data_3LUA # _entry.id 3LUA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.338 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3LUA RCSB RCSB057738 WWPDB D_1000057738 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id NYSGXRC-11201g _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3LUA _pdbx_database_status.recvd_initial_deposition_date 2010-02-17 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Satyanarayana, L.' 1 ? 'Burley, S.K.' 2 0000-0002-2487-9713 'Swaminathan, S.' 3 ? 'New York SGX Research Center for Structural Genomics (NYSGXRC)' 4 ? # _citation.id primary _citation.title 'Crystal structure of a Signal receiver domain of Two component Signal Transduction (Histidine Kinase) from Clostridium thermocellum' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Satyanarayana, L.' 1 ? primary 'Burley, S.K.' 2 0000-0002-2487-9713 primary 'Swaminathan, S.' 3 ? # _cell.entry_id 3LUA _cell.length_a 94.100 _cell.length_b 94.100 _cell.length_c 68.009 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3LUA _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Response regulator receiver protein' 16491.611 1 ? ? 'signal receiver domain residues 2-130' ? 2 water nat water 18.015 53 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)SLDGTVLLIDYFEYEREKTKIIFDNIGEYDFIEVENLKKFYSIFKDLDSITLII(MSE)DIAFPVEKEGLEVLSA IRNNSRTANTPVIIATKSDNPGYRHAALKFKVSDYILKPYPTKRLENSVRSVLKICQRFREGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSLDGTVLLIDYFEYEREKTKIIFDNIGEYDFIEVENLKKFYSIFKDLDSITLIIMDIAFPVEKEGLEVLSAIRNNSRTA NTPVIIATKSDNPGYRHAALKFKVSDYILKPYPTKRLENSVRSVLKICQRFREGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGXRC-11201g # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 SER n 1 3 LEU n 1 4 ASP n 1 5 GLY n 1 6 THR n 1 7 VAL n 1 8 LEU n 1 9 LEU n 1 10 ILE n 1 11 ASP n 1 12 TYR n 1 13 PHE n 1 14 GLU n 1 15 TYR n 1 16 GLU n 1 17 ARG n 1 18 GLU n 1 19 LYS n 1 20 THR n 1 21 LYS n 1 22 ILE n 1 23 ILE n 1 24 PHE n 1 25 ASP n 1 26 ASN n 1 27 ILE n 1 28 GLY n 1 29 GLU n 1 30 TYR n 1 31 ASP n 1 32 PHE n 1 33 ILE n 1 34 GLU n 1 35 VAL n 1 36 GLU n 1 37 ASN n 1 38 LEU n 1 39 LYS n 1 40 LYS n 1 41 PHE n 1 42 TYR n 1 43 SER n 1 44 ILE n 1 45 PHE n 1 46 LYS n 1 47 ASP n 1 48 LEU n 1 49 ASP n 1 50 SER n 1 51 ILE n 1 52 THR n 1 53 LEU n 1 54 ILE n 1 55 ILE n 1 56 MSE n 1 57 ASP n 1 58 ILE n 1 59 ALA n 1 60 PHE n 1 61 PRO n 1 62 VAL n 1 63 GLU n 1 64 LYS n 1 65 GLU n 1 66 GLY n 1 67 LEU n 1 68 GLU n 1 69 VAL n 1 70 LEU n 1 71 SER n 1 72 ALA n 1 73 ILE n 1 74 ARG n 1 75 ASN n 1 76 ASN n 1 77 SER n 1 78 ARG n 1 79 THR n 1 80 ALA n 1 81 ASN n 1 82 THR n 1 83 PRO n 1 84 VAL n 1 85 ILE n 1 86 ILE n 1 87 ALA n 1 88 THR n 1 89 LYS n 1 90 SER n 1 91 ASP n 1 92 ASN n 1 93 PRO n 1 94 GLY n 1 95 TYR n 1 96 ARG n 1 97 HIS n 1 98 ALA n 1 99 ALA n 1 100 LEU n 1 101 LYS n 1 102 PHE n 1 103 LYS n 1 104 VAL n 1 105 SER n 1 106 ASP n 1 107 TYR n 1 108 ILE n 1 109 LEU n 1 110 LYS n 1 111 PRO n 1 112 TYR n 1 113 PRO n 1 114 THR n 1 115 LYS n 1 116 ARG n 1 117 LEU n 1 118 GLU n 1 119 ASN n 1 120 SER n 1 121 VAL n 1 122 ARG n 1 123 SER n 1 124 VAL n 1 125 LEU n 1 126 LYS n 1 127 ILE n 1 128 CYS n 1 129 GLN n 1 130 ARG n 1 131 PHE n 1 132 ARG n 1 133 GLU n 1 134 GLY n 1 135 HIS n 1 136 HIS n 1 137 HIS n 1 138 HIS n 1 139 HIS n 1 140 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene '4809959, Cthe_3085' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 27405/DSM 1237' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details 'Top10 (Invitrogen)' _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Clostridium thermocellum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 203119 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3) Codon+RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'BC pSGX3 (BC)' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A3DK02_CLOTH _struct_ref.pdbx_db_accession A3DK02 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DGTVLLIDYFEYEREKTKIIFDNIGEYDFIEVENLKKFYSIFKDLDSITLIIMDIAFPVEKEGLEVLSAIRNNSRTANTP VIIATKSDNPGYRHAALKFKVSDYILKPYPTKRLENSVRSVLKICQRFR ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3LUA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 132 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A3DK02 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 130 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 130 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3LUA MSE A 1 ? UNP A3DK02 ? ? 'expression tag' -3 1 1 3LUA SER A 2 ? UNP A3DK02 ? ? 'expression tag' -2 2 1 3LUA LEU A 3 ? UNP A3DK02 ? ? 'expression tag' -1 3 1 3LUA GLU A 133 ? UNP A3DK02 ? ? 'expression tag' 131 4 1 3LUA GLY A 134 ? UNP A3DK02 ? ? 'expression tag' 132 5 1 3LUA HIS A 135 ? UNP A3DK02 ? ? 'expression tag' 133 6 1 3LUA HIS A 136 ? UNP A3DK02 ? ? 'expression tag' 134 7 1 3LUA HIS A 137 ? UNP A3DK02 ? ? 'expression tag' 135 8 1 3LUA HIS A 138 ? UNP A3DK02 ? ? 'expression tag' 136 9 1 3LUA HIS A 139 ? UNP A3DK02 ? ? 'expression tag' 137 10 1 3LUA HIS A 140 ? UNP A3DK02 ? ? 'expression tag' 138 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3LUA _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.64 _exptl_crystal.density_percent_sol 53.33 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 292 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details '0.2M Sodium acetate pH 7.0, 20% PEG 3,350, VAPOR DIFFUSION, SITTING DROP, temperature 292K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2009-11-26 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X29A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X29A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9792 # _reflns.entry_id 3LUA _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 2.4 _reflns.number_obs ? _reflns.number_all 26360 _reflns.percent_possible_obs 100.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.116 _reflns.pdbx_netI_over_sigmaI 6.2 _reflns.B_iso_Wilson_estimate 36.9 _reflns.pdbx_redundancy 10.9 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.40 _reflns_shell.d_res_low 2.49 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.779 _reflns_shell.meanI_over_sigI_obs 5.6 _reflns_shell.pdbx_redundancy 10.5 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 2615 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3LUA _refine.ls_number_reflns_obs 12710 _refine.ls_number_reflns_all 12710 _refine.pdbx_ls_sigma_I 0.0 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 47.05 _refine.ls_d_res_high 2.40 _refine.ls_percent_reflns_obs 96.2 _refine.ls_R_factor_obs 0.234 _refine.ls_R_factor_all 0.234 _refine.ls_R_factor_R_work 0.234 _refine.ls_R_factor_R_free 0.267 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 545 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 40.9 _refine.aniso_B[1][1] -2.98 _refine.aniso_B[2][2] -2.98 _refine.aniso_B[3][3] 5.95 _refine.aniso_B[1][2] 3.58 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model Isotropic _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3LUA _refine_analyze.Luzzati_coordinate_error_obs 0.32 _refine_analyze.Luzzati_sigma_a_obs 0.32 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.37 _refine_analyze.Luzzati_sigma_a_free 0.34 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1021 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 53 _refine_hist.number_atoms_total 1074 _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 47.05 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.6 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_degree 24.6 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_deg 0.85 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.d_res_high 2.40 _refine_ls_shell.d_res_low 2.55 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.R_factor_R_work 0.285 _refine_ls_shell.percent_reflns_obs 88.6 _refine_ls_shell.R_factor_R_free 0.322 _refine_ls_shell.R_factor_R_free_error 0.040 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 66 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 1879 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3LUA _struct.title 'Crystal structure of a Signal receiver domain of Two component Signal Transduction (Histidine Kinase) from Clostridium thermocellum' _struct.pdbx_descriptor 'Response regulator receiver protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3LUA _struct_keywords.pdbx_keywords 'Transcription regulator' _struct_keywords.text ;Two-component signal transduction system, Histidine Kinase, Phosphorelay, Receiver domain, 11201g, NYSGXRC, PSI-II, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, Transcription regulator ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PHE A 13 ? GLY A 28 ? PHE A 11 GLY A 26 1 ? 16 HELX_P HELX_P2 2 ASN A 37 ? SER A 43 ? ASN A 35 SER A 41 1 ? 7 HELX_P HELX_P3 3 VAL A 62 ? ASN A 76 ? VAL A 60 ASN A 74 1 ? 15 HELX_P HELX_P4 4 SER A 77 ? ALA A 80 ? SER A 75 ALA A 78 5 ? 4 HELX_P HELX_P5 5 ASN A 92 ? PHE A 102 ? ASN A 90 PHE A 100 1 ? 11 HELX_P HELX_P6 6 LYS A 115 ? LYS A 126 ? LYS A 113 LYS A 124 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ILE 55 C ? ? ? 1_555 A MSE 56 N ? ? A ILE 53 A MSE 54 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale2 covale both ? A MSE 56 C ? ? ? 1_555 A ASP 57 N ? ? A MSE 54 A ASP 55 1_555 ? ? ? ? ? ? ? 1.327 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PHE 60 A . ? PHE 58 A PRO 61 A ? PRO 59 A 1 -0.61 2 LYS 110 A . ? LYS 108 A PRO 111 A ? PRO 109 A 1 -0.04 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASP A 31 ? VAL A 35 ? ASP A 29 VAL A 33 A 2 THR A 6 ? ILE A 10 ? THR A 4 ILE A 8 A 3 LEU A 53 ? MSE A 56 ? LEU A 51 MSE A 54 A 4 VAL A 84 ? THR A 88 ? VAL A 82 THR A 86 A 5 ASP A 106 ? LEU A 109 ? ASP A 104 LEU A 107 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ASP A 31 ? O ASP A 29 N VAL A 7 ? N VAL A 5 A 2 3 N LEU A 8 ? N LEU A 6 O ILE A 55 ? O ILE A 53 A 3 4 N ILE A 54 ? N ILE A 52 O ILE A 85 ? O ILE A 83 A 4 5 N ILE A 86 ? N ILE A 84 O ILE A 108 ? O ILE A 106 # _database_PDB_matrix.entry_id 3LUA _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3LUA _atom_sites.fract_transf_matrix[1][1] 0.010627 _atom_sites.fract_transf_matrix[1][2] 0.006135 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012271 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014704 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 -3 ? ? ? A . n A 1 2 SER 2 -2 ? ? ? A . n A 1 3 LEU 3 -1 -1 LEU LEU A . n A 1 4 ASP 4 2 2 ASP ASP A . n A 1 5 GLY 5 3 3 GLY GLY A . n A 1 6 THR 6 4 4 THR THR A . n A 1 7 VAL 7 5 5 VAL VAL A . n A 1 8 LEU 8 6 6 LEU LEU A . n A 1 9 LEU 9 7 7 LEU LEU A . n A 1 10 ILE 10 8 8 ILE ILE A . n A 1 11 ASP 11 9 9 ASP ASP A . n A 1 12 TYR 12 10 10 TYR TYR A . n A 1 13 PHE 13 11 11 PHE PHE A . n A 1 14 GLU 14 12 12 GLU GLU A . n A 1 15 TYR 15 13 13 TYR TYR A . n A 1 16 GLU 16 14 14 GLU GLU A . n A 1 17 ARG 17 15 15 ARG ARG A . n A 1 18 GLU 18 16 16 GLU GLU A . n A 1 19 LYS 19 17 17 LYS LYS A . n A 1 20 THR 20 18 18 THR THR A . n A 1 21 LYS 21 19 19 LYS LYS A . n A 1 22 ILE 22 20 20 ILE ILE A . n A 1 23 ILE 23 21 21 ILE ILE A . n A 1 24 PHE 24 22 22 PHE PHE A . n A 1 25 ASP 25 23 23 ASP ASP A . n A 1 26 ASN 26 24 24 ASN ASN A . n A 1 27 ILE 27 25 25 ILE ILE A . n A 1 28 GLY 28 26 26 GLY GLY A . n A 1 29 GLU 29 27 27 GLU GLU A . n A 1 30 TYR 30 28 28 TYR TYR A . n A 1 31 ASP 31 29 29 ASP ASP A . n A 1 32 PHE 32 30 30 PHE PHE A . n A 1 33 ILE 33 31 31 ILE ILE A . n A 1 34 GLU 34 32 32 GLU GLU A . n A 1 35 VAL 35 33 33 VAL VAL A . n A 1 36 GLU 36 34 34 GLU GLU A . n A 1 37 ASN 37 35 35 ASN ASN A . n A 1 38 LEU 38 36 36 LEU LEU A . n A 1 39 LYS 39 37 37 LYS LYS A . n A 1 40 LYS 40 38 38 LYS LYS A . n A 1 41 PHE 41 39 39 PHE PHE A . n A 1 42 TYR 42 40 40 TYR TYR A . n A 1 43 SER 43 41 41 SER SER A . n A 1 44 ILE 44 42 42 ILE ILE A . n A 1 45 PHE 45 43 43 PHE PHE A . n A 1 46 LYS 46 44 44 LYS LYS A . n A 1 47 ASP 47 45 45 ASP ASP A . n A 1 48 LEU 48 46 46 LEU LEU A . n A 1 49 ASP 49 47 47 ASP ASP A . n A 1 50 SER 50 48 48 SER SER A . n A 1 51 ILE 51 49 49 ILE ILE A . n A 1 52 THR 52 50 50 THR THR A . n A 1 53 LEU 53 51 51 LEU LEU A . n A 1 54 ILE 54 52 52 ILE ILE A . n A 1 55 ILE 55 53 53 ILE ILE A . n A 1 56 MSE 56 54 54 MSE MSE A . n A 1 57 ASP 57 55 55 ASP ASP A . n A 1 58 ILE 58 56 56 ILE ILE A . n A 1 59 ALA 59 57 57 ALA ALA A . n A 1 60 PHE 60 58 58 PHE PHE A . n A 1 61 PRO 61 59 59 PRO PRO A . n A 1 62 VAL 62 60 60 VAL VAL A . n A 1 63 GLU 63 61 61 GLU GLU A . n A 1 64 LYS 64 62 62 LYS LYS A . n A 1 65 GLU 65 63 63 GLU GLU A . n A 1 66 GLY 66 64 64 GLY GLY A . n A 1 67 LEU 67 65 65 LEU LEU A . n A 1 68 GLU 68 66 66 GLU GLU A . n A 1 69 VAL 69 67 67 VAL VAL A . n A 1 70 LEU 70 68 68 LEU LEU A . n A 1 71 SER 71 69 69 SER SER A . n A 1 72 ALA 72 70 70 ALA ALA A . n A 1 73 ILE 73 71 71 ILE ILE A . n A 1 74 ARG 74 72 72 ARG ARG A . n A 1 75 ASN 75 73 73 ASN ASN A . n A 1 76 ASN 76 74 74 ASN ASN A . n A 1 77 SER 77 75 75 SER SER A . n A 1 78 ARG 78 76 76 ARG ARG A . n A 1 79 THR 79 77 77 THR THR A . n A 1 80 ALA 80 78 78 ALA ALA A . n A 1 81 ASN 81 79 79 ASN ASN A . n A 1 82 THR 82 80 80 THR THR A . n A 1 83 PRO 83 81 81 PRO PRO A . n A 1 84 VAL 84 82 82 VAL VAL A . n A 1 85 ILE 85 83 83 ILE ILE A . n A 1 86 ILE 86 84 84 ILE ILE A . n A 1 87 ALA 87 85 85 ALA ALA A . n A 1 88 THR 88 86 86 THR THR A . n A 1 89 LYS 89 87 87 LYS LYS A . n A 1 90 SER 90 88 88 SER SER A . n A 1 91 ASP 91 89 89 ASP ASP A . n A 1 92 ASN 92 90 90 ASN ASN A . n A 1 93 PRO 93 91 91 PRO PRO A . n A 1 94 GLY 94 92 92 GLY GLY A . n A 1 95 TYR 95 93 93 TYR TYR A . n A 1 96 ARG 96 94 94 ARG ARG A . n A 1 97 HIS 97 95 95 HIS HIS A . n A 1 98 ALA 98 96 96 ALA ALA A . n A 1 99 ALA 99 97 97 ALA ALA A . n A 1 100 LEU 100 98 98 LEU LEU A . n A 1 101 LYS 101 99 99 LYS LYS A . n A 1 102 PHE 102 100 100 PHE PHE A . n A 1 103 LYS 103 101 101 LYS LYS A . n A 1 104 VAL 104 102 102 VAL VAL A . n A 1 105 SER 105 103 103 SER SER A . n A 1 106 ASP 106 104 104 ASP ASP A . n A 1 107 TYR 107 105 105 TYR TYR A . n A 1 108 ILE 108 106 106 ILE ILE A . n A 1 109 LEU 109 107 107 LEU LEU A . n A 1 110 LYS 110 108 108 LYS LYS A . n A 1 111 PRO 111 109 109 PRO PRO A . n A 1 112 TYR 112 110 110 TYR TYR A . n A 1 113 PRO 113 111 111 PRO PRO A . n A 1 114 THR 114 112 112 THR THR A . n A 1 115 LYS 115 113 113 LYS LYS A . n A 1 116 ARG 116 114 114 ARG ARG A . n A 1 117 LEU 117 115 115 LEU LEU A . n A 1 118 GLU 118 116 116 GLU GLU A . n A 1 119 ASN 119 117 117 ASN ASN A . n A 1 120 SER 120 118 118 SER SER A . n A 1 121 VAL 121 119 119 VAL VAL A . n A 1 122 ARG 122 120 120 ARG ARG A . n A 1 123 SER 123 121 121 SER SER A . n A 1 124 VAL 124 122 122 VAL VAL A . n A 1 125 LEU 125 123 123 LEU LEU A . n A 1 126 LYS 126 124 124 LYS LYS A . n A 1 127 ILE 127 125 125 ILE ILE A . n A 1 128 CYS 128 126 ? ? ? A . n A 1 129 GLN 129 127 ? ? ? A . n A 1 130 ARG 130 128 ? ? ? A . n A 1 131 PHE 131 129 ? ? ? A . n A 1 132 ARG 132 130 ? ? ? A . n A 1 133 GLU 133 131 ? ? ? A . n A 1 134 GLY 134 132 ? ? ? A . n A 1 135 HIS 135 133 ? ? ? A . n A 1 136 HIS 136 134 ? ? ? A . n A 1 137 HIS 137 135 ? ? ? A . n A 1 138 HIS 138 136 ? ? ? A . n A 1 139 HIS 139 137 ? ? ? A . n A 1 140 HIS 140 138 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'New York SGX Research Center for Structural Genomics' _pdbx_SG_project.initial_of_center NYSGXRC # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 139 2 HOH TIP A . B 2 HOH 2 140 3 HOH TIP A . B 2 HOH 3 141 4 HOH TIP A . B 2 HOH 4 142 5 HOH TIP A . B 2 HOH 5 143 6 HOH TIP A . B 2 HOH 6 144 7 HOH TIP A . B 2 HOH 7 145 8 HOH TIP A . B 2 HOH 8 146 9 HOH TIP A . B 2 HOH 9 147 10 HOH TIP A . B 2 HOH 10 148 11 HOH TIP A . B 2 HOH 11 149 12 HOH TIP A . B 2 HOH 12 150 13 HOH TIP A . B 2 HOH 13 151 14 HOH TIP A . B 2 HOH 14 152 15 HOH TIP A . B 2 HOH 15 153 16 HOH TIP A . B 2 HOH 16 154 17 HOH TIP A . B 2 HOH 17 155 18 HOH TIP A . B 2 HOH 18 156 19 HOH TIP A . B 2 HOH 19 157 20 HOH TIP A . B 2 HOH 20 158 21 HOH TIP A . B 2 HOH 21 159 22 HOH TIP A . B 2 HOH 22 160 23 HOH TIP A . B 2 HOH 23 161 24 HOH TIP A . B 2 HOH 24 162 25 HOH TIP A . B 2 HOH 25 163 26 HOH TIP A . B 2 HOH 26 164 27 HOH TIP A . B 2 HOH 27 165 28 HOH TIP A . B 2 HOH 28 166 29 HOH TIP A . B 2 HOH 29 167 30 HOH TIP A . B 2 HOH 30 168 31 HOH TIP A . B 2 HOH 31 169 33 HOH TIP A . B 2 HOH 32 170 34 HOH TIP A . B 2 HOH 33 171 35 HOH TIP A . B 2 HOH 34 172 37 HOH TIP A . B 2 HOH 35 173 39 HOH TIP A . B 2 HOH 36 174 42 HOH TIP A . B 2 HOH 37 175 43 HOH TIP A . B 2 HOH 38 176 44 HOH TIP A . B 2 HOH 39 177 48 HOH TIP A . B 2 HOH 40 178 49 HOH TIP A . B 2 HOH 41 179 51 HOH TIP A . B 2 HOH 42 180 52 HOH TIP A . B 2 HOH 43 181 53 HOH TIP A . B 2 HOH 44 182 55 HOH TIP A . B 2 HOH 45 183 56 HOH TIP A . B 2 HOH 46 184 57 HOH TIP A . B 2 HOH 47 185 58 HOH TIP A . B 2 HOH 48 186 59 HOH TIP A . B 2 HOH 49 187 61 HOH TIP A . B 2 HOH 50 188 62 HOH TIP A . B 2 HOH 51 189 63 HOH TIP A . B 2 HOH 52 190 66 HOH TIP A . B 2 HOH 53 191 68 HOH TIP A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id MSE _pdbx_struct_mod_residue.label_seq_id 56 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id MSE _pdbx_struct_mod_residue.auth_seq_id 54 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id MET _pdbx_struct_mod_residue.details SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 177 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-03-23 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2011-11-16 4 'Structure model' 1 3 2021-02-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Atomic model' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' audit_author 2 4 'Structure model' citation_author 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_audit_author.identifier_ORCID' 2 4 'Structure model' '_citation_author.identifier_ORCID' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CBASS 'data collection' . ? 1 SHELXCD phasing . ? 2 SHARP phasing . ? 3 CNS refinement 1.1 ? 4 DENZO 'data reduction' . ? 5 HKL-2000 'data scaling' . ? 6 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 PHE _pdbx_validate_rmsd_angle.auth_seq_id_1 100 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PHE _pdbx_validate_rmsd_angle.auth_seq_id_2 100 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PHE _pdbx_validate_rmsd_angle.auth_seq_id_3 100 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 90.53 _pdbx_validate_rmsd_angle.angle_target_value 111.00 _pdbx_validate_rmsd_angle.angle_deviation -20.47 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.70 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -103.88 52.91 2 1 ILE A 42 ? ? -141.50 -14.11 3 1 THR A 112 ? ? -60.40 16.99 4 1 SER A 121 ? ? -69.07 -71.09 5 1 VAL A 122 ? ? -37.79 -36.33 6 1 LYS A 124 ? ? 75.78 159.59 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE -3 ? A MSE 1 2 1 Y 1 A SER -2 ? A SER 2 3 1 Y 1 A CYS 126 ? A CYS 128 4 1 Y 1 A GLN 127 ? A GLN 129 5 1 Y 1 A ARG 128 ? A ARG 130 6 1 Y 1 A PHE 129 ? A PHE 131 7 1 Y 1 A ARG 130 ? A ARG 132 8 1 Y 1 A GLU 131 ? A GLU 133 9 1 Y 1 A GLY 132 ? A GLY 134 10 1 Y 1 A HIS 133 ? A HIS 135 11 1 Y 1 A HIS 134 ? A HIS 136 12 1 Y 1 A HIS 135 ? A HIS 137 13 1 Y 1 A HIS 136 ? A HIS 138 14 1 Y 1 A HIS 137 ? A HIS 139 15 1 Y 1 A HIS 138 ? A HIS 140 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #