data_3LUU # _entry.id 3LUU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.365 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3LUU pdb_00003luu 10.2210/pdb3luu/pdb RCSB RCSB057758 ? ? WWPDB D_1000057758 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id 381806 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.SG_entry Y _pdbx_database_status.entry_id 3LUU _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-02-18 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Joint Center for Structural Genomics (JCSG)' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title ;Crystal structure of Protein with unknown function which belongs to Pfam DUF971 family (AFE_2189) from Acidithiobacillus ferrooxidans ATCC 23270 at 1.93 A resolution ; _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # _citation_author.citation_id primary _citation_author.name 'Joint Center for Structural Genomics (JCSG)' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # _cell.entry_id 3LUU _cell.length_a 82.943 _cell.length_b 82.943 _cell.length_c 32.806 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.pdbx_unique_axis ? _cell.Z_PDB 8 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3LUU _symmetry.Int_Tables_number 92 _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized protein' 11622.651 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 water nat water 18.015 45 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;G(MSE)SDPRTQPLEIRPL(MSE)ISRV(MSE)EVDWADGHTSRLTFEHLRVECPCAECKGHTPDQAQIVTGKEHVSVVE VVPVGHYAVQLHFSDGHNTGIFTWEYLRRLDAE ; _entity_poly.pdbx_seq_one_letter_code_can ;GMSDPRTQPLEIRPLMISRVMEVDWADGHTSRLTFEHLRVECPCAECKGHTPDQAQIVTGKEHVSVVEVVPVGHYAVQLH FSDGHNTGIFTWEYLRRLDAE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier 381806 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MSE n 1 3 SER n 1 4 ASP n 1 5 PRO n 1 6 ARG n 1 7 THR n 1 8 GLN n 1 9 PRO n 1 10 LEU n 1 11 GLU n 1 12 ILE n 1 13 ARG n 1 14 PRO n 1 15 LEU n 1 16 MSE n 1 17 ILE n 1 18 SER n 1 19 ARG n 1 20 VAL n 1 21 MSE n 1 22 GLU n 1 23 VAL n 1 24 ASP n 1 25 TRP n 1 26 ALA n 1 27 ASP n 1 28 GLY n 1 29 HIS n 1 30 THR n 1 31 SER n 1 32 ARG n 1 33 LEU n 1 34 THR n 1 35 PHE n 1 36 GLU n 1 37 HIS n 1 38 LEU n 1 39 ARG n 1 40 VAL n 1 41 GLU n 1 42 CYS n 1 43 PRO n 1 44 CYS n 1 45 ALA n 1 46 GLU n 1 47 CYS n 1 48 LYS n 1 49 GLY n 1 50 HIS n 1 51 THR n 1 52 PRO n 1 53 ASP n 1 54 GLN n 1 55 ALA n 1 56 GLN n 1 57 ILE n 1 58 VAL n 1 59 THR n 1 60 GLY n 1 61 LYS n 1 62 GLU n 1 63 HIS n 1 64 VAL n 1 65 SER n 1 66 VAL n 1 67 VAL n 1 68 GLU n 1 69 VAL n 1 70 VAL n 1 71 PRO n 1 72 VAL n 1 73 GLY n 1 74 HIS n 1 75 TYR n 1 76 ALA n 1 77 VAL n 1 78 GLN n 1 79 LEU n 1 80 HIS n 1 81 PHE n 1 82 SER n 1 83 ASP n 1 84 GLY n 1 85 HIS n 1 86 ASN n 1 87 THR n 1 88 GLY n 1 89 ILE n 1 90 PHE n 1 91 THR n 1 92 TRP n 1 93 GLU n 1 94 TYR n 1 95 LEU n 1 96 ARG n 1 97 ARG n 1 98 LEU n 1 99 ASP n 1 100 ALA n 1 101 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AFE_0852, AFE_2189' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 23270 / DSM 14882 / NCIB 8455' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Acidithiobacillus ferrooxidans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 243159 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain HK100 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name SpeedET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B7J6R7_ACIF2 _struct_ref.pdbx_db_accession B7J6R7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSDPRTQPLEIRPLMISRVMEVDWADGHTSRLTFEHLRVECPCAECKGHTPDQAQIVTGKEHVSVVEVVPVGHYAVQLHF SDGHNTGIFTWEYLRRLDAE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3LUU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 101 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B7J6R7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 100 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 100 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 3LUU _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code B7J6R7 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.crystals_number 1 _exptl.method 'X-RAY DIFFRACTION' _exptl.entry_id 3LUU # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.43 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 49.33 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 8.3 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.pdbx_details ;0.3000M magnesium chloride, 22.0000% polyethylene glycol 8000, 0.1M TRIS pH 8.3, NANODROP, VAPOR DIFFUSION, SITTING DROP, temperature 293K ; _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 325 mm CCD' _diffrn_detector.details 'Flat collimating mirror, toroid focusing mirror' _diffrn_detector.pdbx_collection_date 2010-01-25 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Double crystal monochromator' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.91837 1.0 2 0.97876 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.pdbx_wavelength_list 0.91837,0.97876 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.entry_id 3LUU _reflns.d_resolution_high 1.93 _reflns.d_resolution_low 41.471 _reflns.number_obs 8966 _reflns.pdbx_Rmerge_I_obs 0.146 _reflns.pdbx_netI_over_sigmaI 11.860 _reflns.percent_possible_obs 98.700 _reflns.B_iso_Wilson_estimate 24.109 _reflns.observed_criterion_sigma_I -3.00 _reflns.observed_criterion_sigma_F ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_redundancy 7.09 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 1.93 2.00 6364 ? 873 1.2110 1.97 ? ? ? ? ? 99.70 1 1 2.00 2.08 6294 ? 866 1.2110 2.5 ? ? ? ? ? 97.10 2 1 2.08 2.17 6020 ? 838 1.2110 3.2 ? ? ? ? ? 99.30 3 1 2.17 2.29 6654 ? 916 1.2110 4.1 ? ? ? ? ? 98.60 4 1 2.29 2.43 6169 ? 851 1.2110 5.9 ? ? ? ? ? 98.30 5 1 2.43 2.62 6461 ? 900 1.2110 7.1 ? ? ? ? ? 98.60 6 1 2.62 2.88 6348 ? 892 1.2110 10.9 ? ? ? ? ? 99.00 7 1 2.88 3.30 6465 ? 919 1.2110 15.6 ? ? ? ? ? 98.70 8 1 3.30 4.15 6348 ? 914 1.2110 26.6 ? ? ? ? ? 99.10 9 1 4.15 41.471 6470 ? 1007 1.2110 36.1 ? ? ? ? ? 98.60 10 1 # _refine.entry_id 3LUU _refine.ls_d_res_high 1.930 _refine.ls_d_res_low 41.471 _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 98.850 _refine.ls_number_reflns_obs 8946 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ;1. HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. 2. A MET-INHIBITION PROTOCOL WAS USED FOR SELENOMETHIONINE INCORPORATION DURING PROTEIN EXPRESSION. THE OCCUPANCY OF THE SE ATOMS IN THE MSE RESIDUES WAS REDUCED TO 0.75 FOR THE REDUCED SCATTERING POWER DUE TO PARTIAL S-MET INCORPORATION. 3. ATOM RECORDS CONTAIN RESIDUAL B FACTORS ONLY. 4. THE METAL ZINC WAS ASSIGNED AS ZINC (ZN) BASED ON X-RAY FLURORESCENCE SPECTROSCOPY AND ANOMALOUS DIFFERENCE FOURIERS. 5. CHLORIDE (CL) MODELED WAS PRESENT IN CRYSTALLIZATION CONDITION. ; _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.197 _refine.ls_R_factor_R_work 0.196 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.221 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 4.800 _refine.ls_number_reflns_R_free 427 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 24.957 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 0.560 _refine.aniso_B[2][2] 0.560 _refine.aniso_B[3][3] -1.110 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.952 _refine.correlation_coeff_Fo_to_Fc_free 0.941 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R 0.145 _refine.pdbx_overall_ESU_R_Free 0.131 _refine.overall_SU_ML 0.098 _refine.overall_SU_B 7.106 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 75.98 _refine.B_iso_min 6.89 _refine.occupancy_max 1.00 _refine.occupancy_min 0.37 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_starting_model ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 707 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 45 _refine_hist.number_atoms_total 754 _refine_hist.d_res_high 1.930 _refine_hist.d_res_low 41.471 # loop_ _refine_ls_restr.type _refine_ls_restr.pdbx_refine_id _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 'X-RAY DIFFRACTION' 745 0.015 0.021 ? ? r_bond_other_d 'X-RAY DIFFRACTION' 493 0.002 0.020 ? ? r_angle_refined_deg 'X-RAY DIFFRACTION' 1020 1.701 1.932 ? ? r_angle_other_deg 'X-RAY DIFFRACTION' 1195 1.055 3.000 ? ? r_dihedral_angle_1_deg 'X-RAY DIFFRACTION' 93 6.638 5.000 ? ? r_dihedral_angle_2_deg 'X-RAY DIFFRACTION' 35 31.569 22.000 ? ? r_dihedral_angle_3_deg 'X-RAY DIFFRACTION' 117 13.905 15.000 ? ? r_dihedral_angle_4_deg 'X-RAY DIFFRACTION' 7 14.000 15.000 ? ? r_chiral_restr 'X-RAY DIFFRACTION' 116 0.097 0.200 ? ? r_gen_planes_refined 'X-RAY DIFFRACTION' 829 0.006 0.021 ? ? r_gen_planes_other 'X-RAY DIFFRACTION' 160 0.001 0.020 ? ? r_mcbond_it 'X-RAY DIFFRACTION' 453 2.128 3.000 ? ? r_mcbond_other 'X-RAY DIFFRACTION' 180 0.520 3.000 ? ? r_mcangle_it 'X-RAY DIFFRACTION' 740 3.725 5.000 ? ? r_scbond_it 'X-RAY DIFFRACTION' 292 5.649 8.000 ? ? r_scangle_it 'X-RAY DIFFRACTION' 277 8.597 11.000 ? ? # _refine_ls_shell.d_res_high 1.930 _refine_ls_shell.d_res_low 1.980 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 100.000 _refine_ls_shell.number_reflns_R_work 606 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.269 _refine_ls_shell.R_factor_R_free 0.280 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 36 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 642 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3LUU _struct.title ;Crystal structure of Protein with unknown function which belongs to Pfam DUF971 family (AFE_2189) from Acidithiobacillus ferrooxidans ATCC 23270 at 1.93 A resolution ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.text ;AFE_2189, Pfam DUF971 family, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, quinone biosynthesis, BIOSYNTHETIC PROTEIN ; _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' _struct_keywords.entry_id 3LUU # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PHE A 35 ? GLU A 41 ? PHE A 34 GLU A 40 1 ? 7 HELX_P HELX_P2 2 TRP A 92 ? ASP A 99 ? TRP A 91 ASP A 98 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 15 C ? ? ? 1_555 A MSE 16 N ? ? A LEU 14 A MSE 15 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? A MSE 16 C ? ? ? 1_555 A ILE 17 N ? ? A MSE 15 A ILE 16 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale3 covale both ? A VAL 20 C ? ? ? 1_555 A MSE 21 N ? ? A VAL 19 A MSE 20 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale4 covale both ? A MSE 21 C ? ? ? 1_555 A GLU 22 N ? ? A MSE 20 A GLU 21 1_555 ? ? ? ? ? ? ? 1.322 ? ? metalc1 metalc ? ? A HIS 37 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 36 A ZN 101 1_555 ? ? ? ? ? ? ? 2.036 ? ? metalc2 metalc ? ? A GLU 41 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 40 A ZN 101 1_555 ? ? ? ? ? ? ? 2.021 ? ? metalc3 metalc ? ? A GLU 101 O ? ? ? 1_555 B ZN . ZN ? ? A GLU 100 A ZN 101 1_555 ? ? ? ? ? ? ? 2.043 ? ? metalc4 metalc ? ? A GLU 101 OXT ? ? ? 1_555 B ZN . ZN ? ? A GLU 100 A ZN 101 1_555 ? ? ? ? ? ? ? 2.344 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PRO A 9 ? LEU A 15 ? PRO A 8 LEU A 14 A 2 VAL A 20 ? TRP A 25 ? VAL A 19 TRP A 24 A 3 THR A 30 ? THR A 34 ? THR A 29 THR A 33 B 1 VAL A 66 ? VAL A 72 ? VAL A 65 VAL A 71 B 2 ALA A 76 ? PHE A 81 ? ALA A 75 PHE A 80 B 3 ILE A 89 ? THR A 91 ? ILE A 88 THR A 90 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 10 ? N LEU A 9 O ASP A 24 ? O ASP A 23 A 2 3 N MSE A 21 ? N MSE A 20 O LEU A 33 ? O LEU A 32 B 1 2 N VAL A 70 ? N VAL A 69 O GLN A 78 ? O GLN A 77 B 2 3 N VAL A 77 ? N VAL A 76 O PHE A 90 ? O PHE A 89 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 101 ? 4 'BINDING SITE FOR RESIDUE ZN A 101' AC2 Software A CL 102 ? 3 'BINDING SITE FOR RESIDUE CL A 102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 22 ? GLU A 21 . ? 4_454 ? 2 AC1 4 HIS A 37 ? HIS A 36 . ? 1_555 ? 3 AC1 4 GLU A 41 ? GLU A 40 . ? 1_555 ? 4 AC1 4 GLU A 101 ? GLU A 100 . ? 1_555 ? 5 AC2 3 THR A 34 ? THR A 33 . ? 1_555 ? 6 AC2 3 HIS A 37 ? HIS A 36 . ? 1_555 ? 7 AC2 3 HOH D . ? HOH A 117 . ? 4_454 ? # _atom_sites.entry_id 3LUU _atom_sites.fract_transf_matrix[1][1] 0.012057 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012057 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.030482 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL N O S SE ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 MSE 2 1 ? ? ? A . n A 1 3 SER 3 2 2 SER SER A . n A 1 4 ASP 4 3 3 ASP ASP A . n A 1 5 PRO 5 4 4 PRO PRO A . n A 1 6 ARG 6 5 5 ARG ARG A . n A 1 7 THR 7 6 6 THR THR A . n A 1 8 GLN 8 7 7 GLN GLN A . n A 1 9 PRO 9 8 8 PRO PRO A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 GLU 11 10 10 GLU GLU A . n A 1 12 ILE 12 11 11 ILE ILE A . n A 1 13 ARG 13 12 12 ARG ARG A . n A 1 14 PRO 14 13 13 PRO PRO A . n A 1 15 LEU 15 14 14 LEU LEU A . n A 1 16 MSE 16 15 15 MSE MSE A . n A 1 17 ILE 17 16 16 ILE ILE A . n A 1 18 SER 18 17 17 SER SER A . n A 1 19 ARG 19 18 18 ARG ARG A . n A 1 20 VAL 20 19 19 VAL VAL A . n A 1 21 MSE 21 20 20 MSE MSE A . n A 1 22 GLU 22 21 21 GLU GLU A . n A 1 23 VAL 23 22 22 VAL VAL A . n A 1 24 ASP 24 23 23 ASP ASP A . n A 1 25 TRP 25 24 24 TRP TRP A . n A 1 26 ALA 26 25 25 ALA ALA A . n A 1 27 ASP 27 26 26 ASP ASP A . n A 1 28 GLY 28 27 27 GLY GLY A . n A 1 29 HIS 29 28 28 HIS HIS A . n A 1 30 THR 30 29 29 THR THR A . n A 1 31 SER 31 30 30 SER SER A . n A 1 32 ARG 32 31 31 ARG ARG A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 THR 34 33 33 THR THR A . n A 1 35 PHE 35 34 34 PHE PHE A . n A 1 36 GLU 36 35 35 GLU GLU A . n A 1 37 HIS 37 36 36 HIS HIS A . n A 1 38 LEU 38 37 37 LEU LEU A . n A 1 39 ARG 39 38 38 ARG ARG A . n A 1 40 VAL 40 39 39 VAL VAL A . n A 1 41 GLU 41 40 40 GLU GLU A . n A 1 42 CYS 42 41 41 CYS CYS A . n A 1 43 PRO 43 42 42 PRO PRO A . n A 1 44 CYS 44 43 43 CYS CYS A . n A 1 45 ALA 45 44 ? ? ? A . n A 1 46 GLU 46 45 ? ? ? A . n A 1 47 CYS 47 46 ? ? ? A . n A 1 48 LYS 48 47 ? ? ? A . n A 1 49 GLY 49 48 ? ? ? A . n A 1 50 HIS 50 49 ? ? ? A . n A 1 51 THR 51 50 ? ? ? A . n A 1 52 PRO 52 51 ? ? ? A . n A 1 53 ASP 53 52 ? ? ? A . n A 1 54 GLN 54 53 ? ? ? A . n A 1 55 ALA 55 54 54 ALA ALA A . n A 1 56 GLN 56 55 55 GLN GLN A . n A 1 57 ILE 57 56 56 ILE ILE A . n A 1 58 VAL 58 57 57 VAL VAL A . n A 1 59 THR 59 58 58 THR THR A . n A 1 60 GLY 60 59 59 GLY GLY A . n A 1 61 LYS 61 60 60 LYS LYS A . n A 1 62 GLU 62 61 61 GLU GLU A . n A 1 63 HIS 63 62 62 HIS HIS A . n A 1 64 VAL 64 63 63 VAL VAL A . n A 1 65 SER 65 64 64 SER SER A . n A 1 66 VAL 66 65 65 VAL VAL A . n A 1 67 VAL 67 66 66 VAL VAL A . n A 1 68 GLU 68 67 67 GLU GLU A . n A 1 69 VAL 69 68 68 VAL VAL A . n A 1 70 VAL 70 69 69 VAL VAL A . n A 1 71 PRO 71 70 70 PRO PRO A . n A 1 72 VAL 72 71 71 VAL VAL A . n A 1 73 GLY 73 72 72 GLY GLY A . n A 1 74 HIS 74 73 73 HIS HIS A . n A 1 75 TYR 75 74 74 TYR TYR A . n A 1 76 ALA 76 75 75 ALA ALA A . n A 1 77 VAL 77 76 76 VAL VAL A . n A 1 78 GLN 78 77 77 GLN GLN A . n A 1 79 LEU 79 78 78 LEU LEU A . n A 1 80 HIS 80 79 79 HIS HIS A . n A 1 81 PHE 81 80 80 PHE PHE A . n A 1 82 SER 82 81 81 SER SER A . n A 1 83 ASP 83 82 82 ASP ASP A . n A 1 84 GLY 84 83 83 GLY GLY A . n A 1 85 HIS 85 84 84 HIS HIS A . n A 1 86 ASN 86 85 85 ASN ASN A . n A 1 87 THR 87 86 86 THR THR A . n A 1 88 GLY 88 87 87 GLY GLY A . n A 1 89 ILE 89 88 88 ILE ILE A . n A 1 90 PHE 90 89 89 PHE PHE A . n A 1 91 THR 91 90 90 THR THR A . n A 1 92 TRP 92 91 91 TRP TRP A . n A 1 93 GLU 93 92 92 GLU GLU A . n A 1 94 TYR 94 93 93 TYR TYR A . n A 1 95 LEU 95 94 94 LEU LEU A . n A 1 96 ARG 96 95 95 ARG ARG A . n A 1 97 ARG 97 96 96 ARG ARG A . n A 1 98 LEU 98 97 97 LEU LEU A . n A 1 99 ASP 99 98 98 ASP ASP A . n A 1 100 ALA 100 99 99 ALA ALA A . n A 1 101 GLU 101 100 100 GLU GLU A . n # _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Joint Center for Structural Genomics' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center JCSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 101 1 ZN ZN A . C 3 CL 1 102 2 CL CL A . D 4 HOH 1 103 3 HOH HOH A . D 4 HOH 2 104 4 HOH HOH A . D 4 HOH 3 105 5 HOH HOH A . D 4 HOH 4 106 6 HOH HOH A . D 4 HOH 5 107 7 HOH HOH A . D 4 HOH 6 108 8 HOH HOH A . D 4 HOH 7 109 9 HOH HOH A . D 4 HOH 8 110 10 HOH HOH A . D 4 HOH 9 111 11 HOH HOH A . D 4 HOH 10 112 12 HOH HOH A . D 4 HOH 11 113 13 HOH HOH A . D 4 HOH 12 114 14 HOH HOH A . D 4 HOH 13 115 15 HOH HOH A . D 4 HOH 14 116 16 HOH HOH A . D 4 HOH 15 117 17 HOH HOH A . D 4 HOH 16 118 18 HOH HOH A . D 4 HOH 17 119 19 HOH HOH A . D 4 HOH 18 120 20 HOH HOH A . D 4 HOH 19 121 21 HOH HOH A . D 4 HOH 20 122 22 HOH HOH A . D 4 HOH 21 123 23 HOH HOH A . D 4 HOH 22 124 24 HOH HOH A . D 4 HOH 23 125 25 HOH HOH A . D 4 HOH 24 126 26 HOH HOH A . D 4 HOH 25 127 27 HOH HOH A . D 4 HOH 26 128 28 HOH HOH A . D 4 HOH 27 129 29 HOH HOH A . D 4 HOH 28 130 30 HOH HOH A . D 4 HOH 29 131 31 HOH HOH A . D 4 HOH 30 132 32 HOH HOH A . D 4 HOH 31 133 33 HOH HOH A . D 4 HOH 32 134 34 HOH HOH A . D 4 HOH 33 135 35 HOH HOH A . D 4 HOH 34 136 36 HOH HOH A . D 4 HOH 35 137 37 HOH HOH A . D 4 HOH 36 138 38 HOH HOH A . D 4 HOH 37 139 39 HOH HOH A . D 4 HOH 38 140 40 HOH HOH A . D 4 HOH 39 141 41 HOH HOH A . D 4 HOH 40 142 42 HOH HOH A . D 4 HOH 41 143 43 HOH HOH A . D 4 HOH 42 144 44 HOH HOH A . D 4 HOH 43 145 45 HOH HOH A . D 4 HOH 44 146 46 HOH HOH A . D 4 HOH 45 147 47 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 16 A MSE 15 ? MET SELENOMETHIONINE 2 A MSE 21 A MSE 20 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 37 ? A HIS 36 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OE2 ? A GLU 41 ? A GLU 40 ? 1_555 109.4 ? 2 NE2 ? A HIS 37 ? A HIS 36 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 O ? A GLU 101 ? A GLU 100 ? 1_555 95.4 ? 3 OE2 ? A GLU 41 ? A GLU 40 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 O ? A GLU 101 ? A GLU 100 ? 1_555 119.1 ? 4 NE2 ? A HIS 37 ? A HIS 36 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OXT ? A GLU 101 ? A GLU 100 ? 1_555 151.6 ? 5 OE2 ? A GLU 41 ? A GLU 40 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OXT ? A GLU 101 ? A GLU 100 ? 1_555 86.3 ? 6 O ? A GLU 101 ? A GLU 100 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OXT ? A GLU 101 ? A GLU 100 ? 1_555 56.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-03-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-11-08 4 'Structure model' 1 3 2019-07-17 5 'Structure model' 1 4 2023-02-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Refinement description' 3 2 'Structure model' 'Version format compliance' 4 3 'Structure model' 'Refinement description' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' 'Refinement description' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' software 3 4 'Structure model' struct_conn 4 5 'Structure model' database_2 5 5 'Structure model' pdbx_struct_conn_angle 6 5 'Structure model' struct_conn 7 5 'Structure model' struct_ref_seq_dif 8 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.classification' 2 3 'Structure model' '_software.name' 3 4 'Structure model' '_software.classification' 4 4 'Structure model' '_software.contact_author' 5 4 'Structure model' '_software.contact_author_email' 6 4 'Structure model' '_software.language' 7 4 'Structure model' '_software.location' 8 4 'Structure model' '_software.name' 9 4 'Structure model' '_software.type' 10 4 'Structure model' '_software.version' 11 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 12 5 'Structure model' '_database_2.pdbx_DOI' 13 5 'Structure model' '_database_2.pdbx_database_accession' 14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 17 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 18 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 19 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 20 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 21 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 22 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 23 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 24 5 'Structure model' '_pdbx_struct_conn_angle.value' 25 5 'Structure model' '_struct_conn.pdbx_dist_value' 26 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 27 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 28 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 29 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 30 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 31 5 'Structure model' '_struct_ref_seq_dif.details' 32 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 33 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 34 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 12.2733 _pdbx_refine_tls.origin_y 31.4435 _pdbx_refine_tls.origin_z -3.1427 _pdbx_refine_tls.T[1][1] 0.0385 _pdbx_refine_tls.T[2][2] 0.0300 _pdbx_refine_tls.T[3][3] 0.0070 _pdbx_refine_tls.T[1][2] 0.0143 _pdbx_refine_tls.T[1][3] 0.0065 _pdbx_refine_tls.T[2][3] 0.0016 _pdbx_refine_tls.L[1][1] 1.2021 _pdbx_refine_tls.L[2][2] 1.7464 _pdbx_refine_tls.L[3][3] 1.2485 _pdbx_refine_tls.L[1][2] 0.4155 _pdbx_refine_tls.L[1][3] -0.3404 _pdbx_refine_tls.L[2][3] 0.3061 _pdbx_refine_tls.S[1][1] -0.0697 _pdbx_refine_tls.S[2][2] 0.0581 _pdbx_refine_tls.S[3][3] 0.0116 _pdbx_refine_tls.S[1][2] 0.0164 _pdbx_refine_tls.S[1][3] -0.0409 _pdbx_refine_tls.S[2][3] -0.0912 _pdbx_refine_tls.S[2][1] -0.1178 _pdbx_refine_tls.S[3][1] 0.0428 _pdbx_refine_tls.S[3][2] 0.0386 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 2 A 100 ? . . . . ? 'X-RAY DIFFRACTION' 2 1 A 101 A 102 ? . . . . ? 'X-RAY DIFFRACTION' 3 1 A 103 A 147 ? . . . . ? # _phasing.method MAD # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal REFMAC 5.5.0102 ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 1 PHENIX . ? package 'P.D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 2 SHELX . ? package 'George M. Sheldrick' gsheldr@shelx.uni-ac.gwdg.de phasing http://shelx.uni-ac.gwdg.de/SHELX/ Fortran_77 ? 3 MolProbity 3beta29 ? package 'D.C. & J.S. Richardson lab' molprobity@kinemage.biochem.duke.edu 'model building' http://kinemage.biochem.duke.edu/molprobity/ ? ? 4 XSCALE . ? package 'Wolfgang Kabsch' ? 'data scaling' http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ? ? 5 PDB_EXTRACT 3.006 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 6 XDS . ? ? ? ? 'data reduction' ? ? ? 7 SHELXD . ? ? ? ? phasing ? ? ? 8 autoSHARP . ? ? ? ? phasing ? ? ? 9 # _pdbx_entry_details.entry_id 3LUU _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THE CONSTRUCT WAS EXPRESSED WITH A PURIFICATION TAG MGSDKIHHHHHHENLYFQG. THE TAG WAS REMOVED WITH TEV PROTEASE LEAVING ONLY A GLYCINE (0) FOLLOWED BY THE TARGET SEQUENCE. ; _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 85 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -152.13 _pdbx_validate_torsion.psi -3.90 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 2 ? OG ? A SER 3 OG 2 1 Y 1 A GLN 7 ? CG ? A GLN 8 CG 3 1 Y 1 A GLN 7 ? CD ? A GLN 8 CD 4 1 Y 1 A GLN 7 ? OE1 ? A GLN 8 OE1 5 1 Y 1 A GLN 7 ? NE2 ? A GLN 8 NE2 6 1 Y 1 A CYS 43 ? SG ? A CYS 44 SG 7 1 Y 1 A ASN 85 ? CG ? A ASN 86 CG 8 1 Y 1 A ASN 85 ? OD1 ? A ASN 86 OD1 9 1 Y 1 A ASN 85 ? ND2 ? A ASN 86 ND2 10 1 Y 1 A GLU 92 ? CD ? A GLU 93 CD 11 1 Y 1 A GLU 92 ? OE1 ? A GLU 93 OE1 12 1 Y 1 A GLU 92 ? OE2 ? A GLU 93 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A MSE 1 ? A MSE 2 3 1 Y 1 A ALA 44 ? A ALA 45 4 1 Y 1 A GLU 45 ? A GLU 46 5 1 Y 1 A CYS 46 ? A CYS 47 6 1 Y 1 A LYS 47 ? A LYS 48 7 1 Y 1 A GLY 48 ? A GLY 49 8 1 Y 1 A HIS 49 ? A HIS 50 9 1 Y 1 A THR 50 ? A THR 51 10 1 Y 1 A PRO 51 ? A PRO 52 11 1 Y 1 A ASP 52 ? A ASP 53 12 1 Y 1 A GLN 53 ? A GLN 54 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'CHLORIDE ION' CL 4 water HOH #