data_3LUO
# 
_entry.id   3LUO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.380 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3LUO         pdb_00003luo 10.2210/pdb3luo/pdb 
RCSB  RCSB057752   ?            ?                   
WWPDB D_1000057752 ?            ?                   
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
3CGM PDB 'Another crystal form of the same protein' unspecified 
3CGN PDB 'Another crystal form of the same protein' unspecified 
# 
_pdbx_database_status.entry_id                        3LUO 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2010-02-18 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Loew, C.'      1 ? 
'Neumann, P.'   2 ? 
'Weininger, U.' 3 ? 
'Stubbs, M.T.'  4 ? 
'Balbach, J.'   5 ? 
# 
_citation.id                        primary 
_citation.title                     
'Crystal Structure Determination and Functional Characterization of the Metallochaperone SlyD from Thermus thermophilus' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            398 
_citation.page_first                375 
_citation.page_last                 390 
_citation.year                      2010 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20230833 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2010.03.014 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Loew, C.'            1 ? 
primary 'Neumann, P.'         2 ? 
primary 'Tidow, H.'           3 ? 
primary 'Weininger, U.'       4 ? 
primary 'Haupt, C.'           5 ? 
primary 'Friedrich-Epler, B.' 6 ? 
primary 'Scholz, C.'          7 ? 
primary 'Stubbs, M.T.'        8 ? 
primary 'Balbach, J.'         9 ? 
# 
_cell.length_a           111.400 
_cell.length_b           111.400 
_cell.length_c           111.400 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3LUO 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              24 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'I 21 3' 
_symmetry.entry_id                         3LUO 
_symmetry.Int_Tables_number                199 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Peptidyl-prolyl cis-trans isomerase' 17400.234 1  5.2.1.8 ? ? ?                     
2 polymer     syn Suc-Ala-Leu-Pro-Phe-pNA               590.625   1  ?       ? ? 'The bound substrate' 
3 non-polymer syn 'ZINC ION'                            65.409    4  ?       ? ? ?                     
4 water       nat water                                 18.015    21 ?       ? ? ?                     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFP
EDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPSGHHHHHH
;
;MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFP
EDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPSGHHHHHH
;
A ? 
2 'polypeptide(L)' no yes '(SIN)ALPA(NIT)' XALPAX B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   VAL n 
1 4   GLY n 
1 5   GLN n 
1 6   ASP n 
1 7   LYS n 
1 8   VAL n 
1 9   VAL n 
1 10  THR n 
1 11  ILE n 
1 12  ARG n 
1 13  TYR n 
1 14  THR n 
1 15  LEU n 
1 16  GLN n 
1 17  VAL n 
1 18  GLU n 
1 19  GLY n 
1 20  GLU n 
1 21  VAL n 
1 22  LEU n 
1 23  ASP n 
1 24  GLN n 
1 25  GLY n 
1 26  GLU n 
1 27  LEU n 
1 28  SER n 
1 29  TYR n 
1 30  LEU n 
1 31  HIS n 
1 32  GLY n 
1 33  HIS n 
1 34  ARG n 
1 35  ASN n 
1 36  LEU n 
1 37  ILE n 
1 38  PRO n 
1 39  GLY n 
1 40  LEU n 
1 41  GLU n 
1 42  GLU n 
1 43  ALA n 
1 44  LEU n 
1 45  GLU n 
1 46  GLY n 
1 47  ARG n 
1 48  GLU n 
1 49  GLU n 
1 50  GLY n 
1 51  GLU n 
1 52  ALA n 
1 53  PHE n 
1 54  GLN n 
1 55  ALA n 
1 56  HIS n 
1 57  VAL n 
1 58  PRO n 
1 59  ALA n 
1 60  GLU n 
1 61  LYS n 
1 62  ALA n 
1 63  TYR n 
1 64  GLY n 
1 65  PRO n 
1 66  HIS n 
1 67  ASP n 
1 68  PRO n 
1 69  GLU n 
1 70  GLY n 
1 71  VAL n 
1 72  GLN n 
1 73  VAL n 
1 74  VAL n 
1 75  PRO n 
1 76  LEU n 
1 77  SER n 
1 78  ALA n 
1 79  PHE n 
1 80  PRO n 
1 81  GLU n 
1 82  ASP n 
1 83  ALA n 
1 84  GLU n 
1 85  VAL n 
1 86  VAL n 
1 87  PRO n 
1 88  GLY n 
1 89  ALA n 
1 90  GLN n 
1 91  PHE n 
1 92  TYR n 
1 93  ALA n 
1 94  GLN n 
1 95  ASP n 
1 96  MET n 
1 97  GLU n 
1 98  GLY n 
1 99  ASN n 
1 100 PRO n 
1 101 MET n 
1 102 PRO n 
1 103 LEU n 
1 104 THR n 
1 105 VAL n 
1 106 VAL n 
1 107 ALA n 
1 108 VAL n 
1 109 GLU n 
1 110 GLY n 
1 111 GLU n 
1 112 GLU n 
1 113 VAL n 
1 114 THR n 
1 115 VAL n 
1 116 ASP n 
1 117 PHE n 
1 118 ASN n 
1 119 HIS n 
1 120 PRO n 
1 121 LEU n 
1 122 ALA n 
1 123 GLY n 
1 124 LYS n 
1 125 ASP n 
1 126 LEU n 
1 127 ASP n 
1 128 PHE n 
1 129 GLN n 
1 130 VAL n 
1 131 GLU n 
1 132 VAL n 
1 133 VAL n 
1 134 LYS n 
1 135 VAL n 
1 136 ARG n 
1 137 GLU n 
1 138 ALA n 
1 139 THR n 
1 140 PRO n 
1 141 GLU n 
1 142 GLU n 
1 143 LEU n 
1 144 LEU n 
1 145 HIS n 
1 146 GLY n 
1 147 HIS n 
1 148 ALA n 
1 149 HIS n 
1 150 PRO n 
1 151 SER n 
1 152 GLY n 
1 153 HIS n 
1 154 HIS n 
1 155 HIS n 
1 156 HIS n 
1 157 HIS n 
1 158 HIS n 
2 1   SIN n 
2 2   ALA n 
2 3   LEU n 
2 4   PRO n 
2 5   ALA n 
2 6   NIT n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    HB8 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     300852 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET-VECTOR 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'THE PEPTIDE SUBSTRATE WAS PURCHASED FROM A COMPANY.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q5SLE7_THET8 Q5SLE7 1 
;MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFP
EDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAH
;
1 ? 
2 PDB 3LUO         3LUO   2 XALPAX 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3LUO A 1 ? 149 ? Q5SLE7 1 ? 149 ? 1 149 
2 2 3LUO B 1 ? 6   ? 3LUO   1 ? 6   ? 1 6   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3LUO PRO A 150 ? UNP Q5SLE7 ? ? 'expression tag' 150 1 
1 3LUO SER A 151 ? UNP Q5SLE7 ? ? 'expression tag' 151 2 
1 3LUO GLY A 152 ? UNP Q5SLE7 ? ? 'expression tag' 152 3 
1 3LUO HIS A 153 ? UNP Q5SLE7 ? ? 'expression tag' 153 4 
1 3LUO HIS A 154 ? UNP Q5SLE7 ? ? 'expression tag' 154 5 
1 3LUO HIS A 155 ? UNP Q5SLE7 ? ? 'expression tag' 155 6 
1 3LUO HIS A 156 ? UNP Q5SLE7 ? ? 'expression tag' 156 7 
1 3LUO HIS A 157 ? UNP Q5SLE7 ? ? 'expression tag' 157 8 
1 3LUO HIS A 158 ? UNP Q5SLE7 ? ? 'expression tag' 158 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ?                'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                'C5 H11 N O2 S'  149.211 
NIT non-polymer         . 4-NITROANILINE  PARANITROANILINE 'C6 H6 N2 O2'    138.124 
PHE 'L-peptide linking' y PHENYLALANINE   ?                'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                'C3 H7 N O3'     105.093 
SIN non-polymer         . 'SUCCINIC ACID' ?                'C4 H6 O4'       118.088 
THR 'L-peptide linking' y THREONINE       ?                'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ?                'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ?                'Zn 2'           65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          3LUO 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        ? 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      3.20 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   61.58 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;10MG/ML N-SUC-ALA-LEU-PRO-PHE-PNA, 2M AMMONIUM SULFATE, 5 % PEG 400, 100MM MES, PH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2009-06-12 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9841 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'BESSY BEAMLINE 14.1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9841 
_diffrn_source.pdbx_synchrotron_site       BESSY 
_diffrn_source.pdbx_synchrotron_beamline   14.1 
# 
_reflns.entry_id                     3LUO 
_reflns.d_resolution_high            2.550 
_reflns.number_obs                   7636 
_reflns.pdbx_Rmerge_I_obs            0.050 
_reflns.pdbx_netI_over_sigmaI        23.770 
_reflns.percent_possible_obs         99.700 
_reflns.B_iso_Wilson_estimate        68.806 
_reflns.observed_criterion_sigma_I   -3.00 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             20.0 
_reflns.number_all                   7658 
_reflns.pdbx_Rsym_value              0.054 
_reflns.pdbx_redundancy              7.35 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.55 
_reflns_shell.d_res_low              2.65 
_reflns_shell.number_measured_obs    5982 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      808 
_reflns_shell.Rmerge_I_obs           0.643 
_reflns_shell.meanI_over_sigI_obs    3.5 
_reflns_shell.pdbx_Rsym_value        0.662 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_redundancy        7.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      808 
_reflns_shell.percent_possible_all   100.00 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3LUO 
_refine.ls_d_res_high                            2.550 
_refine.ls_d_res_low                             19.693 
_refine.pdbx_ls_sigma_F                          1.24 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.930 
_refine.ls_number_reflns_obs                     7636 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'TLS parameters have been included in refinemnt' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.207 
_refine.ls_R_factor_R_work                       0.205 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.235 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.030 
_refine.ls_number_reflns_R_free                  731 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               94.308 
_refine.solvent_model_param_bsol                 92.506 
_refine.solvent_model_param_ksol                 0.407 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.aniso_B[1][1]                            0.000 
_refine.aniso_B[2][2]                            0.000 
_refine.aniso_B[3][3]                            0.000 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.330 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             0.800 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3CGM' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                215.89 
_refine.B_iso_min                                31.23 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.43 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3LUO 
_refine_analyze.Luzzati_coordinate_error_obs    0.33 
_refine_analyze.Luzzati_sigma_a_obs             0.36 
_refine_analyze.Luzzati_d_res_low_obs           8 
_refine_analyze.Luzzati_coordinate_error_free   0.34 
_refine_analyze.Luzzati_sigma_a_free            0.37 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1160 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             21 
_refine_hist.number_atoms_total               1185 
_refine_hist.d_res_high                       2.550 
_refine_hist.d_res_low                        19.693 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           1195 0.023  ? ? 'X-RAY DIFFRACTION' ? 
f_angle_d          1614 0.928  ? ? 'X-RAY DIFFRACTION' ? 
f_chiral_restr     174  0.058  ? ? 'X-RAY DIFFRACTION' ? 
f_plane_restr      219  0.004  ? ? 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 431  18.271 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
2.550 2.609  15 100.000 923 . 0.288 0.278 . 49 . 972  . . 'X-RAY DIFFRACTION' 
2.609 2.675  15 99.000  914 . 0.289 0.391 . 48 . 962  . . 'X-RAY DIFFRACTION' 
2.675 2.747  15 100.000 923 . 0.292 0.367 . 48 . 971  . . 'X-RAY DIFFRACTION' 
2.747 2.827  15 100.000 899 . 0.262 0.344 . 49 . 948  . . 'X-RAY DIFFRACTION' 
2.827 2.918  15 100.000 940 . 0.225 0.264 . 49 . 989  . . 'X-RAY DIFFRACTION' 
2.918 3.022  15 100.000 913 . 0.222 0.218 . 48 . 961  . . 'X-RAY DIFFRACTION' 
3.022 3.143  15 100.000 906 . 0.213 0.315 . 48 . 954  . . 'X-RAY DIFFRACTION' 
3.143 3.285  15 100.000 951 . 0.183 0.151 . 51 . 1002 . . 'X-RAY DIFFRACTION' 
3.285 3.458  15 100.000 892 . 0.163 0.239 . 46 . 938  . . 'X-RAY DIFFRACTION' 
3.458 3.673  15 100.000 936 . 0.189 0.312 . 50 . 986  . . 'X-RAY DIFFRACTION' 
3.673 3.954  15 100.000 923 . 0.182 0.191 . 50 . 973  . . 'X-RAY DIFFRACTION' 
3.954 4.348  15 100.000 900 . 0.160 0.210 . 47 . 947  . . 'X-RAY DIFFRACTION' 
4.348 4.969  15 100.000 928 . 0.139 0.186 . 49 . 977  . . 'X-RAY DIFFRACTION' 
4.969 6.227  15 100.000 920 . 0.170 0.164 . 48 . 968  . . 'X-RAY DIFFRACTION' 
6.227 19.694 15 100.000 925 . 0.254 0.225 . 51 . 976  . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3LUO 
_struct.title                     
'Crystal Structure and functional characterization of the thermophilic prolyl isomerase and chaperone SlyD' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3LUO 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            
'PROLYL CIS TRANS ISOMERASE, CHAPERONE FUNCTION, TWO DOMAIN PROTEIN, Ni(2+) Zn(2+) BINDING, SLYD, Isomerase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ILE A 37  ? GLU A 45  ? ILE A 37  GLU A 45  1 ? 9 
HELX_P HELX_P2 2 PRO A 58  ? ALA A 62  ? PRO A 58  ALA A 62  5 ? 5 
HELX_P HELX_P3 3 ASP A 67  ? GLU A 69  ? ASP A 67  GLU A 69  5 ? 3 
HELX_P HELX_P4 4 SER A 77  ? PHE A 79  ? SER A 77  PHE A 79  5 ? 3 
HELX_P HELX_P5 5 THR A 139 ? GLY A 146 ? THR A 139 GLY A 146 1 ? 8 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? B SIN 1   C4  ? ? ? 1_555 B ALA 2 N  ? ? B SIN 1   B ALA 2   1_555 ? ? ? ? ? ? ? 1.333 ? ? 
covale2 covale both ? B ALA 5   C   ? ? ? 1_555 B NIT 6 N1 ? ? B ALA 5   B NIT 6   1_555 ? ? ? ? ? ? ? 1.333 ? ? 
metalc1 metalc ?    ? A GLU 49  OE1 ? ? ? 1_555 F ZN  . ZN ? ? A GLU 49  A ZN  162 1_555 ? ? ? ? ? ? ? 2.213 ? ? 
metalc2 metalc ?    ? A GLU 49  OE2 ? ? ? 1_555 F ZN  . ZN ? ? A GLU 49  A ZN  162 1_555 ? ? ? ? ? ? ? 2.605 ? ? 
metalc3 metalc ?    ? A HIS 145 ND1 ? ? ? 1_555 D ZN  . ZN ? ? A HIS 145 A ZN  160 1_555 ? ? ? ? ? ? ? 2.280 ? ? 
metalc4 metalc ?    ? A HIS 147 NE2 ? ? ? 1_555 D ZN  . ZN ? ? A HIS 147 A ZN  160 1_555 ? ? ? ? ? ? ? 2.442 ? ? 
metalc5 metalc ?    ? A HIS 149 NE2 ? ? ? 1_555 D ZN  . ZN ? ? A HIS 149 A ZN  160 1_555 ? ? ? ? ? ? ? 2.074 ? ? 
metalc6 metalc ?    ? D ZN  .   ZN  ? ? ? 1_555 G HOH . O  ? ? A ZN  160 A HOH 163 1_555 ? ? ? ? ? ? ? 2.248 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LEU 
_struct_mon_prot_cis.label_seq_id           3 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LEU 
_struct_mon_prot_cis.auth_seq_id            3 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    4 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     4 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       5.04 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 20  ? LEU A 30  ? GLU A 20  LEU A 30  
A 2 LYS A 7   ? VAL A 17  ? LYS A 7   VAL A 17  
A 3 LEU A 126 ? GLU A 137 ? LEU A 126 GLU A 137 
A 4 ALA A 52  ? VAL A 57  ? ALA A 52  VAL A 57  
B 1 VAL A 71  ? PRO A 75  ? VAL A 71  PRO A 75  
B 2 GLU A 112 ? ASP A 116 ? GLU A 112 ASP A 116 
B 3 LEU A 103 ? GLU A 109 ? LEU A 103 GLU A 109 
B 4 ALA A 89  ? PHE A 91  ? ALA A 89  PHE A 91  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU A 20  ? O GLU A 20  N VAL A 17  ? N VAL A 17  
A 2 3 N VAL A 8   ? N VAL A 8   O ARG A 136 ? O ARG A 136 
A 3 4 O LEU A 126 ? O LEU A 126 N VAL A 57  ? N VAL A 57  
B 1 2 N GLN A 72  ? N GLN A 72  O VAL A 115 ? O VAL A 115 
B 2 3 O THR A 114 ? O THR A 114 N ALA A 107 ? N ALA A 107 
B 3 4 O LEU A 103 ? O LEU A 103 N PHE A 91  ? N PHE A 91  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 159 ? 5 'BINDING SITE FOR RESIDUE ZN A 159' 
AC2 Software A ZN 160 ? 4 'BINDING SITE FOR RESIDUE ZN A 160' 
AC3 Software A ZN 161 ? 5 'BINDING SITE FOR RESIDUE ZN A 161' 
AC4 Software A ZN 162 ? 1 'BINDING SITE FOR RESIDUE ZN A 162' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 GLY A 19  ? GLY A 19  . ? 24_545 ? 
2  AC1 5 GLU A 20  ? GLU A 20  . ? 24_545 ? 
3  AC1 5 ALA A 52  ? ALA A 52  . ? 9_555  ? 
4  AC1 5 GLU A 137 ? GLU A 137 . ? 1_555  ? 
5  AC1 5 HOH G .   ? HOH A 177 . ? 1_555  ? 
6  AC2 4 HIS A 145 ? HIS A 145 . ? 1_555  ? 
7  AC2 4 HIS A 147 ? HIS A 147 . ? 1_555  ? 
8  AC2 4 HIS A 149 ? HIS A 149 . ? 1_555  ? 
9  AC2 4 HOH G .   ? HOH A 163 . ? 1_555  ? 
10 AC3 5 TYR A 29  ? TYR A 29  . ? 1_555  ? 
11 AC3 5 LEU A 30  ? LEU A 30  . ? 1_555  ? 
12 AC3 5 ASN A 35  ? ASN A 35  . ? 1_555  ? 
13 AC3 5 HIS A 147 ? HIS A 147 . ? 1_555  ? 
14 AC3 5 ALA A 148 ? ALA A 148 . ? 1_555  ? 
15 AC4 1 GLU A 49  ? GLU A 49  . ? 1_555  ? 
# 
_atom_sites.entry_id                    3LUO 
_atom_sites.fract_transf_matrix[1][1]   0.008977 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008977 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008977 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   LYS 2   2   2   LYS LYS A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   GLN 5   5   5   GLN GLN A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   LYS 7   7   7   LYS LYS A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  ILE 11  11  11  ILE ILE A . n 
A 1 12  ARG 12  12  12  ARG ARG A . n 
A 1 13  TYR 13  13  13  TYR TYR A . n 
A 1 14  THR 14  14  14  THR THR A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  VAL 17  17  17  VAL VAL A . n 
A 1 18  GLU 18  18  18  GLU GLU A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  ASP 23  23  23  ASP ASP A . n 
A 1 24  GLN 24  24  24  GLN GLN A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  TYR 29  29  29  TYR TYR A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  HIS 31  31  31  HIS HIS A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  HIS 33  33  33  HIS HIS A . n 
A 1 34  ARG 34  34  34  ARG ARG A . n 
A 1 35  ASN 35  35  35  ASN ASN A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  ILE 37  37  37  ILE ILE A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  GLY 39  39  39  GLY GLY A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  ALA 43  43  43  ALA ALA A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  GLU 45  45  45  GLU GLU A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  GLN 54  54  54  GLN GLN A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  HIS 56  56  56  HIS HIS A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  HIS 66  66  66  HIS HIS A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  PRO 68  68  68  PRO PRO A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  GLU 81  81  ?   ?   ?   A . n 
A 1 82  ASP 82  82  ?   ?   ?   A . n 
A 1 83  ALA 83  83  ?   ?   ?   A . n 
A 1 84  GLU 84  84  ?   ?   ?   A . n 
A 1 85  VAL 85  85  ?   ?   ?   A . n 
A 1 86  VAL 86  86  ?   ?   ?   A . n 
A 1 87  PRO 87  87  87  PRO PRO A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  GLN 90  90  90  GLN GLN A . n 
A 1 91  PHE 91  91  91  PHE PHE A . n 
A 1 92  TYR 92  92  92  TYR TYR A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  GLN 94  94  94  GLN GLN A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  MET 96  96  96  MET MET A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 MET 101 101 101 MET MET A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 THR 104 104 104 THR THR A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 ALA 107 107 107 ALA ALA A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 ASN 118 118 118 ASN ASN A . n 
A 1 119 HIS 119 119 119 HIS HIS A . n 
A 1 120 PRO 120 120 120 PRO PRO A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 LYS 124 124 124 LYS LYS A . n 
A 1 125 ASP 125 125 125 ASP ASP A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 ASP 127 127 127 ASP ASP A . n 
A 1 128 PHE 128 128 128 PHE PHE A . n 
A 1 129 GLN 129 129 129 GLN GLN A . n 
A 1 130 VAL 130 130 130 VAL VAL A . n 
A 1 131 GLU 131 131 131 GLU GLU A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 PRO 140 140 140 PRO PRO A . n 
A 1 141 GLU 141 141 141 GLU GLU A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 HIS 145 145 145 HIS HIS A . n 
A 1 146 GLY 146 146 146 GLY GLY A . n 
A 1 147 HIS 147 147 147 HIS HIS A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 HIS 149 149 149 HIS HIS A . n 
A 1 150 PRO 150 150 150 PRO PRO A . n 
A 1 151 SER 151 151 151 SER SER A . n 
A 1 152 GLY 152 152 ?   ?   ?   A . n 
A 1 153 HIS 153 153 ?   ?   ?   A . n 
A 1 154 HIS 154 154 ?   ?   ?   A . n 
A 1 155 HIS 155 155 ?   ?   ?   A . n 
A 1 156 HIS 156 156 ?   ?   ?   A . n 
A 1 157 HIS 157 157 ?   ?   ?   A . n 
A 1 158 HIS 158 158 ?   ?   ?   A . n 
B 2 1   SIN 1   1   1   SIN SIN B . n 
B 2 2   ALA 2   2   2   ALA ALA B . n 
B 2 3   LEU 3   3   3   LEU LEU B . n 
B 2 4   PRO 4   4   4   PRO PRO B . n 
B 2 5   ALA 5   5   5   ALA ALA B . n 
B 2 6   NIT 6   6   6   NIT NIT B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 ZN  1  159 1  ZN  ZN  A . 
D 3 ZN  1  160 2  ZN  ZN  A . 
E 3 ZN  1  161 3  ZN  ZN  A . 
F 3 ZN  1  162 4  ZN  ZN  A . 
G 4 HOH 1  163 1  HOH HOH A . 
G 4 HOH 2  164 3  HOH HOH A . 
G 4 HOH 3  165 5  HOH HOH A . 
G 4 HOH 4  166 6  HOH HOH A . 
G 4 HOH 5  167 7  HOH HOH A . 
G 4 HOH 6  168 8  HOH HOH A . 
G 4 HOH 7  169 12 HOH HOH A . 
G 4 HOH 8  170 13 HOH HOH A . 
G 4 HOH 9  171 14 HOH HOH A . 
G 4 HOH 10 172 15 HOH HOH A . 
G 4 HOH 11 173 16 HOH HOH A . 
G 4 HOH 12 174 17 HOH HOH A . 
G 4 HOH 13 175 18 HOH HOH A . 
G 4 HOH 14 176 19 HOH HOH A . 
G 4 HOH 15 177 20 HOH HOH A . 
G 4 HOH 16 178 21 HOH HOH A . 
G 4 HOH 17 179 22 HOH HOH A . 
G 4 HOH 18 180 23 HOH HOH A . 
G 4 HOH 19 181 25 HOH HOH A . 
H 4 HOH 1  24  24 HOH HOH B . 
H 4 HOH 2  26  26 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    dimeric   2 
2 software_defined_assembly PISA hexameric 6 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1     A,B,C,D,E,F,G,H 
2 1,2,3 A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 6300  ? 
2 MORE         -386  ? 
2 'SSA (A^2)'  25740 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 
3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 
1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OE1 ? A GLU 49  ? A GLU 49  ? 1_555 ZN ? F ZN . ? A ZN 162 ? 1_555 OE2 ? A GLU 49  ? A GLU 49  ? 1_555 53.3  ? 
2 ND1 ? A HIS 145 ? A HIS 145 ? 1_555 ZN ? D ZN . ? A ZN 160 ? 1_555 NE2 ? A HIS 147 ? A HIS 147 ? 1_555 116.5 ? 
3 ND1 ? A HIS 145 ? A HIS 145 ? 1_555 ZN ? D ZN . ? A ZN 160 ? 1_555 NE2 ? A HIS 149 ? A HIS 149 ? 1_555 132.5 ? 
4 NE2 ? A HIS 147 ? A HIS 147 ? 1_555 ZN ? D ZN . ? A ZN 160 ? 1_555 NE2 ? A HIS 149 ? A HIS 149 ? 1_555 94.7  ? 
5 ND1 ? A HIS 145 ? A HIS 145 ? 1_555 ZN ? D ZN . ? A ZN 160 ? 1_555 O   ? G HOH .   ? A HOH 163 ? 1_555 116.8 ? 
6 NE2 ? A HIS 147 ? A HIS 147 ? 1_555 ZN ? D ZN . ? A ZN 160 ? 1_555 O   ? G HOH .   ? A HOH 163 ? 1_555 95.2  ? 
7 NE2 ? A HIS 149 ? A HIS 149 ? 1_555 ZN ? D ZN . ? A ZN 160 ? 1_555 O   ? G HOH .   ? A HOH 163 ? 1_555 93.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-03-31 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2014-02-26 
4 'Structure model' 1 3 2023-11-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 4 'Structure model' 'Refinement description'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' chem_comp_atom                
2 4 'Structure model' chem_comp_bond                
3 4 'Structure model' database_2                    
4 4 'Structure model' pdbx_initial_refinement_model 
5 4 'Structure model' pdbx_struct_conn_angle        
6 4 'Structure model' struct_conn                   
7 4 'Structure model' struct_ref_seq_dif            
8 4 'Structure model' struct_site                   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                        
2  4 'Structure model' '_database_2.pdbx_database_accession'         
3  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
4  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
5  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
8  4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
9  4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
16 4 'Structure model' '_pdbx_struct_conn_angle.value'               
17 4 'Structure model' '_struct_conn.pdbx_dist_value'                
18 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
19 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
20 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
21 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
22 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
23 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
26 4 'Structure model' '_struct_ref_seq_dif.details'                 
27 4 'Structure model' '_struct_site.pdbx_auth_asym_id'              
28 4 'Structure model' '_struct_site.pdbx_auth_comp_id'              
29 4 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 7.2791  -11.9273 -19.3250 0.4228 0.3342 0.5429 0.0799 0.0822  0.0681 0.7820 0.4777 1.7705  0.2454  
-0.0440 0.3618 0.3214  0.0001  -0.2449 -0.1575 0.1354 -0.2803 -0.2586 -0.0161 0.1942  
'X-RAY DIFFRACTION' 2 ? refined 19.9229 -25.8474 -43.2071 1.4281 1.0020 1.2107 0.2621 -0.0070 0.0502 1.5764 1.2920 -0.7523 -0.3475 
0.0706  0.8771 -0.0188 -0.0823 -0.1462 -0.4142 0.2669 -0.2203 0.2252  -0.5473 -0.2406 
'X-RAY DIFFRACTION' 3 ? refined 7.1653  -17.5696 -24.5964 0.7594 1.0162 0.8180 0.3224 0.1531  0.2085 2.0105 4.8183 2.3376  4.0425  
-1.4061 0.0585 -0.1098 -0.1955 0.2905  -0.1180 0.1118 0.0950  -0.0644 0.3993  0.8476  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 1   A 68  'CHAIN A AND (RESID 1:68 OR RESID 118:151)' ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 1 A 118 A 151 'CHAIN A AND (RESID 1:68 OR RESID 118:151)' ? ? ? ? ? 
'X-RAY DIFFRACTION' 3 2 A 69  A 117 'CHAIN A AND (RESID 69:117)'                ? ? ? ? ? 
'X-RAY DIFFRACTION' 4 3 B 1   B 6   'CHAIN B'                                   ? ? ? ? ? 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 XSCALE      .     ?               package 'Wolfgang Kabsch' ?                     'data processing' 
http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ?   ? 
2 PHENIX      .     ?               package 'Paul D. Adams'   PDAdams@lbl.gov       refinement        
http://www.phenix-online.org/                                               C++ ? 
3 PDB_EXTRACT 3.005 'June 11, 2008' package PDB               help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/                                   C++ ? 
4 MAR345dtb   .     ?               ?       ?                 ?                     'data collection' ? ?   ? 
5 XDS         .     ?               ?       ?                 ?                     'data reduction'  ? ?   ? 
6 XSCALE      .     ?               ?       ?                 ?                     'data scaling'    ? ?   ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 62  ? ? -118.98 -100.26 
2 1 ASN A 99  ? ? 70.84   80.08   
3 1 PRO A 100 ? ? -48.52  150.74  
4 1 ASN A 118 ? ? -49.08  159.19  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 81  ? A GLU 81  
2  1 Y 1 A ASP 82  ? A ASP 82  
3  1 Y 1 A ALA 83  ? A ALA 83  
4  1 Y 1 A GLU 84  ? A GLU 84  
5  1 Y 1 A VAL 85  ? A VAL 85  
6  1 Y 1 A VAL 86  ? A VAL 86  
7  1 Y 1 A GLY 152 ? A GLY 152 
8  1 Y 1 A HIS 153 ? A HIS 153 
9  1 Y 1 A HIS 154 ? A HIS 154 
10 1 Y 1 A HIS 155 ? A HIS 155 
11 1 Y 1 A HIS 156 ? A HIS 156 
12 1 Y 1 A HIS 157 ? A HIS 157 
13 1 Y 1 A HIS 158 ? A HIS 158 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
GLN N    N  N N 74  
GLN CA   C  N S 75  
GLN C    C  N N 76  
GLN O    O  N N 77  
GLN CB   C  N N 78  
GLN CG   C  N N 79  
GLN CD   C  N N 80  
GLN OE1  O  N N 81  
GLN NE2  N  N N 82  
GLN OXT  O  N N 83  
GLN H    H  N N 84  
GLN H2   H  N N 85  
GLN HA   H  N N 86  
GLN HB2  H  N N 87  
GLN HB3  H  N N 88  
GLN HG2  H  N N 89  
GLN HG3  H  N N 90  
GLN HE21 H  N N 91  
GLN HE22 H  N N 92  
GLN HXT  H  N N 93  
GLU N    N  N N 94  
GLU CA   C  N S 95  
GLU C    C  N N 96  
GLU O    O  N N 97  
GLU CB   C  N N 98  
GLU CG   C  N N 99  
GLU CD   C  N N 100 
GLU OE1  O  N N 101 
GLU OE2  O  N N 102 
GLU OXT  O  N N 103 
GLU H    H  N N 104 
GLU H2   H  N N 105 
GLU HA   H  N N 106 
GLU HB2  H  N N 107 
GLU HB3  H  N N 108 
GLU HG2  H  N N 109 
GLU HG3  H  N N 110 
GLU HE2  H  N N 111 
GLU HXT  H  N N 112 
GLY N    N  N N 113 
GLY CA   C  N N 114 
GLY C    C  N N 115 
GLY O    O  N N 116 
GLY OXT  O  N N 117 
GLY H    H  N N 118 
GLY H2   H  N N 119 
GLY HA2  H  N N 120 
GLY HA3  H  N N 121 
GLY HXT  H  N N 122 
HIS N    N  N N 123 
HIS CA   C  N S 124 
HIS C    C  N N 125 
HIS O    O  N N 126 
HIS CB   C  N N 127 
HIS CG   C  Y N 128 
HIS ND1  N  Y N 129 
HIS CD2  C  Y N 130 
HIS CE1  C  Y N 131 
HIS NE2  N  Y N 132 
HIS OXT  O  N N 133 
HIS H    H  N N 134 
HIS H2   H  N N 135 
HIS HA   H  N N 136 
HIS HB2  H  N N 137 
HIS HB3  H  N N 138 
HIS HD1  H  N N 139 
HIS HD2  H  N N 140 
HIS HE1  H  N N 141 
HIS HE2  H  N N 142 
HIS HXT  H  N N 143 
HOH O    O  N N 144 
HOH H1   H  N N 145 
HOH H2   H  N N 146 
ILE N    N  N N 147 
ILE CA   C  N S 148 
ILE C    C  N N 149 
ILE O    O  N N 150 
ILE CB   C  N S 151 
ILE CG1  C  N N 152 
ILE CG2  C  N N 153 
ILE CD1  C  N N 154 
ILE OXT  O  N N 155 
ILE H    H  N N 156 
ILE H2   H  N N 157 
ILE HA   H  N N 158 
ILE HB   H  N N 159 
ILE HG12 H  N N 160 
ILE HG13 H  N N 161 
ILE HG21 H  N N 162 
ILE HG22 H  N N 163 
ILE HG23 H  N N 164 
ILE HD11 H  N N 165 
ILE HD12 H  N N 166 
ILE HD13 H  N N 167 
ILE HXT  H  N N 168 
LEU N    N  N N 169 
LEU CA   C  N S 170 
LEU C    C  N N 171 
LEU O    O  N N 172 
LEU CB   C  N N 173 
LEU CG   C  N N 174 
LEU CD1  C  N N 175 
LEU CD2  C  N N 176 
LEU OXT  O  N N 177 
LEU H    H  N N 178 
LEU H2   H  N N 179 
LEU HA   H  N N 180 
LEU HB2  H  N N 181 
LEU HB3  H  N N 182 
LEU HG   H  N N 183 
LEU HD11 H  N N 184 
LEU HD12 H  N N 185 
LEU HD13 H  N N 186 
LEU HD21 H  N N 187 
LEU HD22 H  N N 188 
LEU HD23 H  N N 189 
LEU HXT  H  N N 190 
LYS N    N  N N 191 
LYS CA   C  N S 192 
LYS C    C  N N 193 
LYS O    O  N N 194 
LYS CB   C  N N 195 
LYS CG   C  N N 196 
LYS CD   C  N N 197 
LYS CE   C  N N 198 
LYS NZ   N  N N 199 
LYS OXT  O  N N 200 
LYS H    H  N N 201 
LYS H2   H  N N 202 
LYS HA   H  N N 203 
LYS HB2  H  N N 204 
LYS HB3  H  N N 205 
LYS HG2  H  N N 206 
LYS HG3  H  N N 207 
LYS HD2  H  N N 208 
LYS HD3  H  N N 209 
LYS HE2  H  N N 210 
LYS HE3  H  N N 211 
LYS HZ1  H  N N 212 
LYS HZ2  H  N N 213 
LYS HZ3  H  N N 214 
LYS HXT  H  N N 215 
MET N    N  N N 216 
MET CA   C  N S 217 
MET C    C  N N 218 
MET O    O  N N 219 
MET CB   C  N N 220 
MET CG   C  N N 221 
MET SD   S  N N 222 
MET CE   C  N N 223 
MET OXT  O  N N 224 
MET H    H  N N 225 
MET H2   H  N N 226 
MET HA   H  N N 227 
MET HB2  H  N N 228 
MET HB3  H  N N 229 
MET HG2  H  N N 230 
MET HG3  H  N N 231 
MET HE1  H  N N 232 
MET HE2  H  N N 233 
MET HE3  H  N N 234 
MET HXT  H  N N 235 
NIT N1   N  N N 236 
NIT C1   C  Y N 237 
NIT C2   C  Y N 238 
NIT C3   C  Y N 239 
NIT C4   C  Y N 240 
NIT N4   N  N N 241 
NIT ON1  O  N N 242 
NIT ON2  O  N N 243 
NIT C5   C  Y N 244 
NIT C6   C  Y N 245 
NIT HN11 H  N N 246 
NIT HN12 H  N N 247 
NIT H2   H  N N 248 
NIT H3   H  N N 249 
NIT H5   H  N N 250 
NIT H6   H  N N 251 
PHE N    N  N N 252 
PHE CA   C  N S 253 
PHE C    C  N N 254 
PHE O    O  N N 255 
PHE CB   C  N N 256 
PHE CG   C  Y N 257 
PHE CD1  C  Y N 258 
PHE CD2  C  Y N 259 
PHE CE1  C  Y N 260 
PHE CE2  C  Y N 261 
PHE CZ   C  Y N 262 
PHE OXT  O  N N 263 
PHE H    H  N N 264 
PHE H2   H  N N 265 
PHE HA   H  N N 266 
PHE HB2  H  N N 267 
PHE HB3  H  N N 268 
PHE HD1  H  N N 269 
PHE HD2  H  N N 270 
PHE HE1  H  N N 271 
PHE HE2  H  N N 272 
PHE HZ   H  N N 273 
PHE HXT  H  N N 274 
PRO N    N  N N 275 
PRO CA   C  N S 276 
PRO C    C  N N 277 
PRO O    O  N N 278 
PRO CB   C  N N 279 
PRO CG   C  N N 280 
PRO CD   C  N N 281 
PRO OXT  O  N N 282 
PRO H    H  N N 283 
PRO HA   H  N N 284 
PRO HB2  H  N N 285 
PRO HB3  H  N N 286 
PRO HG2  H  N N 287 
PRO HG3  H  N N 288 
PRO HD2  H  N N 289 
PRO HD3  H  N N 290 
PRO HXT  H  N N 291 
SER N    N  N N 292 
SER CA   C  N S 293 
SER C    C  N N 294 
SER O    O  N N 295 
SER CB   C  N N 296 
SER OG   O  N N 297 
SER OXT  O  N N 298 
SER H    H  N N 299 
SER H2   H  N N 300 
SER HA   H  N N 301 
SER HB2  H  N N 302 
SER HB3  H  N N 303 
SER HG   H  N N 304 
SER HXT  H  N N 305 
SIN C1   C  N N 306 
SIN O1   O  N N 307 
SIN O2   O  N N 308 
SIN C2   C  N N 309 
SIN C3   C  N N 310 
SIN C4   C  N N 311 
SIN O3   O  N N 312 
SIN O4   O  N N 313 
SIN HO2  H  N N 314 
SIN H21  H  N N 315 
SIN H22  H  N N 316 
SIN H31  H  N N 317 
SIN H32  H  N N 318 
SIN HO4  H  N N 319 
THR N    N  N N 320 
THR CA   C  N S 321 
THR C    C  N N 322 
THR O    O  N N 323 
THR CB   C  N R 324 
THR OG1  O  N N 325 
THR CG2  C  N N 326 
THR OXT  O  N N 327 
THR H    H  N N 328 
THR H2   H  N N 329 
THR HA   H  N N 330 
THR HB   H  N N 331 
THR HG1  H  N N 332 
THR HG21 H  N N 333 
THR HG22 H  N N 334 
THR HG23 H  N N 335 
THR HXT  H  N N 336 
TYR N    N  N N 337 
TYR CA   C  N S 338 
TYR C    C  N N 339 
TYR O    O  N N 340 
TYR CB   C  N N 341 
TYR CG   C  Y N 342 
TYR CD1  C  Y N 343 
TYR CD2  C  Y N 344 
TYR CE1  C  Y N 345 
TYR CE2  C  Y N 346 
TYR CZ   C  Y N 347 
TYR OH   O  N N 348 
TYR OXT  O  N N 349 
TYR H    H  N N 350 
TYR H2   H  N N 351 
TYR HA   H  N N 352 
TYR HB2  H  N N 353 
TYR HB3  H  N N 354 
TYR HD1  H  N N 355 
TYR HD2  H  N N 356 
TYR HE1  H  N N 357 
TYR HE2  H  N N 358 
TYR HH   H  N N 359 
TYR HXT  H  N N 360 
VAL N    N  N N 361 
VAL CA   C  N S 362 
VAL C    C  N N 363 
VAL O    O  N N 364 
VAL CB   C  N N 365 
VAL CG1  C  N N 366 
VAL CG2  C  N N 367 
VAL OXT  O  N N 368 
VAL H    H  N N 369 
VAL H2   H  N N 370 
VAL HA   H  N N 371 
VAL HB   H  N N 372 
VAL HG11 H  N N 373 
VAL HG12 H  N N 374 
VAL HG13 H  N N 375 
VAL HG21 H  N N 376 
VAL HG22 H  N N 377 
VAL HG23 H  N N 378 
VAL HXT  H  N N 379 
ZN  ZN   ZN N N 380 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HIS N   CA   sing N N 116 
HIS N   H    sing N N 117 
HIS N   H2   sing N N 118 
HIS CA  C    sing N N 119 
HIS CA  CB   sing N N 120 
HIS CA  HA   sing N N 121 
HIS C   O    doub N N 122 
HIS C   OXT  sing N N 123 
HIS CB  CG   sing N N 124 
HIS CB  HB2  sing N N 125 
HIS CB  HB3  sing N N 126 
HIS CG  ND1  sing Y N 127 
HIS CG  CD2  doub Y N 128 
HIS ND1 CE1  doub Y N 129 
HIS ND1 HD1  sing N N 130 
HIS CD2 NE2  sing Y N 131 
HIS CD2 HD2  sing N N 132 
HIS CE1 NE2  sing Y N 133 
HIS CE1 HE1  sing N N 134 
HIS NE2 HE2  sing N N 135 
HIS OXT HXT  sing N N 136 
HOH O   H1   sing N N 137 
HOH O   H2   sing N N 138 
ILE N   CA   sing N N 139 
ILE N   H    sing N N 140 
ILE N   H2   sing N N 141 
ILE CA  C    sing N N 142 
ILE CA  CB   sing N N 143 
ILE CA  HA   sing N N 144 
ILE C   O    doub N N 145 
ILE C   OXT  sing N N 146 
ILE CB  CG1  sing N N 147 
ILE CB  CG2  sing N N 148 
ILE CB  HB   sing N N 149 
ILE CG1 CD1  sing N N 150 
ILE CG1 HG12 sing N N 151 
ILE CG1 HG13 sing N N 152 
ILE CG2 HG21 sing N N 153 
ILE CG2 HG22 sing N N 154 
ILE CG2 HG23 sing N N 155 
ILE CD1 HD11 sing N N 156 
ILE CD1 HD12 sing N N 157 
ILE CD1 HD13 sing N N 158 
ILE OXT HXT  sing N N 159 
LEU N   CA   sing N N 160 
LEU N   H    sing N N 161 
LEU N   H2   sing N N 162 
LEU CA  C    sing N N 163 
LEU CA  CB   sing N N 164 
LEU CA  HA   sing N N 165 
LEU C   O    doub N N 166 
LEU C   OXT  sing N N 167 
LEU CB  CG   sing N N 168 
LEU CB  HB2  sing N N 169 
LEU CB  HB3  sing N N 170 
LEU CG  CD1  sing N N 171 
LEU CG  CD2  sing N N 172 
LEU CG  HG   sing N N 173 
LEU CD1 HD11 sing N N 174 
LEU CD1 HD12 sing N N 175 
LEU CD1 HD13 sing N N 176 
LEU CD2 HD21 sing N N 177 
LEU CD2 HD22 sing N N 178 
LEU CD2 HD23 sing N N 179 
LEU OXT HXT  sing N N 180 
LYS N   CA   sing N N 181 
LYS N   H    sing N N 182 
LYS N   H2   sing N N 183 
LYS CA  C    sing N N 184 
LYS CA  CB   sing N N 185 
LYS CA  HA   sing N N 186 
LYS C   O    doub N N 187 
LYS C   OXT  sing N N 188 
LYS CB  CG   sing N N 189 
LYS CB  HB2  sing N N 190 
LYS CB  HB3  sing N N 191 
LYS CG  CD   sing N N 192 
LYS CG  HG2  sing N N 193 
LYS CG  HG3  sing N N 194 
LYS CD  CE   sing N N 195 
LYS CD  HD2  sing N N 196 
LYS CD  HD3  sing N N 197 
LYS CE  NZ   sing N N 198 
LYS CE  HE2  sing N N 199 
LYS CE  HE3  sing N N 200 
LYS NZ  HZ1  sing N N 201 
LYS NZ  HZ2  sing N N 202 
LYS NZ  HZ3  sing N N 203 
LYS OXT HXT  sing N N 204 
MET N   CA   sing N N 205 
MET N   H    sing N N 206 
MET N   H2   sing N N 207 
MET CA  C    sing N N 208 
MET CA  CB   sing N N 209 
MET CA  HA   sing N N 210 
MET C   O    doub N N 211 
MET C   OXT  sing N N 212 
MET CB  CG   sing N N 213 
MET CB  HB2  sing N N 214 
MET CB  HB3  sing N N 215 
MET CG  SD   sing N N 216 
MET CG  HG2  sing N N 217 
MET CG  HG3  sing N N 218 
MET SD  CE   sing N N 219 
MET CE  HE1  sing N N 220 
MET CE  HE2  sing N N 221 
MET CE  HE3  sing N N 222 
MET OXT HXT  sing N N 223 
NIT N1  C1   sing N N 224 
NIT N1  HN11 sing N N 225 
NIT N1  HN12 sing N N 226 
NIT C1  C2   doub Y N 227 
NIT C1  C6   sing Y N 228 
NIT C2  C3   sing Y N 229 
NIT C2  H2   sing N N 230 
NIT C3  C4   doub Y N 231 
NIT C3  H3   sing N N 232 
NIT C4  N4   sing N N 233 
NIT C4  C5   sing Y N 234 
NIT N4  ON1  sing N N 235 
NIT N4  ON2  doub N N 236 
NIT C5  C6   doub Y N 237 
NIT C5  H5   sing N N 238 
NIT C6  H6   sing N N 239 
PHE N   CA   sing N N 240 
PHE N   H    sing N N 241 
PHE N   H2   sing N N 242 
PHE CA  C    sing N N 243 
PHE CA  CB   sing N N 244 
PHE CA  HA   sing N N 245 
PHE C   O    doub N N 246 
PHE C   OXT  sing N N 247 
PHE CB  CG   sing N N 248 
PHE CB  HB2  sing N N 249 
PHE CB  HB3  sing N N 250 
PHE CG  CD1  doub Y N 251 
PHE CG  CD2  sing Y N 252 
PHE CD1 CE1  sing Y N 253 
PHE CD1 HD1  sing N N 254 
PHE CD2 CE2  doub Y N 255 
PHE CD2 HD2  sing N N 256 
PHE CE1 CZ   doub Y N 257 
PHE CE1 HE1  sing N N 258 
PHE CE2 CZ   sing Y N 259 
PHE CE2 HE2  sing N N 260 
PHE CZ  HZ   sing N N 261 
PHE OXT HXT  sing N N 262 
PRO N   CA   sing N N 263 
PRO N   CD   sing N N 264 
PRO N   H    sing N N 265 
PRO CA  C    sing N N 266 
PRO CA  CB   sing N N 267 
PRO CA  HA   sing N N 268 
PRO C   O    doub N N 269 
PRO C   OXT  sing N N 270 
PRO CB  CG   sing N N 271 
PRO CB  HB2  sing N N 272 
PRO CB  HB3  sing N N 273 
PRO CG  CD   sing N N 274 
PRO CG  HG2  sing N N 275 
PRO CG  HG3  sing N N 276 
PRO CD  HD2  sing N N 277 
PRO CD  HD3  sing N N 278 
PRO OXT HXT  sing N N 279 
SER N   CA   sing N N 280 
SER N   H    sing N N 281 
SER N   H2   sing N N 282 
SER CA  C    sing N N 283 
SER CA  CB   sing N N 284 
SER CA  HA   sing N N 285 
SER C   O    doub N N 286 
SER C   OXT  sing N N 287 
SER CB  OG   sing N N 288 
SER CB  HB2  sing N N 289 
SER CB  HB3  sing N N 290 
SER OG  HG   sing N N 291 
SER OXT HXT  sing N N 292 
SIN C1  O1   doub N N 293 
SIN C1  O2   sing N N 294 
SIN C1  C2   sing N N 295 
SIN O2  HO2  sing N N 296 
SIN C2  C3   sing N N 297 
SIN C2  H21  sing N N 298 
SIN C2  H22  sing N N 299 
SIN C3  C4   sing N N 300 
SIN C3  H31  sing N N 301 
SIN C3  H32  sing N N 302 
SIN C4  O3   doub N N 303 
SIN C4  O4   sing N N 304 
SIN O4  HO4  sing N N 305 
THR N   CA   sing N N 306 
THR N   H    sing N N 307 
THR N   H2   sing N N 308 
THR CA  C    sing N N 309 
THR CA  CB   sing N N 310 
THR CA  HA   sing N N 311 
THR C   O    doub N N 312 
THR C   OXT  sing N N 313 
THR CB  OG1  sing N N 314 
THR CB  CG2  sing N N 315 
THR CB  HB   sing N N 316 
THR OG1 HG1  sing N N 317 
THR CG2 HG21 sing N N 318 
THR CG2 HG22 sing N N 319 
THR CG2 HG23 sing N N 320 
THR OXT HXT  sing N N 321 
TYR N   CA   sing N N 322 
TYR N   H    sing N N 323 
TYR N   H2   sing N N 324 
TYR CA  C    sing N N 325 
TYR CA  CB   sing N N 326 
TYR CA  HA   sing N N 327 
TYR C   O    doub N N 328 
TYR C   OXT  sing N N 329 
TYR CB  CG   sing N N 330 
TYR CB  HB2  sing N N 331 
TYR CB  HB3  sing N N 332 
TYR CG  CD1  doub Y N 333 
TYR CG  CD2  sing Y N 334 
TYR CD1 CE1  sing Y N 335 
TYR CD1 HD1  sing N N 336 
TYR CD2 CE2  doub Y N 337 
TYR CD2 HD2  sing N N 338 
TYR CE1 CZ   doub Y N 339 
TYR CE1 HE1  sing N N 340 
TYR CE2 CZ   sing Y N 341 
TYR CE2 HE2  sing N N 342 
TYR CZ  OH   sing N N 343 
TYR OH  HH   sing N N 344 
TYR OXT HXT  sing N N 345 
VAL N   CA   sing N N 346 
VAL N   H    sing N N 347 
VAL N   H2   sing N N 348 
VAL CA  C    sing N N 349 
VAL CA  CB   sing N N 350 
VAL CA  HA   sing N N 351 
VAL C   O    doub N N 352 
VAL C   OXT  sing N N 353 
VAL CB  CG1  sing N N 354 
VAL CB  CG2  sing N N 355 
VAL CB  HB   sing N N 356 
VAL CG1 HG11 sing N N 357 
VAL CG1 HG12 sing N N 358 
VAL CG1 HG13 sing N N 359 
VAL CG2 HG21 sing N N 360 
VAL CG2 HG22 sing N N 361 
VAL CG2 HG23 sing N N 362 
VAL OXT HXT  sing N N 363 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ZINC ION' ZN  
4 water      HOH 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   3CGM 
_pdbx_initial_refinement_model.details          'PDB ENTRY 3CGM' 
#