data_3LMF # _entry.id 3LMF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.312 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3LMF RCSB RCSB057457 WWPDB D_1000057457 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id NmR72 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 3LMF _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-01-29 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Forouhar, F.' 1 'Lew, S.' 2 'Seetharaman, J.' 3 'Sahdev, S.' 4 'Xiao, R.' 5 'Ciccosanti, C.' 6 'Lee, D.' 7 'Everett, J.K.' 8 'Nair, R.' 9 'Acton, T.B.' 10 'Rost, B.' 11 'Montelione, G.T.' 12 'Tong, L.' 13 'Hunt, J.F.' 14 'Northeast Structural Genomics Consortium (NESG)' 15 # _citation.id primary _citation.title 'Northeast Structural Genomics Consortium Target NmR72' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Forouhar, F.' 1 ? primary 'Lew, S.' 2 ? primary 'Seetharaman, J.' 3 ? primary 'Sahdev, S.' 4 ? primary 'Xiao, R.' 5 ? primary 'Ciccosanti, C.' 6 ? primary 'Lee, D.' 7 ? primary 'Everett, J.K.' 8 ? primary 'Nair, R.' 9 ? primary 'Acton, T.B.' 10 ? primary 'Rost, B.' 11 ? primary 'Montelione, G.T.' 12 ? primary 'Tong, L.' 13 ? primary 'Hunt, J.F.' 14 ? # _cell.entry_id 3LMF _cell.length_a 94.417 _cell.length_b 94.417 _cell.length_c 72.688 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.pdbx_unique_axis ? _cell.Z_PDB 12 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3LMF _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.Int_Tables_number 181 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized protein' 14090.048 1 ? ? ? ? 2 water nat water 18.015 32 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)FLYTETDQNLQACIDACNHCYRTCLR(MSE)A(MSE)NHCLEAGGKHVEADHLRL(MSE)(MSE)NCAEICQTSL NF(MSE)LSGSRFSPKVCGVCAEICDACAKSCEQLDG(MSE)EECVQTCRQCAEHCRK(MSE)AALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MFLYTETDQNLQACIDACNHCYRTCLRMAMNHCLEAGGKHVEADHLRLMMNCAEICQTSLNFMLSGSRFSPKVCGVCAEI CDACAKSCEQLDGMEECVQTCRQCAEHCRKMAALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NmR72 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 PHE n 1 3 LEU n 1 4 TYR n 1 5 THR n 1 6 GLU n 1 7 THR n 1 8 ASP n 1 9 GLN n 1 10 ASN n 1 11 LEU n 1 12 GLN n 1 13 ALA n 1 14 CYS n 1 15 ILE n 1 16 ASP n 1 17 ALA n 1 18 CYS n 1 19 ASN n 1 20 HIS n 1 21 CYS n 1 22 TYR n 1 23 ARG n 1 24 THR n 1 25 CYS n 1 26 LEU n 1 27 ARG n 1 28 MSE n 1 29 ALA n 1 30 MSE n 1 31 ASN n 1 32 HIS n 1 33 CYS n 1 34 LEU n 1 35 GLU n 1 36 ALA n 1 37 GLY n 1 38 GLY n 1 39 LYS n 1 40 HIS n 1 41 VAL n 1 42 GLU n 1 43 ALA n 1 44 ASP n 1 45 HIS n 1 46 LEU n 1 47 ARG n 1 48 LEU n 1 49 MSE n 1 50 MSE n 1 51 ASN n 1 52 CYS n 1 53 ALA n 1 54 GLU n 1 55 ILE n 1 56 CYS n 1 57 GLN n 1 58 THR n 1 59 SER n 1 60 LEU n 1 61 ASN n 1 62 PHE n 1 63 MSE n 1 64 LEU n 1 65 SER n 1 66 GLY n 1 67 SER n 1 68 ARG n 1 69 PHE n 1 70 SER n 1 71 PRO n 1 72 LYS n 1 73 VAL n 1 74 CYS n 1 75 GLY n 1 76 VAL n 1 77 CYS n 1 78 ALA n 1 79 GLU n 1 80 ILE n 1 81 CYS n 1 82 ASP n 1 83 ALA n 1 84 CYS n 1 85 ALA n 1 86 LYS n 1 87 SER n 1 88 CYS n 1 89 GLU n 1 90 GLN n 1 91 LEU n 1 92 ASP n 1 93 GLY n 1 94 MSE n 1 95 GLU n 1 96 GLU n 1 97 CYS n 1 98 VAL n 1 99 GLN n 1 100 THR n 1 101 CYS n 1 102 ARG n 1 103 GLN n 1 104 CYS n 1 105 ALA n 1 106 GLU n 1 107 HIS n 1 108 CYS n 1 109 ARG n 1 110 LYS n 1 111 MSE n 1 112 ALA n 1 113 ALA n 1 114 LEU n 1 115 GLU n 1 116 HIS n 1 117 HIS n 1 118 HIS n 1 119 HIS n 1 120 HIS n 1 121 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Nmul_A1745 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 25196' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Nitrosospira multiformis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 323848 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+ Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pET 21-23C' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q2Y879_NITMU _struct_ref.pdbx_db_accession Q2Y879 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MFLYTETDQNLQACIDACNHCYRTCLRMAMNHCLEAGGKHVEADHLRLMMNCAEICQTSLNFMLSGSRFSPKVCGVCAEI CDACAKSCEQLDGMEECVQTCRQCAEHCRKMAA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3LMF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 113 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q2Y879 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 113 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 113 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3LMF LEU A 114 ? UNP Q2Y879 ? ? 'EXPRESSION TAG' 114 1 1 3LMF GLU A 115 ? UNP Q2Y879 ? ? 'EXPRESSION TAG' 115 2 1 3LMF HIS A 116 ? UNP Q2Y879 ? ? 'EXPRESSION TAG' 116 3 1 3LMF HIS A 117 ? UNP Q2Y879 ? ? 'EXPRESSION TAG' 117 4 1 3LMF HIS A 118 ? UNP Q2Y879 ? ? 'EXPRESSION TAG' 118 5 1 3LMF HIS A 119 ? UNP Q2Y879 ? ? 'EXPRESSION TAG' 119 6 1 3LMF HIS A 120 ? UNP Q2Y879 ? ? 'EXPRESSION TAG' 120 7 1 3LMF HIS A 121 ? UNP Q2Y879 ? ? 'EXPRESSION TAG' 121 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 3LMF _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 3.32 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 62.94 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'Microbatch, under oil' _exptl_crystal_grow.pH 8 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.pdbx_details ;Protein solution: 100mM NaCl, 5mM DTT, 0.02% NaN3, 10mM Tris-HCl (pH 7.5), Reservoir solution: 0.1M Tris (pH 8), 12% PEG 20K, and 0.1M KH2PO4, Microbatch, under oil, temperature 277K ; _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2010-01-20 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97912 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_wavelength_list 0.97912 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A # _reflns.entry_id 3LMF _reflns.B_iso_Wilson_estimate 13.600 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 2.3 _reflns.d_resolution_low 30 _reflns.number_all 11161 _reflns.number_obs 11150 _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.137 _reflns.pdbx_Rsym_value 0.12 _reflns.pdbx_netI_over_sigmaI 28 _reflns.pdbx_redundancy 21.6 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.3 _reflns_shell.d_res_low 2.69 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.544 _reflns_shell.meanI_over_sigI_obs 10.5 _reflns_shell.pdbx_Rsym_value 0.593 _reflns_shell.pdbx_redundancy 23.2 _reflns_shell.number_unique_all 1137 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3LMF _refine.ls_d_res_high 2.300 _refine.ls_d_res_low 19.800 _refine.pdbx_ls_sigma_F 2.00 _refine.pdbx_data_cutoff_high_absF 79242.969 _refine.pdbx_data_cutoff_low_absF 0.000 _refine.ls_percent_reflns_obs 91.200 _refine.ls_number_reflns_obs 8275 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'BULK SOLVENT MODEL USED' _refine.ls_R_factor_R_work 0.209 _refine.ls_R_factor_R_free 0.247 _refine.ls_percent_reflns_R_free 5.000 _refine.ls_number_reflns_R_free 738 _refine.ls_R_factor_R_free_error 0.009 _refine.B_iso_mean 34.000 _refine.solvent_model_param_bsol 49.044 _refine.solvent_model_param_ksol 0.400 _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.aniso_B[1][1] -4.040 _refine.aniso_B[2][2] -4.040 _refine.aniso_B[3][3] 8.080 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.solvent_model_details 'FLAT MODEL' _refine.pdbx_ls_sigma_I 2 _refine.ls_number_reflns_all 16081 _refine.ls_R_factor_all 0.211 _refine.ls_R_factor_obs 0.21 _refine.ls_redundancy_reflns_obs ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.occupancy_max ? _refine.occupancy_min ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3LMF _refine_analyze.Luzzati_coordinate_error_obs 0.260 _refine_analyze.Luzzati_sigma_a_obs 0.090 _refine_analyze.Luzzati_d_res_low_obs 5.000 _refine_analyze.Luzzati_coordinate_error_free 0.330 _refine_analyze.Luzzati_sigma_a_free 0.120 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 822 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 32 _refine_hist.number_atoms_total 854 _refine_hist.d_res_high 2.300 _refine_hist.d_res_low 19.800 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d ? 0.006 ? ? 'X-RAY DIFFRACTION' ? c_angle_deg ? 0.900 ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d ? 16.300 ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d ? 0.680 ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 2.300 _refine_ls_shell.d_res_low 2.380 _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.percent_reflns_obs 83.400 _refine_ls_shell.number_reflns_R_work 1284 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.204 _refine_ls_shell.R_factor_R_free 0.298 _refine_ls_shell.percent_reflns_R_free 4.500 _refine_ls_shell.number_reflns_R_free 61 _refine_ls_shell.R_factor_R_free_error 0.038 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 1345 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 dna-rna_rep.param dna-rna.top 'X-RAY DIFFRACTION' 3 water_rep.param water.top 'X-RAY DIFFRACTION' 4 ion.param ion.top 'X-RAY DIFFRACTION' # _struct.entry_id 3LMF _struct.title 'Crystal Structure of Nmul_A1745 protein from Nitrosospira multiformis, Northeast Structural Genomics Consortium Target NmR72' _struct.pdbx_descriptor 'Uncharacterized protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3LMF _struct_keywords.text ;All alpha-helical protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Unknown function ; _struct_keywords.pdbx_keywords 'Structural Genomics, Unknown function' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 7 ? ASN A 31 ? THR A 7 ASN A 31 1 ? 25 HELX_P HELX_P2 2 ASN A 31 ? GLY A 37 ? ASN A 31 GLY A 37 1 ? 7 HELX_P HELX_P3 3 GLY A 38 ? VAL A 41 ? GLY A 38 VAL A 41 5 ? 4 HELX_P HELX_P4 4 GLU A 42 ? SER A 65 ? GLU A 42 SER A 65 1 ? 24 HELX_P HELX_P5 5 PHE A 69 ? LEU A 91 ? PHE A 69 LEU A 91 1 ? 23 HELX_P HELX_P6 6 MSE A 94 ? ALA A 113 ? MSE A 94 ALA A 113 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A ARG 27 C ? ? ? 1_555 A MSE 28 N ? ? A ARG 27 A MSE 28 1_555 ? ? ? ? ? ? ? 1.322 ? covale2 covale both ? A MSE 28 C ? ? ? 1_555 A ALA 29 N ? ? A MSE 28 A ALA 29 1_555 ? ? ? ? ? ? ? 1.327 ? covale3 covale both ? A ALA 29 C ? ? ? 1_555 A MSE 30 N ? ? A ALA 29 A MSE 30 1_555 ? ? ? ? ? ? ? 1.331 ? covale4 covale both ? A MSE 30 C ? ? ? 1_555 A ASN 31 N ? ? A MSE 30 A ASN 31 1_555 ? ? ? ? ? ? ? 1.328 ? covale5 covale both ? A LEU 48 C ? ? ? 1_555 A MSE 49 N ? ? A LEU 48 A MSE 49 1_555 ? ? ? ? ? ? ? 1.325 ? covale6 covale both ? A MSE 49 C ? ? ? 1_555 A MSE 50 N ? ? A MSE 49 A MSE 50 1_555 ? ? ? ? ? ? ? 1.332 ? covale7 covale both ? A MSE 50 C ? ? ? 1_555 A ASN 51 N ? ? A MSE 50 A ASN 51 1_555 ? ? ? ? ? ? ? 1.331 ? covale8 covale both ? A PHE 62 C ? ? ? 1_555 A MSE 63 N ? ? A PHE 62 A MSE 63 1_555 ? ? ? ? ? ? ? 1.325 ? covale9 covale both ? A MSE 63 C ? ? ? 1_555 A LEU 64 N ? ? A MSE 63 A LEU 64 1_555 ? ? ? ? ? ? ? 1.325 ? covale10 covale both ? A GLY 93 C ? ? ? 1_555 A MSE 94 N ? ? A GLY 93 A MSE 94 1_555 ? ? ? ? ? ? ? 1.327 ? covale11 covale both ? A MSE 94 C ? ? ? 1_555 A GLU 95 N ? ? A MSE 94 A GLU 95 1_555 ? ? ? ? ? ? ? 1.328 ? covale12 covale both ? A LYS 110 C ? ? ? 1_555 A MSE 111 N ? ? A LYS 110 A MSE 111 1_555 ? ? ? ? ? ? ? 1.332 ? covale13 covale both ? A MSE 111 C ? ? ? 1_555 A ALA 112 N ? ? A MSE 111 A ALA 112 1_555 ? ? ? ? ? ? ? 1.326 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 3LMF _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.000000 _database_PDB_matrix.origx_vector[2] 0.000000 _database_PDB_matrix.origx_vector[3] 0.000000 # _atom_sites.entry_id 3LMF _atom_sites.fract_transf_matrix[1][1] 0.010591 _atom_sites.fract_transf_matrix[1][2] 0.006115 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012230 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013757 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 PHE 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 TYR 4 4 ? ? ? A . n A 1 5 THR 5 5 ? ? ? A . n A 1 6 GLU 6 6 ? ? ? A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 MSE 28 28 28 MSE MSE A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 MSE 30 30 30 MSE MSE A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 MSE 49 49 49 MSE MSE A . n A 1 50 MSE 50 50 50 MSE MSE A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 MSE 63 63 63 MSE MSE A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 MSE 94 94 94 MSE MSE A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 CYS 97 97 97 CYS CYS A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 CYS 104 104 104 CYS CYS A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 CYS 108 108 108 CYS CYS A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 MSE 111 111 111 MSE MSE A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 HIS 116 116 ? ? ? A . n A 1 117 HIS 117 117 ? ? ? A . n A 1 118 HIS 118 118 ? ? ? A . n A 1 119 HIS 119 119 ? ? ? A . n A 1 120 HIS 120 120 ? ? ? A . n A 1 121 HIS 121 121 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 201 HOH HOH A . B 2 HOH 2 202 202 HOH HOH A . B 2 HOH 3 203 203 HOH HOH A . B 2 HOH 4 204 204 HOH HOH A . B 2 HOH 5 205 205 HOH HOH A . B 2 HOH 6 206 206 HOH HOH A . B 2 HOH 7 207 207 HOH HOH A . B 2 HOH 8 208 208 HOH HOH A . B 2 HOH 9 209 209 HOH HOH A . B 2 HOH 10 210 210 HOH HOH A . B 2 HOH 11 211 211 HOH HOH A . B 2 HOH 12 212 212 HOH HOH A . B 2 HOH 13 213 213 HOH HOH A . B 2 HOH 14 214 214 HOH HOH A . B 2 HOH 15 215 215 HOH HOH A . B 2 HOH 16 216 216 HOH HOH A . B 2 HOH 17 217 217 HOH HOH A . B 2 HOH 18 218 218 HOH HOH A . B 2 HOH 19 219 219 HOH HOH A . B 2 HOH 20 220 220 HOH HOH A . B 2 HOH 21 221 221 HOH HOH A . B 2 HOH 22 222 222 HOH HOH A . B 2 HOH 23 223 223 HOH HOH A . B 2 HOH 24 224 224 HOH HOH A . B 2 HOH 25 225 225 HOH HOH A . B 2 HOH 26 226 226 HOH HOH A . B 2 HOH 27 227 227 HOH HOH A . B 2 HOH 28 228 228 HOH HOH A . B 2 HOH 29 229 229 HOH HOH A . B 2 HOH 30 230 230 HOH HOH A . B 2 HOH 31 231 231 HOH HOH A . B 2 HOH 32 232 232 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 28 A MSE 28 ? MET SELENOMETHIONINE 2 A MSE 30 A MSE 30 ? MET SELENOMETHIONINE 3 A MSE 49 A MSE 49 ? MET SELENOMETHIONINE 4 A MSE 50 A MSE 50 ? MET SELENOMETHIONINE 5 A MSE 63 A MSE 63 ? MET SELENOMETHIONINE 6 A MSE 94 A MSE 94 ? MET SELENOMETHIONINE 7 A MSE 111 A MSE 111 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7720 ? 1 MORE -28 ? 1 'SSA (A^2)' 16620 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 47.2085000000 0.0000000000 -1.0000000000 0.0000000000 81.7675205491 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 7_555 y,x,-z+1/3 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 24.2293333333 4 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+1/3 0.5000000000 -0.8660254038 0.0000000000 47.2085000000 -0.8660254038 -0.5000000000 0.0000000000 81.7675205491 0.0000000000 0.0000000000 -1.0000000000 24.2293333333 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-02-16 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2019-07-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.contact_author' 2 3 'Structure model' '_software.contact_author_email' 3 3 'Structure model' '_software.language' 4 3 'Structure model' '_software.location' 5 3 'Structure model' '_software.name' 6 3 'Structure model' '_software.type' 7 3 'Structure model' '_software.version' 8 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal CNS '1.2 &XtalView' ? ? ? ? refinement ? ? ? 1 PDB_EXTRACT 3.00 'March. 27, 2007' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 2 ADSC Quantum ? ? ? ? 'data collection' ? ? ? 3 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 4 SCALEPACK . ? ? ? ? 'data scaling' ? ? ? 5 SHELX 'then SOLVE/RESOLVE' ? ? ? ? phasing ? ? ? 6 REFMAC . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran_77 ? 7 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLN _pdbx_validate_symm_contact.auth_seq_id_1 57 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OE1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 GLN _pdbx_validate_symm_contact.auth_seq_id_2 57 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 7_555 _pdbx_validate_symm_contact.dist 2.18 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 31 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -121.25 _pdbx_validate_torsion.psi -86.72 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A PHE 2 ? A PHE 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A TYR 4 ? A TYR 4 5 1 Y 1 A THR 5 ? A THR 5 6 1 Y 1 A GLU 6 ? A GLU 6 7 1 Y 1 A HIS 116 ? A HIS 116 8 1 Y 1 A HIS 117 ? A HIS 117 9 1 Y 1 A HIS 118 ? A HIS 118 10 1 Y 1 A HIS 119 ? A HIS 119 11 1 Y 1 A HIS 120 ? A HIS 120 12 1 Y 1 A HIS 121 ? A HIS 121 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #