LEU A 39 ? N LEU A 39 O ILE A 55 ? O ILE A 55 A 3 4 N VAL A 54 ? N VAL A 54 O LEU A 113 ? O LEU A 113 A 4 5 O HIS A 114 ? O HIS A 114 N VAL A 97 ? N VAL A 97 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE ADN A 1450' AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 127' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 20 ILE A 18 ? ILE A 18 . ? 1_555 ? 2 AC1 20 PHE A 19 ? PHE A 19 . ? 1_555 ? 3 AC1 20 LYS A 25 ? LYS A 25 . ? 5_454 ? 4 AC1 20 GLU A 34 ? GLU A 34 . ? 5_454 ? 5 AC1 20 PHE A 41 ? PHE A 41 . ? 1_555 ? 6 AC1 20 HIS A 42 ? HIS A 42 . ? 1_555 ? 7 AC1 20 ASP A 43 ? ASP A 43 . ? 1_555 ? 8 AC1 20 ILE A 44 ? ILE A 44 . ? 1_555 ? 9 AC1 20 SER A 45 ? SER A 45 . ? 1_555 ? 10 AC1 20 LEU A 53 ? LEU A 53 . ? 1_555 ? 11 AC1 20 HIS A 112 ? HIS A 112 . ? 1_555 ? 12 AC1 20 HIS A 114 ? HIS A 114 . ? 1_555 ? 13 AC1 20 HOH D . ? HOH A 136 . ? 1_555 ? 14 AC1 20 HOH D . ? HOH A 137 . ? 1_555 ? 15 AC1 20 HOH D . ? HOH A 153 . ? 1_555 ? 16 AC1 20 HOH D . ? HOH A 198 . ? 1_555 ? 17 AC1 20 HOH D . ? HOH A 200 . ? 1_555 ? 18 AC1 20 HOH D . ? HOH A 210 . ? 1_555 ? 19 AC1 20 HOH D . ? HOH A 251 . ? 1_555 ? 20 AC1 20 HOH D . ? HOH A 272 . ? 1_555 ? 21 AC2 5 GLY A 15 ? GLY A 15 . ? 1_555 ? 22 AC2 5 ASP A 16 ? ASP A 16 . ? 1_555 ? 23 AC2 5 THR A 17 ? THR A 17 . ? 1_555 ? 24 AC2 5 LYS A 21 ? LYS A 21 . ? 1_555 ? 25 AC2 5 ARG A 24 ? ARG A 24 . ? 1_555 ? # _database_PDB_matrix.entry_id 3LLJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3LLJ _atom_sites.fract_transf_matrix[1][1] 0.025158 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.025158 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007045 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N NA O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 ILE 5 5 ? ? ? A . n A 1 6 ALA 6 6 ? ? ? A . n A 1 7 LYS 7 7 ? ? ? A . n A 1 8 ALA 8 8 ? ? ? A . n A 1 9 GLN 9 9 ? ? ? A . n A 1 10 VAL 10 10 ? ? ? A . n A 1 11 ALA 11 11 ? ? ? A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 MET 96 96 96 MET MET A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 TYR 109 109 109 TYR TYR A . n A 1 110 HIS 110 110 110 HIS HIS A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 HIS 112 112 112 HIS HIS A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 MET 121 121 121 MET MET A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 TRP 123 123 123 TRP TRP A . n A 1 124 PRO 124 124 124 PRO PRO A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 GLY 126 126 126 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ADN 1 1450 1450 ADN ADN A . C 3 NA 1 127 1 NA NA A . D 4 HOH 1 128 128 HOH HOH A . D 4 HOH 2 129 129 HOH HOH A . D 4 HOH 3 130 130 HOH HOH A . D 4 HOH 4 131 131 HOH HOH A . D 4 HOH 5 132 132 HOH HOH A . D 4 HOH 6 133 133 HOH HOH A . D 4 HOH 7 134 134 HOH HOH A . D 4 HOH 8 135 135 HOH HOH A . D 4 HOH 9 136 136 HOH HOH A . D 4 HOH 10 137 137 HOH HOH A . D 4 HOH 11 138 138 HOH HOH A . D 4 HOH 12 139 139 HOH HOH A . D 4 HOH 13 140 140 HOH HOH A . D 4 HOH 14 141 141 HOH HOH A . D 4 HOH 15 142 142 HOH HOH A . D 4 HOH 16 143 143 HOH HOH A . D 4 HOH 17 144 144 HOH HOH A . D 4 HOH 18 145 145 HOH HOH A . D 4 HOH 19 146 146 HOH HOH A . D 4 HOH 20 147 147 HOH HOH A . D 4 HOH 21 148 148 HOH HOH A . D 4 HOH 22 149 149 HOH HOH A . D 4 HOH 23 150 150 HOH HOH A . D 4 HOH 24 151 151 HOH HOH A . D 4 HOH 25 152 152 HOH HOH A . D 4 HOH 26 153 153 HOH HOH A . D 4 HOH 27 154 154 HOH HOH A . D 4 HOH 28 155 155 HOH HOH A . D 4 HOH 29 156 156 HOH HOH A . D 4 HOH 30 157 157 HOH HOH A . D 4 HOH 31 158 158 HOH HOH A . D 4 HOH 32 159 159 HOH HOH A . D 4 HOH 33 160 160 HOH HOH A . D 4 HOH 34 161 161 HOH HOH A . D 4 HOH 35 162 162 HOH HOH A . D 4 HOH 36 163 163 HOH HOH A . D 4 HOH 37 164 164 HOH HOH A . D 4 HOH 38 165 165 HOH HOH A . D 4 HOH 39 166 166 HOH HOH A . D 4 HOH 40 167 167 HOH HOH A . D 4 HOH 41 168 168 HOH HOH A . D 4 HOH 42 169 169 HOH HOH A . D 4 HOH 43 170 170 HOH HOH A . D 4 HOH 44 171 171 HOH HOH A . D 4 HOH 45 172 172 HOH HOH A . D 4 HOH 46 173 173 HOH HOH A . D 4 HOH 47 174 174 HOH HOH A . D 4 HOH 48 175 175 HOH HOH A . D 4 HOH 49 176 176 HOH HOH A . D 4 HOH 50 177 177 HOH HOH A . D 4 HOH 51 178 178 HOH HOH A . D 4 HOH 52 179 179 HOH HOH A . D 4 HOH 53 180 180 HOH HOH A . D 4 HOH 54 181 181 HOH HOH A . D 4 HOH 55 182 182 HOH HOH A . D 4 HOH 56 183 183 HOH HOH A . D 4 HOH 57 184 184 HOH HOH A . D 4 HOH 58 185 185 HOH HOH A . D 4 HOH 59 186 186 HOH HOH A . D 4 HOH 60 187 187 HOH HOH A . D 4 HOH 61 188 188 HOH HOH A . D 4 HOH 62 189 189 HOH HOH A . D 4 HOH 63 190 190 HOH HOH A . D 4 HOH 64 191 191 HOH HOH A . D 4 HOH 65 192 192 HOH HOH A . D 4 HOH 66 193 193 HOH HOH A . D 4 HOH 67 194 194 HOH HOH A . D 4 HOH 68 195 195 HOH HOH A . D 4 HOH 69 196 196 HOH HOH A . D 4 HOH 70 197 197 HOH HOH A . D 4 HOH 71 198 198 HOH HOH A . D 4 HOH 72 199 199 HOH HOH A . D 4 HOH 73 200 200 HOH HOH A . D 4 HOH 74 201 201 HOH HOH A . D 4 HOH 75 202 202 HOH HOH A . D 4 HOH 76 203 203 HOH HOH A . D 4 HOH 77 204 204 HOH HOH A . D 4 HOH 78 205 205 HOH HOH A . D 4 HOH 79 206 206 HOH HOH A . D 4 HOH 80 207 207 HOH HOH A . D 4 HOH 81 208 208 HOH HOH A . D 4 HOH 82 209 209 HOH HOH A . D 4 HOH 83 210 210 HOH HOH A . D 4 HOH 84 211 211 HOH HOH A . D 4 HOH 85 212 212 HOH HOH A . D 4 HOH 86 213 213 HOH HOH A . D 4 HOH 87 214 214 HOH HOH A . D 4 HOH 88 215 215 HOH HOH A . D 4 HOH 89 216 216 HOH HOH A . D 4 HOH 90 217 217 HOH HOH A . D 4 HOH 91 218 218 HOH HOH A . D 4 HOH 92 219 219 HOH HOH A . D 4 HOH 93 220 220 HOH HOH A . D 4 HOH 94 221 221 HOH HOH A . D 4 HOH 95 222 222 HOH HOH A . D 4 HOH 96 223 223 HOH HOH A . D 4 HOH 97 224 224 HOH HOH A . D 4 HOH 98 225 225 HOH HOH A . D 4 HOH 99 226 226 HOH HOH A . D 4 HOH 100 227 227 HOH HOH A . D 4 HOH 101 228 228 HOH HOH A . D 4 HOH 102 229 229 HOH HOH A . D 4 HOH 103 230 230 HOH HOH A . D 4 HOH 104 231 231 HOH HOH A . D 4 HOH 105 232 232 HOH HOH A . D 4 HOH 106 233 233 HOH HOH A . D 4 HOH 107 234 234 HOH HOH A . D 4 HOH 108 235 235 HOH HOH A . D 4 HOH 109 236 236 HOH HOH A . D 4 HOH 110 237 237 HOH HOH A . D 4 HOH 111 238 238 HOH HOH A . D 4 HOH 112 239 239 HOH HOH A . D 4 HOH 113 240 240 HOH HOH A . D 4 HOH 114 241 241 HOH HOH A . D 4 HOH 115 242 242 HOH HOH A . D 4 HOH 116 243 243 HOH HOH A . D 4 HOH 117 244 244 HOH HOH A . D 4 HOH 118 245 245 HOH HOH A . D 4 HOH 119 246 246 HOH HOH A . D 4 HOH 120 247 247 HOH HOH A . D 4 HOH 121 248 248 HOH HOH A . D 4 HOH 122 249 249 HOH HOH A . D 4 HOH 123 250 250 HOH HOH A . D 4 HOH 124 251 251 HOH HOH A . D 4 HOH 125 252 252 HOH HOH A . D 4 HOH 126 253 253 HOH HOH A . D 4 HOH 127 254 254 HOH HOH A . D 4 HOH 128 255 255 HOH HOH A . D 4 HOH 129 256 256 HOH HOH A . D 4 HOH 130 257 257 HOH HOH A . D 4 HOH 131 258 258 HOH HOH A . D 4 HOH 132 259 259 HOH HOH A . D 4 HOH 133 260 260 HOH HOH A . D 4 HOH 134 261 261 HOH HOH A . D 4 HOH 135 262 262 HOH HOH A . D 4 HOH 136 263 263 HOH HOH A . D 4 HOH 137 264 264 HOH HOH A . D 4 HOH 138 265 265 HOH HOH A . D 4 HOH 139 266 266 HOH HOH A . D 4 HOH 140 267 267 HOH HOH A . D 4 HOH 141 268 268 HOH HOH A . D 4 HOH 142 269 269 HOH HOH A . D 4 HOH 143 270 270 HOH HOH A . D 4 HOH 144 271 271 HOH HOH A . D 4 HOH 145 272 272 HOH HOH A . D 4 HOH 146 273 273 HOH HOH A . D 4 HOH 147 274 274 HOH HOH A . D 4 HOH 148 275 275 HOH HOH A . D 4 HOH 149 276 276 HOH HOH A . D 4 HOH 150 277 277 HOH HOH A . D 4 HOH 151 278 278 HOH HOH A . D 4 HOH 152 279 279 HOH HOH A . D 4 HOH 153 280 280 HOH HOH A . D 4 HOH 154 281 281 HOH HOH A . D 4 HOH 155 282 282 HOH HOH A . D 4 HOH 156 283 283 HOH HOH A . D 4 HOH 157 284 284 HOH HOH A . D 4 HOH 158 285 285 HOH HOH A . D 4 HOH 159 286 286 HOH HOH A . D 4 HOH 160 287 287 HOH HOH A . D 4 HOH 161 288 288 HOH HOH A . D 4 HOH 162 289 289 HOH HOH A . D 4 HOH 163 290 290 HOH HOH A . D 4 HOH 164 291 291 HOH HOH A . D 4 HOH 165 292 292 HOH HOH A . D 4 HOH 166 293 293 HOH HOH A . D 4 HOH 167 294 127 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4920 ? 1 MORE -17 ? 1 'SSA (A^2)' 9410 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-04-14 2 'Structure model' 1 1 2011-03-09 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MARCCD 'data collection' . ? 1 MOLREP 'model building' 10.2.31 ? 2 REFMAC refinement 5.5.0102 ? 3 DENZO 'data reduction' . ? 4 SCALEPACK 'data scaling' . ? 5 MOLREP phasing 10.2.31 ? 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OG A SER 107 ? A O A HOH 272 ? ? 1.99 2 1 N6 A ADN 1450 ? B O A HOH 136 ? ? 1.99 3 1 N6 A ADN 1450 ? A O A HOH 136 ? ? 2.10 4 1 O A HOH 161 ? ? O A HOH 168 ? ? 2.16 5 1 N6 A ADN 1450 ? A O A HOH 153 ? ? 2.16 6 1 N6 A ADN 1450 ? B O A HOH 153 ? ? 2.18 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 100 ? ? OE1 A GLU 100 ? ? 1.321 1.252 0.069 0.011 N 2 1 CB A VAL 111 ? B CG2 A VAL 111 ? B 1.358 1.524 -0.166 0.021 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 45 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id B _pdbx_validate_torsion.phi -116.24 _pdbx_validate_torsion.psi 61.61 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id "C3'" _pdbx_validate_chiral.label_alt_id B _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id ADN _pdbx_validate_chiral.auth_seq_id 1450 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details 'WRONG HAND' _pdbx_validate_chiral.omega . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A ILE 5 ? A ILE 5 6 1 Y 1 A ALA 6 ? A ALA 6 7 1 Y 1 A LYS 7 ? A LYS 7 8 1 Y 1 A ALA 8 ? A ALA 8 9 1 Y 1 A GLN 9 ? A GLN 9 10 1 Y 1 A VAL 10 ? A VAL 10 11 1 Y 1 A ALA 11 ? A ALA 11 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ADENOSINE ADN 3 'SODIUM ION' NA 4 water HOH #